CLUSTAL format seed alignment for MF_01937

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D2PVS5_KRIFD          ----------------------------------------MATPAQWIEGARPRTLPAAV
A6W5N5_KINRD          -MTRAGGPPSRLARWCVVPDPAEPSSPSSVPLPSSARTHRRATPGQWVSAARPRTLPAAV
MENA_MYCTU            ----------------------------------------MASFAQWVSGARPRTLPNAI
K0KFH5_SACES          ----------------------------------------MATVVQWISGTRPRTLPNSI
C4LLA5_CORK4          --MPHTPEQPSTPDSSSSDNSSEFDGRASSRRTHPRTPSRTVTAHDWLEAARPHTWANGF
R0JJJ1_CORCT          --MSHTEPQPNS-----------------------------VTLSDWIQGARPHTWANAF
D6Z868_SEGRD          ----------------------------------------MATLRQWAQGARPRTFPNAL
E8NG47_MICTS          -------MAAQSRKRSRPAPKRRPHGNPQKHKSGAPQAVAPATARDWIAAARLRTLPLAI
B0RCZ9_CLAMS          --------------------------------------MRTATARDWISGARIRTLPLAV
B2GHK2_KOCRD          ----------------------------------------MATPAQWVEGARLRTLPMAA
E1VYH2_GLUAR          ----------------------------------------MATLSQWVSGARLRTLPIVI
E3H075_ROTDC          ----------------------------------------MATPAEWIEGARLRTLPLAL
F5XLQ4_MICPN          --------------------------------MSIDVTQPRPTAAQWLAGARPRTLPAAI
I6Y0M1_PSEPQ          -----------------------------------------MSFSTWVAGARPRTLPAAA
M5A1W1_9ACTN          -------------------------------------------MNRWMIGARLRTLPAAV
C7MFJ4_BRAFD          ----------------------------------------MASLSQWVQGARPRTLPAAL
C7M0N6_ACIFD          ----------------------------------------MAQVGAWIAGARPRTLPASV
D6ZKM9_MOBCV          ----------------------------------------MATAQAWIEGARLRTLPASA
K4IN59_BIFAP          -----------------------------------------MNIRLWMDGMRPRTLPASV
K4IPV7_BIFAP          ---------------------------------------MFITLREYKDALRPSALLCSP
A1A0C5_BIFAA          MWASVPPEPSLKNKRAITKGRSQYGSALLHTLAHPTSNMRFMEISTWIRGARLKTLPLAI
B8DW73_BIFA0          -----------------------------------------MQFHDYVSGMRIPTLMLGI
B3DQI5_BIFLD          -----------------------------------------MSIGLWVRGARPKTLATSI
I3WJK0_BIFBI          -----------------------------------------MTVKLWISGARPKTLTTSL
Q83H01_TROWT          -----------------------------MALEKRRRKKKRSLILPWLLASRPATLIVSL
MENA_ECOLI            ----------------------------------MTEQQ-ISRTQAWLESLRPKTLPLAF
B7LA27_ECO55          ----------------------------------MTEQQ-ISRTQAWLESLRPKTLPLAF
Q57HC7_SALCH          ----------------------------------MTEQQQISRTQAWLESLRPKTLPLAF
C0Q440_SALPC          ------------------------------MALNMTEQQQISRTQAWLESLRPKTLPLAF
A0A0H3BR13_SALNS      ------------------------------MALNMTEQQQISRTQAWLESLRPKTLPLAF
A0A0H3H3Z8_KLEOK      ----------------------------------MTEHA-ITRTQAWLESLRPKTLPLAF
A0A0H3FLY7_KLEAK      ----------------------------------MTEQP-ITRTKAWLESLRPKTLPLAF
W1EQ74_KLEPN          ----------------------------------MTD---ISRSQAWLESLRPKTLPLAF
C5BB80_EDWI9          ----------------------------------MTSLTPISRPRAWLESLRLRTLPLAL
A0A384L2R4_YERPE      ----------------------------------MSLSINTSQTQAWLESLRPRTLPLAF
A0A433N1U4_9GAMM      ----------------------------------MTLSTHSSKTKAWLDSLRPKTLPLAF
H8NV38_RAHAQ          -------------------------------MSTITPFTPTTPARAWLESLRPKTLPLAF
D3V6W0_XENBS          ----------------------------------MNSTTSISQMQAWLESLRPKTLPLAV
Q6LVI4_PHOPR          -----------------------MRHNTLSTVFLSTLIMKSSSLAIWLDAARPKTLPLAI
B0UV43_HISS2          --------------------------------------MANNNVKMWFETARPKTLPLAA
MENA_HAEIN            ---------------------------------MRSKKMINEKLKMWWETARPKTLPLAL
A0A378NC05_MANHA      -------------------------------------MNKNSLFSIWFTTARPKTLPLAL
K0G771_ACTSU          -------------------------------------MDKHSAFSIWFTTARPRTLPLAL
G1UB90_HAEDU          -------------------------------------MNKRSIFSNWFITARPKTLPLAL
F0LRU4_VIBFN          ---------------------------------------MNNSLRIWFDAARPKTLPLAL
Q9KNQ8_VIBCH          ---------------------------------------MNNSVQIWLDAARPKTLPLAL
I4AJL1_BERLS          -----------------------------------------MNLKAWIEAARLRTLPLAL
Q11YA0_CYTH3          ----------------------------------------MAAVTHWIKAFRLRTLPLAL
G0J314_CYCMS          -------------------------------------MTIFTKKQAWIHALRLRTLPLAL
I2EY83_EMTOG          -------------------------------------------MKHWLSAARPRTLPLAL
D2QBD3_SPILD          -------------------------------------------MKSWIAAARPRTLPLAL
E4RUU5_LEAB4          -------------------------------------------MKKWISAARLRTLPLAL
E4T4N3_PALPW          ------------------------------------------MIKPWIQAFRLKTLPLAL
G8R827_OWEHD          -----------------------------------------MDIKPWIAAARLRTLPLAF
C7M701_CAPOD          ---MKVGAGVLKSFLEKSIKQKELLEYIIVFVISICNFAGSMDIITLLKAARLRTLPLSV
H1ZAR9_MYROD          ----------------------------------------MSKTKTWVSAARLRTLPLSI
D5BHI6_ZUNPS          ----------------------------------------MRKINSWVNAARLRTLPLSI
G0L7N0_ZOBGA          ----------------------------------------MTKVGPWINAARLRTLPLSV
F0RAE4_CELLC          -----------------------------------------MKLKAWVNAARLRTLPLSI
G2PK12_MURRD          ----------------------------------------MGNTKAWVQAARLRTLPLSL
H8XPE4_FLAIG          -------------------------------------------MKNWIQAARLRTLPLSV
F2IBY0_FLUTR          ----------------------------------------MANSSDWISALRLRTLPLSI
E4TBG6_RIEAD          -------------------------------------------MKHWIQAARLRTLPLSL
I4A276_ORNRL          -------------------------------------------MKIWIHAARLRTLPLSL
A0KFP0_AERHH          ---------------------------------MFGHHNMTNTLSIWLLAARLRTLPLAC
C4L9G5_TOLAT          ---------------------------------MSGRMNKPR-WKIWLQAARLRTLPLAC
A1SRV4_PSYIN          ----------------------------------------MSNISVWLSELRLRTLPLAA
D5ESR9_PRER2          ---------------------------------------MTDSAKAWLLAARPKTLSGAA
I6ZRI5_MELRP          -------------------------------------------------------MPAAV
I0AJ70_IGNAJ          -------------------------------------MKSENKFQYWILASRPKTLPAAV
B3EKW4_CHLPB          -----------------------------MTEGTLQGQSSTSRFQAWMLAIRPKTLPAGA
B3QXE0_CHLT3          ---------------------------MNTKPPSIQPAPKVSAVEAWMHAIRPKTLPAGA
A7NL00_ROSCS          -------------------------------MNLSLSPSRPGRLRAWVLAARPQTLPAAV
A9WBE2_CHLAA          -------------------------------MTTKATSVPPSHLKIWLMASRPATLPAAV
B9L3E1_THERP          --------------------------MSVPVSDPARMPGRGASWRVWWLGARPATLVAAI
D0LH50_HALO1          ---------------------------MPPEFTPSPPPVTPGSWRAWLLAARPATLSAAV
I0I761_CALAS          -----------------------------------MATQTITRRQAWILAARPKTLPAAL
E4NMD2_HALBP          -----------------------------------MSTQDISRTKAWVMAARPQTLPAAA
A0A1U7EWI7_NATPD      ------------------------------------MTAAASSTKAWLMAARPQTLPAGA
L0IAV4_HALRX          ---------------------------------MTTAESNVSPTSAWLMAARPQTLPAAI
Q07ZK1_SHEFN          --------------------------------------MQPSSMQSWFMAIRPRTLPAAI
Q12NM3_SHEDO          -------------------MLAPQISISLENGFMTQDTTDISQTRAWLMAIRPRTLPAVL
Q6APS3_DESPS          -----------------------------------MENEKLTKWDLWLLAIRPKTLPAAV
B1ZZ52_OPITP          --------------------------------------MKPSFWHIWISAARPRTLPAAI
D5EKA8_CORAD          ----------------------------------------MGSLSVWIEATRPKTLPAAL
F8L8Z7_SIMNZ          -------------------------------------------MNVWIEGARPKTLIASL
Q2S2V4_SALRD          -------------MRLYERSSCLLQPPDYSLMNDSTDAQDVSQARVWLWAARPKTLGAAV
C7RR98_ACCPU          --------------------MRPLPGRRVRRALLVSASGQPSRLGCWWLAIRPKTLTVSL
G8QJX2_AZOOP          ----------------------------MNASTLASLS-RPTPGQAWWLALRPRTLPVAA
C4ZL14_THASP          ------------------------------MTPPHPAPSRPGTLAVWWAAIRPRTLGMAL
A1WW86_HALHL          ----------------------------MDRSMTQMSP-RPSWPTIVWHAIRPRTLPLSL
Q2RNW3_RHORT          ----------------------------MKDDRPPPTPQRPPSPLVWWAAARPRTLGLSL
H6SP86_PARPM          ----------------------------MHPSRP-----RPSWLRVWTLAARPHTLPLSA
W5X374_BDEBC          -------------------------------------MNTQSKFKSILLAFRPKTLTAAL
D6YW76_WADCW          -------------------------------------------MKSWLLASRPKTLTAAF
Q6MCB2_PARUW          ------------------------------------MIDQLTRLKPWMLASRPRTLPICL
B2UL43_AKKM8          ----------------------------------------MNIITSAFLAARPKTLTASL
B8FA11_DESAL          ---------------------------------------MNDQTKHWIMAIRPRTLPAGA
E1X1B0_HALMS          ---------------------------------------MNNKLSAWIQASRPKTLPAAC
Q7MT15_PORGI          ----------------------------------MSNNGSPPRLKAWLALLRPHTLPASV
F4KKK2_PORAD          -----------------------------------------MTLKQFISVSRPYSWPASL
H8MKQ6_CORCM          ------------------------MATPSLPSSSVAVEAKPSLARIWWVALRPKTLTASI
W8YD75_BACTU          ----------------------------------MGTEKEISSAKLIWKMTRPHTLTATF
Q81BK6_BACCR          ----------------------------------MGTEKEISSAKLIWKMTRPHTLTATF
A0A0F6FRY2_BACTK      ----------------------------------MGTEKEISSAKLIWKMTRPHTLTATF
A0A0F7RFG2_BACAN      ----------------------------------MGTEKEISSAKLIWKMTRPHTLTATF
MENA_BACSU            -------------------------MNQTNKGEGQTAPQKESMGQILWQLTRPHTLTASF
F2F7P2_SOLSS          ---------------------------------MTKVVEADKGIKVWWHLTRPHTLTASF
B1YK29_EXIS2          ---------------------------------------MNKSIAVYWRMTRPHTLTASF
I0JPY9_HALH3          -------------------------MSSVPNQNMKASLNEREGFQVWWRLLRPHTLTAAF
Q8Y6K7_LISMO          -----------------------------MANASKSALTKQTGFQKWWTLLRPHTLVASF
A0AJD1_LISW6          -----------------------------MANASKSALTKQTGFQKWWSLLRPHTLVASF
Q4L545_STAHJ          ---------------------------------MANQYQQYSTVRKYWHLMRPHTLTAAV
A0A0E1VIS7_STAA3      ---------------------------------MSNQYQQYSTVKKYWHLMRPHTLTASV
A0A166NHB3_STAPS      ---------------------------------MTSQFEKHSTFHKYWQLMRPHTLTASV
B9E7P8_MACCJ          ---------------------------------MSEHLQTQSGFKKYYHLMRPHTLTASF
C8WXX2_ALIAD          -------------------------------------MTGASRLRVWWRVLRPFTLTASI
Q67QI7_SYMTH          -------------------------------------MAVRARFGVWWRMLRPFTLVASV
Q1AUL4_RUBXD          ------------------------------MEQSRDRKAQGGAAAEWFRLARPFSLTASA
D8GIH8_CLOLD          ---------------------------------------MKQKFKIWLMAARPFSLTASI
Q9X1L4_THEMA          --------------------------------------------MKYFVAVRPFSFVASA
A2BMF3_HYPBU          ----------------------------------------MPRALEVFISTRPWSFPMTI
B8FCL3_DESAL          --------------------------------MKKYYIMGMNTMKTWFLATRPWSFAMSL
Q1MQB4_LAWIP          ------------------------------------------MLYTWIIATRPWSFTAAL
Q1MQB6_LAWIP          ------------------------------------------MLYQWIIASRPWTFTAAF
B8CY37_HALOH          ---------------------------------------MLNTIKKWLIAIRPFGFATTL
I4C2Q9_DESTA          --------------------------------------MTHERLGAWIQASRVPFFVATL
F3ZW58_MAHA5          ---------------------MYVYLQPIMGIIYVKYMRGVEMIGNIMRLARTPFLGASA
                                                                                  

D2PVS5_KRIFD          APVLVGTGAAAYLDG--FVWWK-------------------------------------A
A6W5N5_KINRD          TPVLVGTGSAAALDA--VSWGT-------------------------------------A
MENA_MYCTU            APVVAGTGAAAWLHA--AVWWK-------------------------------------A
K0KFH5_SACES          APVLVGAGAAHHIDG--FDLTW-------------------------------------S
C4LLA5_CORK4          APVIAGTGAAALTGQ--ASIIR-------------------------------------A
R0JJJ1_CORCT          APVIAGSGVAAFHDG--FVWWK-------------------------------------A
D6Z868_SEGRD          APVLLGSAAAAADGGGGFLWWK-------------------------------------A
E8NG47_MICTS          TPVLIGTGAASLV--DDQLHWA------------------------------------LA
B0RCZ9_CLAMS          APVAIGAGAARAMGPDEGVSLG------------------------------------LA
B2GHK2_KOCRD          APVIAGTAAAQAMFGA-RIGPA--------------------------------------
E1VYH2_GLUAR          APVVIGTAAALGEAETVHWFRF--------------------------------------
E3H075_ROTDC          APIIAGSAAAY-EIDAFKPWYA--------------------------------------
F5XLQ4_MICPN          SPVLAGTGVAAWAGGFAPL---------------------------------------QA
I6Y0M1_PSEPQ          APILAGVAAGLGTTPAPPLWR----------------------------------LILLP
M5A1W1_9ACTN          VPVALGAACGLGTPRELGWWSGDG---------------------VVVSADHVGVVWWRV
C7MFJ4_BRAFD          APVAAGTGAAVWQLSELPGGV------------------------------DWTVVVPRA
C7M0N6_ACIFD          APVLAATGLAAHLHHAVVLRA---------------------------------------
D6ZKM9_MOBCV          APVLLGTGIAAGLGKMDPGLA---------------------------------------
K4IN59_BIFAP          APVCVGASAALLKRSRLLEQCTSS--------------CSPTPVDPDLKATTPGRLALIV
K4IPV7_BIFAP          TPVLIGTAAALRQ---LLSQGSG----------------------PD------ARFWLIA
A1A0C5_BIFAA          APVVIGATLSWRGVFLYSQGGDIWHEPCPFFGGQHDLSELKFGSLVGECQRSAGWFILVA
B8DW73_BIFA0          APVLIGVSAACRVIGMRGADG---------------LPACGILTASSACDAGTGRIITLG
B3DQI5_BIFLD          ASVMVGATMAYAHIEQSGTCIAIY------------PEPASCATAREQQTLLMDRFWPVT
I3WJK0_BIFBI          SSVVVGACCAYPVIVGDLNCAQTR------------SDTSQCAAVTADAQAMMSRFWLVT
Q83H01_TROWT          SAVSLGWGAALLTVTGRKASL------------------------------------LLV
MENA_ECOLI            AAIIVGTALAWWQ---------------------------------------GHFDPLVA
B7LA27_ECO55          AAIIVGTALAWWQ---------------------------------------GHFDPLVA
Q57HC7_SALCH          AAIIVGTALAWWQ---------------------------------------GYFDPLVA
C0Q440_SALPC          AAIIVGTALAWWQ---------------------------------------GYFDPLVA
A0A0H3BR13_SALNS      AAIIVGTALAWWQ---------------------------------------GYFDPLVA
A0A0H3H3Z8_KLEOK      AAIIVGSALAWHQ---------------------------------------GSFDPWVA
A0A0H3FLY7_KLEAK      SAIIVGTALAWQQ---------------------------------------GHFDPLVA
W1EQ74_KLEPN          AAIIVGTVLAWEQ---------------------------------------GHFDPWVA
C5BB80_EDWI9          ASIVTGSAIAAWQ---------------------------------------QTFNLGIA
A0A384L2R4_YERPE      ASIVTGSALAVWL---------------------------------------DSFKPAVA
A0A433N1U4_9GAMM      ASIVTGSAIASWH---------------------------------------SSFKPGVA
H8NV38_RAHAQ          ASIVMGSAIASLQ---------------------------------------GVFHPLIA
D3V6W0_XENBS          AAVVSGSALAAWT---------------------------------------GHFKWPVA
Q6LVI4_PHOPR          ASIVCGSAVAGWQ---------------------------------------GSFSASIA
B0UV43_HISS2          ASIMTGSALAYWS---------------------------------------QQFSWTTT
MENA_HAEIN            ASIFTGSALGYWANP-------------------------------------QGFNGLVM
A0A378NC05_MANHA      ASIIVGSALAHWA---------------------------------------GKFDVVTT
K0G771_ACTSU          ASIIVGSALAYWA---------------------------------------GHFDVITT
G1UB90_HAEDU          ASIMVGSALANWV---------------------------------------GQFDWVTN
F0LRU4_VIBFN          VSIFTGSALAFSS---------------------------------------GHFSLPVA
Q9KNQ8_VIBCH          ISILTGSALAFSA---------------------------------------GNFHWLIA
I4AJL1_BERLS          ASMLMGCFLAVMN---------------------------------------NFFDIKIA
Q11YA0_CYTH3          SSIGMAGFLAFDH---------------------------------------KHFNTPVF
G0J314_CYCMS          SSIFMGSFIAYQK---------------------------------------SGFRWSVL
I2EY83_EMTOG          ASIFMGGFLAASV---------------------------------------GKFDWLIF
D2QBD3_SPILD          ASIILGSFLAFAN---------------------------------------QHFDWKIA
E4RUU5_LEAB4          SSILMGGFLAQSV---------------------------------------FMFRWDVF
E4T4N3_PALPW          ANTIIGSCLAASD---------------------------------------DGFRWSVF
G8R827_OWEHD          SSIILGTCLAASM---------------------------------------GSYSITVF
C7M701_CAPOD          AGIITGSALAFRE-------------------------------------DPYAFRWEIF
H1ZAR9_MYROD          SGIIVGTACAFPYY------------------------------------ANHANFYLIF
D5BHI6_ZUNPS          SGILVGSTIAAQQ---------------------------------------GYFSLGIF
G0L7N0_ZOBGA          SGVVVGSALANLY---------------------------------------GVQDMLIF
F0RAE4_CELLC          SGIIVGYALASLY---------------------------------------GFNNSTIF
G2PK12_MURRD          SGIIVGTALAMIE---------------------------------------GQFELPIF
H8XPE4_FLAIG          SGILVGSAYAYYQ---------------------------------------NQFDGIIF
F2IBY0_FLUTR          SGILVGSFIAVFQ---------------------------------------GFWNPIIF
E4TBG6_RIEAD          SGIITGAFVAKWKLKE----------------------------------TGGTWDIWIL
I4A276_ORNRL          SGIILGGFIAQFY---------------------------------------HSFDILLF
A0KFP0_AERHH          SSILLGSGLAASR---------------------------------------GAFDGTIM
C4L9G5_TOLAT          AAVLLGSGLAAGA---------------------------------------DQFRNSVF
A1SRV4_PSYIN          ASIILGAGIAIQA---------------------------------------QIFDLLIF
D5ESR9_PRER2          VPVMIGVALAYSDAAQYGE---------------------------------GTFSWVAA
I6ZRI5_MELRP          VPVLVGTSIAVYDGM---------------------------------------FNPAAA
I0AJ70_IGNAJ          VPVMVGSALAINQGK---------------------------------------FYPLYS
B3EKW4_CHLPB          VPVVVGTALAAVDGK---------------------------------------MLPIAA
B3QXE0_CHLT3          MPVVLGAALALADGK---------------------------------------FSLWPA
A7NL00_ROSCS          APVIVGSAAAFAAGS---------------------------------------FRWLPF
A9WBE2_CHLAA          VPVLVGSALAYSSDA---------------------------------------FQPLVM
B9L3E1_THERP          GPVLVGTAAGVREAGT--------------------------------------IRWLPF
D0LH50_HALO1          VPVLVGSACAAALSG---------------------------------------FRLGPA
I0I761_CALAS          SPVIVGSAFALADGG---------------------------------------FDWLPA
E4NMD2_HALBP          APIFVGVGLAVHDGV---------------------------------------FAALPA
A0A1U7EWI7_NATPD      APVIVGTGLAVYHGV---------------------------------------FAPLPA
L0IAV4_HALRX          APVLVGTALAVHDHV---------------------------------------FAPLPA
Q07ZK1_SHEFN          GPLLIGNMLAIGLEQ---------------------------------------FSLLIA
Q12NM3_SHEDO          GPLIVGNALALGVEG---------------------------------------FSLLTA
Q6APS3_DESPS          APVLVGSAAAFSDGF---------------------------------------FHPLLM
B1ZZ52_OPITP          APVIVGSALAWRDDV---------------------------------------FEPAAA
D5EKA8_CORAD          APVLLGSALAYANLS---------------------------------------FDWRAA
F8L8Z7_SIMNZ          SPILIGSMIAFKQGV---------------------------------------FHPLIF
Q2S2V4_SALRD          APVLVGTGMALEAGA---------------------------------------WHLLSA
C7RR98_ACCPU          VPVLVGHALAWSQQGH--------------------------------------LSGWPA
G8QJX2_AZOOP          APVLSTCALAWSETGQ--------------------------------------LRWLVA
C4ZL14_THASP          APVMLGTALAVADGAE--------------------------------------LAWAVL
A1WW86_HALHL          SPILAGSAVGWVESGV--------------------------------------LRLDVT
Q2RNW3_RHORT          APVLVGAALAWAQTAS--------------------------------------LRLDAA
H6SP86_PARPM          SPILAGIVLAWAETGQ--------------------------------------TALGVS
W5X374_BDEBC          VPCLAGTALVKAIGLS--------------------------------------WDGWVL
D6YW76_WADCW          VPIFLATMLAINNGVN--------------------------------------VHWELS
Q6MCB2_PARUW          APIMVGTFLAFAIVQR--------------------------------------IDWFLA
B2UL43_AKKM8          IPVWAGCMVVQKLTGS--------------------------------------WNASLA
B8FA11_DESAL          APVILGLGLAWEQGLC--------------------------------------WWAAA-
E1X1B0_HALMS          GPVILGSALAYEMGEN--------------------------------------FSPLIF
Q7MT15_PORGI          SPVVVAIAYAIADGN---------------------------------------FRWPQA
F4KKK2_PORAD          APIAVAITLAWLQGG---------------------------------------SNWLIA
H8MKQ6_CORCM          APTLVGWAFAHVEGG---------------------------------------WRPVPA
W8YD75_BACTU          SPVILGTVASLYV---------------------------------------AKIDWLLF
Q81BK6_BACCR          SPVILGTVASLYV---------------------------------------AKIDWLLF
A0A0F6FRY2_BACTK      SPVILGTVASLYV---------------------------------------AKIDWLLF
A0A0F7RFG2_BACAN      SPVILGTVASLYV---------------------------------------AKIDWLLF
MENA_BACSU            VPVLLGTVLAMFY---------------------------------------VKVDLLLF
F2F7P2_SOLSS          VPVLLGTSMALSIN-------------------------------------HETVHFGLF
B1YK29_EXIS2          VPVVVGTAIVAPR--------------------------------------IESLRMDLF
I0JPY9_HALH3          VPVFVGTMLAAME---------------------------------------QPIKLGLF
Q8Y6K7_LISMO          VPVFLGTSVAMSY---------------------------------------TSFHFTRF
A0AJD1_LISW6          VPVFLGTSVAMSY---------------------------------------TSFNFTRF
Q4L545_STAHJ          VPVLVGTATAKLFLLGS----------------------------------QDNIKFMLF
A0A0E1VIS7_STAA3      VPVLVGTAASKIYFLGS----------------------------------EDHIKISLF
A0A166NHB3_STAPS      VPVLVGTATAKLFLLGS----------------------------------EDHLHFGLF
B9E7P8_MACCJ          VPVLVGTACARYF---------------------------------------TEIRMDML
C8WXX2_ALIAD          VPVIVGTAVAVPS---------------------------------------YPFHVWRF
Q67QI7_SYMTH          APVLGGTALAYAH---------------------------------------GGFHTGRF
Q1AUL4_RUBXD          VPVLLGGALAHEA---------------------------------------GSFSWGPF
D8GIH8_CLOLD          IPVTIG-AIFAAKE--------------------------------------SKFQFIYY
Q9X1L4_THEMA          FPVTVG-AMLAEE-----------------------------------------FSLIRY
A2BMF3_HYPBU          VCVGFGIAYGFWLT--------------------------------------GSIDVPLS
B8FCL3_DESAL          ISVGVGAAWA--GD--------------------------------------YGVSWFWL
Q1MQB4_LAWIP          IPISLGTALAWSGTVKTP---------------------------------GVPFHFFCF
Q1MQB6_LAWIP          TPIALGTSLAISD--------------------------------------GYHFDLFLF
B8CY37_HALOH          VSTTLGASLAFYHGS---------------------------------------FNPGLY
I4C2Q9_DESTA          IPLTLGGVVAARAGA---------------------------------------WNTGRW
F3ZW58_MAHA5          VSVMVGSAAAWYYTGR--------------------------------------FSWLYF
                                                                                  

D2PVS5_KRIFD          LLALGVALALQVGVNYANDYSDGIRGTDENRV----------------------------
A6W5N5_KINRD          ALALVVSLALQIGVNYANDYSDGIRGTDSDRV----------------------------
MENA_MYCTU            LLALAVAVALVIGVNYANDYSDGIRGTDDDRV----------------------------
K0KFH5_SACES          LLALVVSLALQVGVNYANDYSDGIRGTDEHRV----------------------------
C4LLA5_CORK4          ILAAIVGWFLVIGVNYANDYSDGIRGTDDDRS----------------------------
R0JJJ1_CORCT          LLALVVAWALIIGVNYANDYSDGIRGTDEDRT----------------------------
D6Z868_SEGRD          LAALIVALGFVIGVNYANDYSDGIRGTDDERI----------------------------
E8NG47_MICTS          LACLAVAFALQIGVNYANDYSDGIRGTDDVRV----------------------------
B0RCZ9_CLAMS          LLCLAVAVLLQIGVNYANDYSDGVRGTDDVRV----------------------------
B2GHK2_KOCRD          LLALVVALALQVGVNYANDYSDGVRGTDDERV----------------------------
E1VYH2_GLUAR          VLALLVGLLLQVGVNYSNDYSDGIRGTDDERV----------------------------
E3H075_ROTDC          FLAFLVAFFLQVGVNYANDYSDGIKGTDEGRV----------------------------
F5XLQ4_MICPN          LLALVVSLALQIGVNYANDYSDGVRGTDANRV----------------------------
I6Y0M1_PSEPQ          LLCLGVALALQVGVNYANDYSDGIRGTDDVRV----------------------------
M5A1W1_9ACTN          ALALIVSLALQVGVNYANDYSDGIRGTDDVRV----------------------------
C7MFJ4_BRAFD          LLALAVSSSLQVGVNYANDYSDGIRGTDDDRV----------------------------
C7M0N6_ACIFD          ILAAVVALALQVGVNYANDYSDGIRGTDQARV----------------------------
D6ZKM9_MOBCV          LWCLAVALLLQIGVNFSNDYSDGIRGTDEYRV----------------------------
K4IN59_BIFAP          VLLVLLALSMQIAANFANDYADGVRGTDSGR-------------------GGEEATSGR-
K4IPV7_BIFAP          LLCCLTAVFIHSTCNLANDYFDGIRGTDEGRS-------------SLSGAGADGAVPDL-
A1A0C5_BIFAA          VLCGCVALFLQVAANFANDYSDGIRGTDEGR--AVDSARSFAKTPSAESTSTPEMLPASQ
B8DW73_BIFA0          LLCLLVALFLQIAVNFANDYSDGVRGTDAHRTAAVRQYTVESDFQFLENGATAEEERQAR
B3DQI5_BIFLD          ILCLLVALFLQIAVNYANDYSDGIRGTDAGR-------------------DTDESKSGK-
I3WJK0_BIFBI          LLCVCVGVLLQIAVNYANDYSDGIRGVDEGR-------------------GGSEKKTKK-
Q83H01_TROWT          ALAALTAVLLQIGANYINDYGDGIRGADSNRS----------------------------
MENA_ECOLI            LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
B7LA27_ECO55          LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
Q57HC7_SALCH          LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
C0Q440_SALPC          LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
A0A0H3BR13_SALNS      LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
A0A0H3H3Z8_KLEOK      LLAIITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
A0A0H3FLY7_KLEAK      LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
W1EQ74_KLEPN          LLALITAGLLQILSNLANDYGDAVKGSDKPDR----------------------------
C5BB80_EDWI9          LLALLTAALLQILSNLANDYGDAVKGSDTPER----------------------------
A0A384L2R4_YERPE      LLALLTAGLLQILSNLANDYGDAVKGSDTEER----------------------------
A0A433N1U4_9GAMM      LLALLTAGLLQILSNLANDYGDAIKGSDTEER----------------------------
H8NV38_RAHAQ          LLALLTAGCLQILSNLANDYGDAEKGSDTPER----------------------------
D3V6W0_XENBS          LLALLTAALLQILSNLANDYGDVAKGSDTEKR----------------------------
Q6LVI4_PHOPR          GLALLTALLLQILSNLANDYGDAVKGTDNDDR----------------------------
B0UV43_HISS2          LLCLLTTLLLQILSNFANDYGDHQKGSDTQER----------------------------
MENA_HAEIN            VLCLLTTILLQVLSNFANDYGDHQKGSDTEER----------------------------
A0A378NC05_MANHA      LLAFITTILLQILSNFANDYGDHVKGSDTKER----------------------------
K0G771_ACTSU          LLAFITTILLQVLSNFANDYGDHVKGSDTKER----------------------------
G1UB90_HAEDU          LLAIITTMLLQILSNFANDYGDYVKGSDTQER----------------------------
F0LRU4_VIBFN          LLALLTATLLQILSNLANDYGDAVKGTDNDKR----------------------------
Q9KNQ8_VIBCH          VLALLTATLLQILSNLANDYGDAVKGTDNHAR----------------------------
I4AJL1_BERLS          SLTILTAILLQILSNYANDYGDSIHGADHKDR----------------------------
Q11YA0_CYTH3          VLCVLTTLFLQILSNLANDYGDFMNGADGEHR----------------------------
G0J314_CYCMS          IMAAITTTLLQILSNLANDYGDSINGADHEGR----------------------------
I2EY83_EMTOG          TLCCLTTIALQVLSNFANDYGDTQNGADLAGR----------------------------
D2QBD3_SPILD          VLAALTTIFLQILSNFANDYGDAVSGKDTELR----------------------------
E4RUU5_LEAB4          LWAVITTILLQVMSNFANDYGDTQNGADSSDR----------------------------
E4T4N3_PALPW          GLAALTTVLLQIMSNMANDYGDFVNGKDTAER----------------------------
G8R827_OWEHD          VLCLLTTLCYQVLSNYANDYGDGVKGTD-ADR----------------------------
C7M701_CAPOD          GWALLTTILFQVLSNFANDYGDGVKGTDNEHR----------------------------
H1ZAR9_MYROD          FFAIITTLLFQILSNFANDYGDGVKGTDNENR----------------------------
D5BHI6_ZUNPS          SLALATTLGLQVLSNFANDYGDGVKGTDNDER----------------------------
G0L7N0_ZOBGA          VLALLTTIGFQVTSNFANDYGDGVRGTDNEDR----------------------------
F0RAE4_CELLC          ILALLTTVALQVTSNFANDYGDGVKGTDNDDR----------------------------
G2PK12_MURRD          ILALLTTVGFQVTSNFANDYGDGVKGTDNEDR----------------------------
H8XPE4_FLAIG          TLAILTTLAFQILSNFANDYGDGVKGTD-ANR----------------------------
F2IBY0_FLUTR          SLALSTTLLFQILSNLANDLGDSLKGADNSDR----------------------------
E4TBG6_RIEAD          ILALLVTLLYQILSNFANDYGDGVKGTDTHRST---------------------------
I4A276_ORNRL          ALACFTTLFLQILSNYANDYGDGVKGTDEIRT----------------------------
A0KFP0_AERHH          ALSLLTAILLQILSNLANDYGDAVSGADNGER----------------------------
C4L9G5_TOLAT          VLCLLTAIGLQVLSNLANDYGDAVSGADNEDR----------------------------
A1SRV4_PSYIN          SLSLITALLLQILSNLANDYGDAISGVDNGKR----------------------------
D5ESR9_PRER2          LLCLLFAFAMQIDANFINDFFDFVNGTDDAET----------------------------
I6ZRI5_MELRP          LFALLCSILIQIGTNFANDLYDYLHGADKKER----------------------------
I0AJ70_IGNAJ          FIALVCSLLIQIGTNFTNDLYDHLKGADTEKR----------------------------
B3EKW4_CHLPB          VVALLCALGIQVATNFINEIYDFRKGADTADR----------------------------
B3QXE0_CHLT3          LIALVCALLIQVATNFINEIYDNRKGADTAER----------------------------
A7NL00_ROSCS          LAALAGALLIQIGTNLANDYFDFRKGADTAER----------------------------
A9WBE2_CHLAA          LAALLGALFIQIGTNLANDYFDAQKGADTSER----------------------------
B9L3E1_THERP          LAALVTALLIQVGTNYANDLFDYLKGADRPDR----------------------------
D0LH50_HALO1          LAALFGAIWIQIGTNFANDVFDFEKGADTEER----------------------------
I0I761_CALAS          LAAALGALLLQILSNFANDYSDFFRGADTPDR----------------------------
E4NMD2_HALBP          LAAFVGAALIQIGTNFANDYYDAVQGADTADR----------------------------
A0A1U7EWI7_NATPD      LFALFGALLLQIGTNFANDYYDAVRGADTEDR----------------------------
L0IAV4_HALRX          ALALLGAALIQIGTNFANDYYDAKHGADTDDR----------------------------
Q07ZK1_SHEFN          FTSMLCAVLLQISVNLANDYFDFKNGIDTEER----------------------------
Q12NM3_SHEDO          LVIISCGLLLQISVNLANDYFDSLSGVDSQER----------------------------
Q6APS3_DESPS          LACLLGALLLQIAVNFANDYFDAKNNIDSAER----------------------------
B1ZZ52_OPITP          ALCLGFALLVQIGTNFANDYYDFMRGADTAAR----------------------------
D5EKA8_CORAD          GICLLFAVLVQIGTNFANDYLDGIKGTDTEAR----------------------------
F8L8Z7_SIMNZ          FLTVLFGLSIQIGTNFANDYFDFRKGADTEDR----------------------------
Q2S2V4_SALRD          LLALAGAVLIQVGVNYHNDYADYVQGADTQER----------------------------
C7RR98_ACCPU          LVALLAALLIQIGTNLHNDVSDFERGSDTPER----------------------------
G8QJX2_AZOOP          LVTLAAALLIQIGTNLLNDVGDFERGTDTPDR----------------------------
C4ZL14_THASP          FATVSCALLIQIGTNLYNDAIDFERGTDRPER----------------------------
A1WW86_HALHL          LVAALSTAAIQIGTNLQNDAADTLNQTDSAER----------------------------
Q2RNW3_RHORT          LIAGLAAMAIQIGTNLFNDAADFLNGTDRAGR----------------------------
H6SP86_PARPM          VAALLTAVAIQIATNLHNDAADSLDGTDQPDR----------------------------
W5X374_BDEBC          FYALAAASFIQIGTNLVNDAVDFKKGADTEKR----------------------------
D6YW76_WADCW          FYALLAAIFIQLGTNLVNDALDFKKGADTEKR----------------------------
Q6MCB2_PARUW          TSSFLSVLFLQIGTNLVNDALDFPKGADTKER----------------------------
B2UL43_AKKM8          LLTLTSCLCLQIACNFFNDAIDHAKHADTERR----------------------------
B8FA11_DESAL          -AALACCIFMQIGANLVNDYFDYAHGVDDKDR----------------------------
E1X1B0_HALMS          ILTLLAAVSMQIGTNLVNDYYDAVRGIDSEKR----------------------------
Q7MT15_PORGI          ALALIVAVSAQTVSNIANDWFDYKKGADTDQR----------------------------
F4KKK2_PORAD          VLCLVVGLSAQSFSNCCNDYYDFKRGADGGER----------------------------
H8MKQ6_CORCM          LTFLVGFMLAQIVSNLVNDYSDFERGADTAAR----------------------------
W8YD75_BACTU          IAMMLACLALQIATNLFNEYYDFKRGLDTA------------------------------
Q81BK6_BACCR          IAMMAACLALQIATNLFNEYYDFKRGLDTA------------------------------
A0A0F6FRY2_BACTK      IAMMVACLALQIATNLFNEYYDFKRGLDTA------------------------------
A0A0F7RFG2_BACAN      IAMMVACLALQIATNLFNEYYDFKRGLDTA------------------------------
MENA_BACSU            LAMLFSCLWIQIATNLFNEYYDFKRGLDTA------------------------------
F2F7P2_SOLSS          FAMLIASMLIQAATNMFNEYYDYKLGLDNE------------------------------
B1YK29_EXIS2          FAMLIASMLIQIATNLFNEYYDYKRGLDTE------------------------------
I0JPY9_HALH3          AAMLLASILIQAATNMFNEYYDYVRGLDNE------------------------------
Q8Y6K7_LISMO          IVMLIACFFIQTSANLFNEYFDYKKGQDDE------------------------------
A0AJD1_LISW6          IVMLIACFFIQTSANLFNEYFDYKKGQDDE------------------------------
Q4L545_STAHJ          IAMLIACLLIQAATNMFNEYYDFKKGLDDH------------------------------
A0A0E1VIS7_STAA3      IAMLLACLLIQAATNMFNEYYDYKKGLDDH------------------------------
A0A166NHB3_STAPS      LAMLFACLLIQAATNMFNEYYDFKKGLDDH------------------------------
B9E7P8_MACCJ          ILMLIACLLIQAATNMFNEYFDYKRGLDDH------------------------------
C8WXX2_ALIAD          VAMLLASMLIQSATNMFNEYYDYQRGLDDE------------------------------
Q67QI7_SYMTH          LAFLLAAVLIQSATNMFNEYFDYVRGLDTR------------------------------
Q1AUL4_RUBXD          LAMLLASVLIQAATNMFNEFYDEKRGLDTA------------------------------
D8GIH8_CLOLD          LISLLAAVLLQASSNMINDYDDFINKVDTK------------------------------
Q9X1L4_THEMA          ILSLIASIFLHAGVNTTNDYFDYKKGVDTK------------------------------
A2BMF3_HYPBU          LLALLGSVLLHAAANVWNDYFDYRYGIDRPGVG---------------------------
B8FCL3_DESAL          ILTAIALVCIHGAANLTNDYFDYKNKVDVPDAP---------------------------
Q1MQB4_LAWIP          LLILLSGLLLQAGTNLLNTYGDFISGVDTL------------------------------
Q1MQB6_LAWIP          ILALLGGIFLQAGANFLNTYGDYMSGVDTI------------------------------
B8CY37_HALOH          FMTMAPLLLIHTGTNLINDYYDYKFGLDGEQS----------------------------
I4C2Q9_DESTA          TIVLIASFLVHLCTNLANDYFDYETGADSGES----------------------------
F3ZW58_MAHA5          ILTEIGVLSLHVASNMANDHYDYLSGADPLGEVKPFS-----------------------
                                    *  *   *     *                                

D2PVS5_KRIFD          ---GPLRLVGSKVASPRAVKTAAFTCFGVGAALGLVLCATS---TWW----------LLV
A6W5N5_KINRD          ---GPFRLVGSGAAEPRHVRDAAFACFAVAALAGLVVVALSG--HWW----------LLL
MENA_MYCTU            ---GPVRLVGSRLATPRSVLTAAMTSLALGALAGLVLALLS---APW----------LIA
K0KFH5_SACES          ---GPFRLVGSGAANPRSVRLAAFAALGVAAVAGLVLIVLTG--RYW----------MLA
C4LLA5_CORK4          ---GPFRLTASGLVQPYGVKHAAFMAFGVAALAGLVLCAISG--HWW----------LIL
R0JJJ1_CORCT          ---GPLRLTGSGLAEPKKVKAAAFISFGIAGVAGTALSLLSA---WW----------LIL
D6Z868_SEGRD          ---GPMRLVGSKAAAPGAVLRAAVASFAAAVVAGLVLAATS---SWW----------LVV
E8NG47_MICTS          ---GPGRLTGGKKAKPRTVLLVALAFFALAALVGLAIVVRTG--QWW----------LLA
B0RCZ9_CLAMS          ---GPARLTGSGAAKPRTVLTVALTFLGLAAVAGLAIVLITG--HWW----------LLA
B2GHK2_KOCRD          ---GPLRLTGSGAAAPHQVRLAAFACFGVAALAGAALVVLSQ--QWW----------LAL
E1VYH2_GLUAR          ---GPLRLTGSKLTAPKNVRNAAFGCFGLAAICGLVLVVLSS--AWP----------LLL
E3H075_ROTDC          ---GPMRLVGSGAASAKSVKYAAFLCFALAMCSGLILVALAN--QWW----------FLA
F5XLQ4_MICPN          ---GPLRLVGSGLAAPAMVKAAAFASFGFAAVAGLALVVLCQ--LWW----------LLA
I6Y0M1_PSEPQ          ---GPVRLTASGLARPGAVKRAAFLCFGVAAVLGSVTVVLSG--HWW----------LLG
M5A1W1_9ACTN          ---GPQRLVASGLAPAKQVKMAAMAAFGVAAVAGLAVAVSTS--LW-----------LLA
C7MFJ4_BRAFD          ---GPFRLTGSGAARPATVKRAAILALALGGLFGVVLVALAQ--IWW----------TLV
C7M0N6_ACIFD          ---GPVRLVGQGLASPAHVRAAALGSFAVAAAAGVVVAA-ET--SWW----------LLV
D6ZKM9_MOBCV          ---GPPRLVGSG-ENPRKVLAVALSCFALASIVGLGVAVISQ--SWW----------LLG
K4IN59_BIFAP          ----PRRLVAAGVPP-RKVLYATMISAAFTCLMGLVVMALTG--HWW----------MIL
K4IPV7_BIFAP          ----PRRGVAGGVEP-RKVLLSAYLNILMACLSGLILCGVTG--HWW----------MIM
A1A0C5_BIFAA          PQHGPARLVASGVSP-KKVLAVAGINALIACLCGLAVVTLTG--YWW----------FIL
B8DW73_BIFA0          ELNGPTRLVAGGVTP-RAVLMAAIVNAVLACVCGLAVIVITG--YWW----------LVF
B3DQI5_BIFLD          ----PQRLTASGLVPAKHVLFAAMICAAIACICGIAAIVISQ--AWW----------LFA
I3WJK0_BIFBI          ----PMRLTASGLVPAKHVLVAAVVSALLACVCGLVAVVLSQ--AWW----------LLL
Q83H01_TROWT          --HASRRLTASGANP-FSVLTTGLSFLIAAAGSGLIAVILTQ--RWQ----------LIL
MENA_ECOLI            --IGPLRGMQKGVITQQEMKRALIITVVLICLSGLALVAVAC--HT-----LADFVGFLI
B7LA27_ECO55          --IGPLRGMQKGVITQQEMKRALIITVVLICLSGLALVAVAC--HT-----LADFVGFLI
Q57HC7_SALCH          --IGPLRGMQKGVITRQEMKRALIITVVLICISGLALVAVAC--HT-----LTDFVGFLI
C0Q440_SALPC          --IGPLRGMQKGVITRQEMKRALIITVVLICISGLALVAVAC--HT-----LTDFVGFLI
A0A0H3BR13_SALNS      --IGPLRGMQKGVITRQEMKRALIITVVLICISGLALVAVAC--HT-----LTDFIGFLI
A0A0H3H3Z8_KLEOK      --IGPLRGMQKGAITQAQMKRALILTVALICLSGLALLFLAW--QT-----MADFIGFMV
A0A0H3FLY7_KLEAK      --IGPLRGMQKGAITQSQMKRALIVTVALICLSGLALLFSAW--QT-----MADFIGFMV
W1EQ74_KLEPN          --IGPLRGMQKGVITPQQMKRALIVTVVLICLFGLALLCAAW--QS-----VGDFIGFLA
C5BB80_EDWI9          --IGPLRGMQKGVITQAQMKRALIITVLLTIASGVALIAVAC--QK-----PQDIIGFLL
A0A384L2R4_YERPE      --IGPLRGMQKGIISHQQMKVALIITVILTIISGIALIAVAC--EK-----PSDILGFLL
A0A433N1U4_9GAMM      --IGPLRGIQTGAITLAQLRNALIVTVALTIISGVSLVILAC--EK-----PADIFGFLI
H8NV38_RAHAQ          --VGPLRGMQKGLITAGQMKRAIILTIALTLICGTALIAVAC--HK-----PSDVVGFLI
D3V6W0_XENBS          --IGPMRGMQKGVITAEQMKTALKITVLTSCLSGIALITVAC--NS-----PSDIIGFLA
Q6LVI4_PHOPR          --IGPQRAIQSGLVTKGAMQKAMALNIVLTVTSGLTLIILAC--NN-----LKDMFGFML
B0UV43_HISS2          --IGPLRAIQQGAINAKQLKQGLILVVFLSLISGSLLIVSAY--QT-----IVDLVAFAL
MENA_HAEIN            --IGPLRGIQKGAISAKELKWGLILMVMASFLSGSFLIGIAY--EN-----LSDLFAFAG
A0A378NC05_MANHA      --IGPLRAIQHGVISGEQLKKAVIILSLLSFVSGVALSAYAF--ET-----VQDLFFFIG
K0G771_ACTSU          --IGPLRAIQHGAITGGQLRNAVILLSILSFIAGVGLTVYAY--QS-----IQDLIVFIS
G1UB90_HAEDU          --IGPLRAIQQGNITGEQLRQAVIFLSFLSFISGLVLTIYAY--QS-----LQDLLVFVS
F0LRU4_VIBFN          --LGPMRAIQSGEVSLADMKRAIFINIGLTIVAGLALVFYAL--DS-----LESILAFIG
Q9KNQ8_VIBCH          --LGPMRAIQSGAVSLSDMKRAMAINVILTMVSGLALVLYAF--DN-----LQNILIFIG
I4AJL1_BERLS          --VGPKRAVQEGKITSSQMKKAVILFSILSFMSGVLLLFMAI--DFQSENSLKILVFFLG
Q11YA0_CYTH3          --VGPARAVQSGAISIKEMKIAIVLFAACSFIAGVSLLYQVK--DLLSVN---MLSAFLL
G0J314_CYCMS          --QGPIRAVQSGLIKPVEMKVAVILFSILSLFSGLFLLYLAL--ED-----IYLFLLFLG
I2EY83_EMTOG          --VGPERAVQSGAITPKQMLNGIIFMVVLCLVLGISLLYFAF--KDASKN---DFLGFLG
D2QBD3_SPILD          --VGPRRAVATGDITKEAMLRGIVLMSVLSLVCGIGLLSVAF--YSVEPK---IFWFFFV
E4RUU5_LEAB4          --IGPARAVQSGEISRRQMFIAICITGLAAFLSGLWLLYTSF--GGFESK---YFKIFLS
E4T4N3_PALPW          --IGPKRMVQSGEITPKIMLRGIIVIGILCVVSGLALILIGT--AGMDIT---NLLIFGV
G8R827_OWEHD          --VGEKRAVASGEISAASMKKAVWLFSILSFVFGTWLSIVAT--QGLPMI---VTIGFVV
C7M701_CAPOD          --IGPTRALQSGRVTRRQMKRVVLITALLSLFSATVLIYTAF--GR---ENLLYISVFFV
H1ZAR9_MYROD          --VGPQRALQSGLLTKEELKRGIIFTAGLSLVSALILIYLSF--GR---DHFFTSLFFFV
D5BHI6_ZUNPS          --IGPQRAIQSGLISHAEMKRGIILTSIITFILAICLIYASF--DS---EDFMYSLIFIG
G0L7N0_ZOBGA          --IGPKRALQSGIVTREELKQGVIISIVIDFLLVVALVYCAF--GF---ENMFYPIVFLI
F0RAE4_CELLC          --IGPKRALQSGILTRKELKKGIIVAIVLCLLLIAGLIFTAF--TAFTADSIIYIALFFI
G2PK12_MURRD          --IGPARAIQSGTITKKALKKGIVVSIIISLLIALALIYLAF--GL---ENLPYILLFLL
H8XPE4_FLAIG          --VGEKRLVASGEVTSAQMKQAVIVTGLISLLLALSLIFVSF--GQ---DHFLFSLLFLV
F2IBY0_FLUTR          --VGPMRAVQSGAISKSAMKSAVILTSVLSFISAGFLIYFGT--KN---LSISSVYIYIG
E4TBG6_RIEAD          --QAEARAVASGKISAQQMKMAVLITAVLAFLASVVLLYIAF--FP---KYIKEFWFFIG
I4A276_ORNRL          ---GEMRAVAAGKISARAMKNGVILMALLSLISALLLLFLAY--YP---AHLGLLFFYIF
A0KFP0_AERHH          --IGPQRAVVSGLITRRQMCVAMALTALAAVVSGLALLGCAF--GD----QWLQILTFVL
C4L9G5_TOLAT          --VGPQRTVVSGLITREQMQRAMSLVAGLTIVSGLSLLWTAF--SG----DWPAILTFIG
A1SRV4_PSYIN          --VGPLRAMQSGAISQKSLKIAILLTTSLVVVSGITLLVIAL--GS----NSTSWVVFLL
D5ESR9_PRER2          -RLGPRRACAQGWVKLDSMKKAIALTTCIACVIGLPLVYYGGFE-------------MVL
I6ZRI5_MELRP          --TGPQRAVASGLISVNEMKLAVTLTFGLSFLMGLYLVYLGG-------------WLILV
I0AJ70_IGNAJ          --KGPLRVLSAGLISVKEMRNAIFLVFGLTFILGLYLVYVTD-------------WKILA
B3EKW4_CHLPB          --LGPTRTVAAGLVSEKNMIVVSVFLLVAVFFMGLYLVYLAG-------------WPILL
B3QXE0_CHLT3          --LGPTRAVASGMISEQVMTRVSISMLVFTFVLGLYLVKIGG-------------WPILL
A7NL00_ROSCS          --LGPLRVTQAGLLTPATVRNGMIIAFGMAALIGIYLIVVGG-------------WPILV
A9WBE2_CHLAA          --LGPVRVTQSGLLPARTVLTAALVSFGLAALAGIYLITVAG-------------WPILV
B9L3E1_THERP          --VGPTRITARGLVTVAAMRRAVVLTFALATVLGLYLVWVGG-------------WPILV
D0LH50_HALO1          --TGPTRAVQTGLLSPEAMRQGMKIAFGLATLAGLYLTWTAG-------------WPVIV
I0I761_CALAS          --LGPVRVTSAGLIRPEEMRRGIAVVIALAVLVGLYLIWVGG-------------WPILA
E4NMD2_HALBP          --EGFTRVTAGGLIAPKSVKRAMYLTFAAAILLGTYLVYVGG-------------VPILV
A0A1U7EWI7_NATPD      --DGFTRVTAGGLIEPAAVKRAMYATFGLSMVIGLYLVAVGG-------------VPILV
L0IAV4_HALRX          --EGFTRVTQSGLIAASQVKTAAIVTFGLAIASGTYLVYVGG-------------LPILV
Q07ZK1_SHEFN          --LGPIRVTQSGILAPSSVRNAMIGCLITSLLVGSLLIVHGG-------------WPIAI
Q12NM3_SHEDO          --LGPIRMTQAGLISAKQMKKAMIMSLICALLVGVYLIDIGG-------------WPIGL
Q6APS3_DESPS          --LGPVRVTQSGLIPAAQVKWAMALALVLAVLVFSYLSSVAG-------------WPIVM
B1ZZ52_OPITP          --VGPQRAVAAGWVSPATMRRAMWATFATAFACGLGLLLWGG-------------PWLIL
D5EKA8_CORAD          --IGPRRAVASGLVAPLAMKWATILVLAVAFCIGLALIPFGG-------------WWLLL
F8L8Z7_SIMNZ          --KGPRRLTQSGLVSPETMKKATAMTFGIAALAALYLITQGG-------------WVIGI
Q2S2V4_SALRD          --VGPLRVTQAGLVAPQTMRRATILVFGLAVMAGLYLIARGG-------------WPILA
C7RR98_ACCPU          --LGPPRATAMGWLPGAVVRRAAWIAFALAFNFGIYLAWHGG-------------WPIVV
G8QJX2_AZOOP          --LGPPRATAMGWLSAAQVKRGGFLALGGAFLLGIYLVGQGG-------------WPIVL
C4ZL14_THASP          --LGPLRVTLAGWASAAEVKRGALLCLLLALLLGAWLCVVGG-------------ALILA
A1WW86_HALHL          --IGPVRVTERGWLTPRQVMAAAYGAFALALFCGLYLVAIGG-------------LPILV
Q2RNW3_RHORT          --IGPPRVTQRGWLSAAAVRRAAFAAFLLAALGGIYLVGLGG-------------PPILG
H6SP86_PARPM          --KGPLRVVQAGWVSAQTVQRAAHLVFGFAFLCGLVLVVKGG-------------WPILL
W5X374_BDEBC          --IGPQRITQAGVLSASQVMALGSLCFLLAILCGVPLVMKGG-------------WVIVG
D6YW76_WADCW          --LGPVRVTQSGLISYEKVLAGGMMCFALALLFGIPLIFAGG-------------IPLTV
Q6MCB2_PARUW          --LGPKRMTQAGLLSFKQTFRGGLICFGVAILIGTPLMITGG-------------WPFAA
B2UL43_AKKM8          --TGPVRMTASGALSHRTVMLIGLFFLLGACLLAFPLIELRG-------------WPILA
B8FA11_DESAL          --LGPDRVTQQGLIPPGQVKAAFMACFGAAFLLGVALVYRGG-------------WPIVI
E1X1B0_HALMS          --LGPTRVTQAGLIPAPVVKRGFILCFLFAVVVSIYLMYIGG-------------STIII
Q7MT15_PORGI          --VGFERGISKGWLSERQVLAALFSFLFLLGFSGFLLCAISN-------------WWLLV
F4KKK2_PORAD          --VGFSRPLASGQLRERDIIGVALFWGLIAAVAGVTLCLLTN-------------PWLLL
H8MKQ6_CORCM          --LGPARVTQKGWLTSREVAGAAALAFTGAALSVLLLTQAGG-------------WPVLV
W8YD75_BACTU          ESVGIGGGIVRHGLKPKNVLTVALLLYVVAAFIGIYICMNSS-------------WWLVV
Q81BK6_BACCR          ESVGIGGGIVRHGLKPKNVLTVALLLYVVAAFIGIYICMNSS-------------WWLVV
A0A0F6FRY2_BACTK      ESVGIGGGIVRHGLKPKNVLTVALLLYVVAAFIGIYICMNSS-------------WWLVV
A0A0F7RFG2_BACAN      DSVGIGGGIVRHGLKPKNVLTVALLLYVVAAIIGVYICMNSS-------------WWLVV
MENA_BACSU            ESVGIGGAIVRHGMKPKTILQLALASYGIAILLGVYICASSS-------------WWLAL
F2F7P2_SOLSS          NSVGIGGTIVRHGVAPKTIMAIALSFYGIAMLLGVYICAMTS-------------WWLVA
B1YK29_EXIS2          DSVGIGGSIVRDGFKPGTILAFAFSLYGISALLGIYLCLETT-------------WWLLL
I0JPY9_HALH3          NSVGIGGTIVRDGISPRVVRSLAIGFFVMAGLLGVYICIASS-------------WWIAV
Q8Y6K7_LISMO          HSVGNGGAIVRNGMRPGFILFLAIFLYILSILGGVYLSIELN-------------WYVGL
A0AJD1_LISW6          HSVGNGGAIVRNGMRPGFILFLAIFLYILSILGGVYLSIELN-------------WYVGL
Q4L545_STAHJ          TSVGIGGAIVRNGMSPKLVMNLAIAFYIVAALLGIFLAANSS-------------FWIIP
A0A0E1VIS7_STAA3      ESVGIGGAIVRNGMSPELVLRLAIAFYILAAILGLFLAANSS-------------FWLLP
A0A166NHB3_STAPS      ESVGIGGAIVRNGMTPQHVLKLAIIFYIIAAILGLYLAIQSS-------------FWLIP
B9E7P8_MACCJ          TSVGIGGAIVRNGMSSKSVYNLAVAFYIIAAIIGIYICANSS-------------WLILL
C8WXX2_ALIAD          RMVGIAGTIVRDGVPPKVVLRLGFAFLAAALLLGVYLCATTS-------------WWLAL
Q67QI7_SYMTH          DHVGIAGTIVRDGVSPRVVITLAWMFLATAVALGLYISATSS-------------WWVFA
Q1AUL4_RUBXD          EAVGIAGSIVHGRVHARAVLLGALLCYTAALFLGLYLVYVGG-------------WPILL
D8GIH8_CLOLD          ESGSSSGIIFENLLTSEELLKGGRLVLALGCILGLFLAFQKG-------------GFILI
Q9X1L4_THEMA          DSLGSSGLLVSGKITPREELLLSVFCYAVSVVLGLVLIKISG-------------PALLW
A2BMF3_HYPBU          TTVYRPHPIFANIMVPGHVLVFGTSLGLAALGIGWALVLAGR-------------PLALL
B8FCL3_DESAL          TTKYRPHPLAQNLLTLHEVKWFALTLFAVGIVLGLVMAAAKG-------------WPLIL
Q1MQB4_LAWIP          DSAVTCPQLVRGILLPEKVKQVGIALLVLSVILGLILYLLSG-------------WPILL
Q1MQB6_LAWIP          DSAITCPQIVTGILPAYKMKYVGIGMLTTAIIIGLFLIFLCG-------------WPVFV
B8CY37_HALOH          -LSSSGLNRVNGQIKLNQIYTVAIACFLASIPFGAYLTLLRG-------------PIIFI
I4C2Q9_DESTA          --IGGSRVIQEGKIAPQEIRNALILLYTIAFACGVWIVWASG------------VWWLAG
F3ZW58_MAHA5          ---GGSQVLQHKQMTIEQSRMLFAAFFILGLVMAIYFAVVVG-------------IWALV
                                                                                  

D2PVS5_KRIFD          AGAASLVGAWFYTGGKTPYGYRALG--EVSVFVFFGLVAVLGTTYVQAER----------
A6W5N5_KINRD          VGAASVAAAWYYTGGKRPYGYAGLG--EVFVFVFFGLVAVTGTTYVQAGR----------
MENA_MYCTU            VGAICIAGAWLYTGGSKPYGYAGFG--ELAVFVFFGPVAVLGTQYTQALR----------
K0KFH5_SACES          LGAVCIAAAWFYTGGRKPYGYSGLG--ELAVFLFFGPAAVLGTLYVQAGE----------
C4LLA5_CORK4          VGAACVVAAWFYTGGKHPYGYRGLG--EVAVFVFFGLVAVLGTQYTQADH----------
R0JJJ1_CORCT          IGILCVLGAWFYTGGKNPYGYRGLG--EIAVFIFFGLVAVMGTQFTQTGS----------
D6Z868_SEGRD          LGAGCLALAWFYTGGTNPYGYKGYG--EVAVFLCFGLAAVLGSELSQTGR----------
E8NG47_MICTS          VGAVCIVAAWFYTGGKRPYGYNAMG--ELFVFVFFGLVATLGTTWVQVQS----------
B0RCZ9_CLAMS          VGAVAIVAAYFYTGGKRPYGYAGLG--DVVVFVFFGLVATAGTQFILIGM----------
B2GHK2_KOCRD          VGLLAIAAAWGYTGGRKPYGYMGLG--DVFVFIFFGLVATLGTTLTQAGR----------
E1VYH2_GLUAR          VGVAAIFAAWGYTGGKNPYGYRGLG--DIYVFIFFGLVATLGTTYTQINQ----------
E3H075_ROTDC          IGASAVFAAWGYTGGKRPYGYMGLG--DIFVFVYFGLVATLGTLYTQSHE----------
F5XLQ4_MICPN          VGLACILAAWYYTGGKHPYGYHGLG--EVFVFVFFGLVAVSGTVLVQVGR----------
I6Y0M1_PSEPQ          VGTASILAAWYYTGGSRPYGYRGLG--EVMVFLFFGLVATVGTTLVTFDS----------
M5A1W1_9ACTN          VGAAAIAAGWFYTGGPKPYGYLGLG--EIFVFVFFGLVATVGTTFAATET----------
C7MFJ4_BRAFD          IGGAAIAAAWLYTGGKRPYGYLGLG--ELFVFVFFGLVAVNGTAYALTGS----------
C7M0N6_ACIFD          IGASAIAAAWFYTGGPRPYGYAGLG--ELFAFAYFGLLATLGTLWIQVHA----------
D6ZKM9_MOBCV          AGVAAVAAAWCYTGGKHPYGYAGIGLSELLVFVFFGLLAVQGTLWVQAQV----------
K4IN59_BIFAP          VGICCLIAGWCYVGGPHPYGYHGLG--EVSVFIFFGLVATLGTEYFLINR----------
K4IPV7_BIFAP          VGVFCLLGAWFYTGGKHPYGYRAMG--ELSIMIFFGLVGVLATQYLETGG----------
A1A0C5_BIFAA          VGIACLVAGWCYVGGKHPYGYHYLG--EIFVFIFFGLVAACGTMFALAGT----------
B8DW73_BIFA0          VGALCVTAAWFYVGGSHPYGYFGFG--ELAAFVFFGPVAALGTQFVLCGQ----------
B3DQI5_BIFLD          VGVASLLAGWFYTGGKHPYGYVGLG--EVGVFLFFGLAAVLGTEYALCGT----------
I3WJK0_BIFBI          VGVLCLLAGWFYTGGKHPYGYAGFG--ELSVFLFFGLAAVLGTQYALSGS----------
Q83H01_TROWT          VGVFSIAAAYLYTAGPFPYAYFGLG--ELSVFIFFGPVTVIGTVFLLSGI----------
MENA_ECOLI            LGGLSIIAAITYTVGNRPYGYIGLG--DISVLVFFGWLSVMGSWYLQAHT----------
B7LA27_ECO55          LGGLSIIAAITYTVGNRPYGYIGLG--DISVLVFFGWLSVMGSWYLQAHT----------
Q57HC7_SALCH          LGGLSIIAAITYTVGNRPYGYIGLG--DISVLVFFGWLSVMGSWYLQAHT----------
C0Q440_SALPC          LGGLSIIAAITYTVGNRPYGYIGLG--DISVLVFFGWLSVMGSWYLQAHT----------
A0A0H3BR13_SALNS      LGGLSIIAAITYTVGNRPYGYIGLG--DISVLVFFGWLSVMGSWYLQAHT----------
A0A0H3H3Z8_KLEOK      LGGLSIVAAITYTVGTRPYGYIGLG--DISVLVFFGWLSVVGSWYLQAHS----------
A0A0H3FLY7_KLEAK      LGGLSIIAAITYTVGTRPYGYIGLG--DISVLVFFGWLSVVGSWYLQAHS----------
W1EQ74_KLEPN          LGGLSIVAAITYTVGTRPYGYIGLG--DISVLVFFGWLSVLGSWYLQAHN----------
C5BB80_EDWI9          LGLMAIIAAITYTVGTRPYGYIGLG--DISVLIFFGWLSVAGTYYLQAGT----------
A0A384L2R4_YERPE      LGLMAIVAAITYTVGRKPYGYMGLG--DISVLVFFGWLSVAGTYYLQAGH----------
A0A433N1U4_9GAMM      LGLLAIFAAITYTVGNKPYGYIGLG--DISVLIFFGWLSVAGSYYLQTGH----------
H8NV38_RAHAQ          LGLLSIGAAITYTVGTRPYGYMGLG--DISVLIFFGWISVAGTFYLQAGY----------
D3V6W0_XENBS          LGVLAIVAAITYTVGTKPYGYMGLG--DLSVLIFFGWLSVIGTYYLQANT----------
Q6LVI4_PHOPR          LGVMAIAASIAYTVGNKPYGYRGLG--DISVLTFFGWLGVAGTYYLQAGQ----------
B0UV43_HISS2          LGLLAILAAITYTVGTKPYGYLGLG--DVSVLIFFGLLGVGGTYYLQTHQ----------
MENA_HAEIN            LGILAIVAAITYTVGVKPYGYMGLG--DISVLVFFGLLGVGGTYYLQTHS----------
A0A378NC05_MANHA      LGIVSIIAAITYTVGKKAYGYLGLG--DLFVLIFFGFVAVIGVFYLQAHS----------
K0G771_ACTSU          LGVISIVAAITYTVGKKAYGYLGLG--DLFVLIFFGFVAVIGTFYLQAHS----------
G1UB90_HAEDU          LGVVSIIAAISYTVGKKAYGYLGLG--DLFVLIFFGFVAVIGSFYLQAHS----------
F0LRU4_VIBFN          LGVLAMMAAIAYTVGNKPYGYVGLG--DLSVFLFFGLLGVSGTYFLHIGH----------
Q9KNQ8_VIBCH          LGVLAILAAIAYTVGNKPYGYVGLG--DLSVFLFFGLLGVSGSFFLHTGY----------
I4AJL1_BERLS          LGLFCIAGAILYTAGKKPYGYMGLG--DIAVLIFFGWVAGGGTYFLQAQASTLFDFQT--
Q11YA0_CYTH3          VGILSIAAAVTYTSGKKPYGYAGLG--DISVFIFFGLVAVCGTYFLQAGE----------
G0J314_CYCMS          IGISAIIAAIAYTSGKRPYGYAGLG--DISVFLFFGCVGVMGTYYLHTLS----------
I2EY83_EMTOG          LGLISMLAAYTYTAGKKPYGYAGLG--DVSVFIFFGLVGVLGSNYLFTKS----------
D2QBD3_SPILD          LGLLSIAAAIGYTNGKRPYGYAGFG--DIAVLIFFGWVGVLGTYFLYTLS----------
E4RUU5_LEAB4          LGILAIGAAYTYTAGKRPYGYQGLG--DISVFLFFGLTAVIASYFLYTLH----------
E4T4N3_PALPW          LGLAAIAAAIKYTVGKNPYGYRGLG--DIFVFIFFGLVGVIGTYFLHTQS----------
G8R827_OWEHD          LGLLAIVAAITYTVGRRAYGYSGLG--DISVLIFFGIVGVVGSYFLQTNM----------
C7M701_CAPOD          LGVLCVVAAIKYTVGQSAYGYRGWG--DLFVFVFFGLVSVVGSYFLYTES----------
H1ZAR9_MYROD          LGISCVAAAIKYTVGQSAYGYRGLG--DLFVFIFFGLVSVMGSFYLYGQT----------
D5BHI6_ZUNPS          LGVASIVAAIKYTVGNSAYGYRGLG--DIFVFIFFGIVAVFGSFFLYVND----------
G0L7N0_ZOBGA          LGAASIWAAIKYTIGASAYGYRGLG--DVFVFLFFGLLAVMGSMFLYTKS----------
F0RAE4_CELLC          LGFCAVWASIKYTVGKSAYGYRGLG--DVFVFIFFGLVSVLGAMFLLTKT----------
G2PK12_MURRD          LGLLSIWAAITYTVGSNAYGYRGMG--DLFVFLFFGLLGVLGSMFLYTKS----------
H8XPE4_FLAIG          LGLASIAAAIKYTVGKNAYGYSGFG--DVFVFIFFGLVSVLGSNFLFTKT----------
F2IBY0_FLUTR          LAIASVLAAITYTIGKKAYGYNGMG--DLFVFIFFGLVSVIGVYPLFSDT----------
E4TBG6_RIEAD          LGVLSILAAIGYTVGKKPYGYMGLG--DIMVFIFFGLVSVVGSYFLFTKS----------
I4A276_ORNRL          LGLLCIWAAIQYTVGKKAYGYRGLG--DIFVFLCFGLISVIGTTMLFTKS----------
A0KFP0_AERHH          LGGAAIVAAITYTVGKTPYGYRGFG--DISVFLFFGLLGVLGSYYLFTKT----------
C4L9G5_TOLAT          FGTLALVAAVTYTVGRRPYGYRGLG--DLSVFLFFGLLGVLGTYYLFTRQ----------
A1SRV4_PSYIN          LGLLAIVAAITYTMGKLHYGYRAMG--DLAVFLFFGLVGVVGSYYLYGLT----------
D5ESR9_PRER2          VGMICVLFAFLYTTW---FSYQGLG--DLLVLVFFGLVPVCCTYYIQLHE----------
I6ZRI5_MELRP          IGIVSILAGIAYTAGPLPLAYNGLG--DIAVFLFFGLVGTTGTYYVQAAR----------
I0AJ70_IGNAJ          IGIFSIIAGLAYTAGPYPLAYHGLG--DLFVFLFFGIIGTMGTYYLHHLE----------
B3EKW4_CHLPB          VGLLSMFFAWAYTGGPFPIAYSGLG--DLFVFIFFGLVAVGGTYYVQAQE----------
B3QXE0_CHLT3          VGLLSLFFAWGYTGGPYPLAYNGLG--EVFVFIFFGIIAVVGTYYVQALS----------
A7NL00_ROSCS          IGVLSIAAGVLYTGGPWPLGYHGLG--DLFTFIFFGVVAVTATAYLHVGA----------
A9WBE2_CHLAA          IGLLSIAAGILYTAGPFPLGYHGLG--DLFTFVFFGLVAVIGTDFAHTGQ----------
B9L3E1_THERP          IGLASIAAGILYTAGPVPLGYAGLG--DVFVFVFFGLVAVGGSSYLQTGS----------
D0LH50_HALO1          IGIASILSGIAYTGGPYPLGYHGLG--DLFVIIFFGFVAVCGTAFVQLGS----------
I0I761_CALAS          IGVAGILAALAYTGGPFPFGYYGLG--EAFVFLFFGVAAVCGTYYVQTLT----------
E4NMD2_HALBP          IGLLSVASGIAYTGGPFPLGYHGLG--DLFVFIFFGVVAVTGTYYVQAAAVIADPLSVGI
A0A1U7EWI7_NATPD      VGLASIVAGITYSGGPLPYGYRGLG--DLFVFVFFGLVAVAGTYYVQAAA-HGGWFPLWI
L0IAV4_HALRX          IGLTGVLFGWAYTGGPYPLGYHGLG--DVFVFVYFGLVAVGGTYYVQAADTLVEGVPLSV
Q07ZK1_SHEFN          LAAASILGALCYSGGPYPLASHGLG--EIAAFVFFGLVAVVGSYYLQAGT----------
Q12NM3_SHEDO          LAAASLLAVICYSGGPYPLASHGLG--ELTVFIFFGLVAVVGSVYLQTGA----------
Q6APS3_DESPS          VMIASVLGALGYSGGPYPLASNGLG--EIFVFIFFGLIAVCGTYFILAAQ----------
B1ZZ52_OPITP          IGLASILCGIAYTGGPWPLAYHGLG--DVFVFIFFGLVAVGATYFVQAGA----------
D5EKA8_CORAD          VGVASVVCAWCYTGGPLPLAYNGLG--DVFVILFFGFIAVGCTYYVQAGT----------
F8L8Z7_SIMNZ          LAALSIVLGYLYTGGPFPLAYLGLG--DLFVLIFFGPVAVAGTVYLQTHE----------
Q2S2V4_SALRD          VGVASIGAAIWYTAGRYSLAALGLA--DVFVFVFFGPVAVGGTYYVQALS----------
C7RR98_ACCPU          IGLASLLAGWAYTGGPRPVAYTPLG--ELFVLLFFGLVAVGGSYYLQTL-----------
G8QJX2_AZOOP          LGLASLFCGWAYTGGPKPIAYGPFG--EVFVWLFFGLGAVLGTYYLQTG-----------
C4ZL14_THASP          IGLASLIAGWAYSGGPRPISHSPLG--EFFVLLFFGVFAVLGSHWLQSR-----------
A1WW86_HALHL          LGILSVLAGYAYSGGPFPISRGPLG--ELFVIFFFGLVAVGGVVYLYTG-----------
Q2RNW3_RHORT          IGLLALLAGYGYSDGPWPISRGPWG--EVMVIAFFGIAAVAGTAFLCGG-----------
H6SP86_PARPM          AGLASLLAGYAYSAGPWPIARGPFG--EVFVTLFFGLVAVAGMTFLITG-----------
W5X374_BDEBC          IGLVSVLMGYAYTAGPFPLAYLGLG--DLFVILFFGLLAVSGIVFLNTG-----------
D6YW76_WADCW          ILLFSVLCGYLYTGGPYPLAYTGLG--DLFVLIFFGFVATCSVYYLQAG-----------
Q6MCB2_PARUW          ILFFSTLCGYLYTGGPVPLAYYGLG--ELFIFIFYGLVAIPSAFYLQTK-----------
B2UL43_AKKM8          IGIPSLYFTYGYTGGPWPLAYKGLG--EIFVILFFGLVAVLGTILVQIGT-APVVPGTLV
B8FA11_DESAL          IGLASIAFAYLYTGGPKPLSYLGLG--EVLAFIFFGPVAVGGTYYLQTL-----------
E1X1B0_HALMS          MGILCILAAYGYTGGPFPFSHYALG--ELFALIFFGPVAVWGTYYLQYK-----------
Q7MT15_PORGI          VGVVVAIGALSYSAGPYPLAYHGLG--EIAVFIFFGLIPVLFTYYVQAES----------
F4KKK2_PORAD          LGALIILFAWMYTGGPYPLAYLGLG--DVAVMTFYGWVAVMTTYYLLTGA----------
H8MKQ6_CORCM          GGAVCLAGAVLYSAGPVPLGYMGLG--DLLVLLISGLLGVTGSYGVLTHR----------
W8YD75_BACTU          IGLIGMAVGYLYTGGPLPIAYTPFG--ELVSGLLMGTCFVLIAFFIQTNTVTIE------
Q81BK6_BACCR          IGLIGMAVGYLYTGGPLPIAYTPFG--ELVSGLLMGTCFVLIAFFIQTNTVTIE------
A0A0F6FRY2_BACTK      IGLIGMAVGYLYTGGPLPIAYTPFG--ELVSGLLMGTCFVLIAFFIQTNTITIE------
A0A0F7RFG2_BACAN      IGLIGMAVGYLYTGGPLPIAYTPFG--ELVSGLLMGTCFVLIAFFIQTNTITTE------
MENA_BACSU            IGLVGMAIGYLYTGGPLPIAYTPFG--ELFSGICMGSVFVLISFFIQTDKINMQ------
F2F7P2_SOLSS          VGLVCMLIGYLYTGGPYPIAYSPFG--ELVSGAVMGMGIVLIAFFIQTGDVTAD------
B1YK29_EXIS2          IGIVSMFVGYIYTGGPLPIAYTPFG--EIVAGFFMGYVIIAISAYLQIGYVPTE------
I0JPY9_HALH3          IGLVSMLFGYLYTGGPYPIAYTPFG--ELTAGFFMGTIIVGISYYIQRLTISWE------
Q8Y6K7_LISMO          LGAICMLVGFLYTGGPYPIAYTPFG--EIMAGFFMGGIITFISFYIQAEFISSF------
A0AJD1_LISW6          LGAICMLVGFLYTGGPYPIAYTPFG--EIMAGFFMGGIITFISFYIQAEFISSF------
Q4L545_STAHJ          VGIVCMAIGYLYTGGPMPISWTPFG--ELFSGLFMGMIIILLAFFIQTGNINSF------
A0A0E1VIS7_STAA3      VGLVCMAVGYLYTGGPFPISWTPFG--ELFSGVFMGMFIIVIAFFIQTGNIQSY------
A0A166NHB3_STAPS      VGLLCMAIGYLYTGGPFPISWTPFG--ELFSGVFMGMIIIVIAFYIQTGHLQNY------
B9E7P8_MACCJ          VGIVCMAVGYFYTGGPVPISWTPFG--EIFAGFFMGYVIIMITFYIQTGHLHVY------
C8WXX2_ALIAD          VGVLCMAVGYFYSGGPVPLAYTPFG--EIAAATAMGPTIVLIAFYLQSGTVTLR------
Q67QI7_SYMTH          VGLACLGVAFLYSGGPLPLSSTPFG--ELAAGFTMGPVMILLVYYTQTLRVTAT------
Q1AUL4_RUBXD          LGCLSALGGYLYSAGPRPIAYTALS--EAAVFVFMGVLIVVISYAVQTASSFPAH-----
D8GIH8_CLOLD          LGTIGALSGYFYTGKPLILKYRGLG--APLIFMIFGPLMTLGGYFVQVQRININ------
Q9X1L4_THEMA          LGLTGLVLGYAYTGHPFYLKYKSLG--MFLVFILMGPLMVLGAYYVQTGRFSLE------
A2BMF3_HYPBU          LGLAGFILAYSYTGPPLNLKYRGLG--ELGVFIAWGPLMVVGGAYVASGSLSLE------
B8FCL3_DESAL          VGAAGIFIAVAYTAPPIALKYHALG--EPMVFLCWGPLAIQGAYFVQTGAFSLP------
Q1MQB4_LAWIP          FGVIGLIGSATYTTGSSPYKYKGLG--PIFVFFLMGPCMVLPAYYVQADVLTWS------
Q1MQB6_LAWIP          FGFIGFLGAASYTTGWSPYKYKGLG--PIFVFFLMGPFMVLPAYYIQTYSLNMN------
B8CY37_HALOH          LGTLGALAGYFYTASPISYKYYGLG--GPSIFIFMGVMMVWGMFYIQTGI----------
I4C2Q9_DESTA          VMGFSFFSSVFYTAPPIRYGYLGLG--ELFVGINMGPIMVGGTAAAVAGG----------
F3ZW58_MAHA5          LGLFGAIIGYAYTLPPASISYKGWG--ELLIGLAFGPLSVLGSYYVQSGG----------
                                 *            .          *                        

D2PVS5_KRIFD          ----LHWTAVAGAVAIGAIACALLVANNLRDIPTDRETGKRTLAVVIGAARSRQLYAGLI
A6W5N5_KINRD          ----VDGTSLAGAFCVGFLACAILVANNLRDVPTDTVAGKRTLAVRIGEARSRRLYAGLV
MENA_MYCTU            ----VDWVGLAQAVATGALSCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLL
K0KFH5_SACES          ----ITGIGIGGAIAMGAFSTGVMIANSLRDIPTDVQAGKRTLATTLGDKDSRRLYLGLV
C4LLA5_CORK4          ----VNWAGVAIAVAIGSVSAAVNLANNLRDIPSDEATGKITLAVRLGDRGSRTLWCILA
R0JJJ1_CORCT          ----VSWAGLAAAVGVGSMSAGVNLANNIRDIPTDSKTGKITLAVRLGDAGARKLFLALI
D6Z868_SEGRD          ----ISASGALCAVGAGSFSAAVLAVNNLRDIDGDRASGKRTLAVRLGEPRARLLYLALA
E8NG47_MICTS          ----IPQEAWFGAVAAGLLACAVLLANNLRDIDQDRLAGKRTLSVLIGRRATQVLFT-LF
B0RCZ9_CLAMS          ----ITGEGWLGGVAAGGFACAVLMVNNIRDIEQDGKVGKRTLAVRLGPRGSRIVYC-IE
B2GHK2_KOCRD          ----LNADAWVMSVSTGLFACALLMANNVRDIPGDREVGKQTLAVRLGDPRARLAFT-AE
E1VYH2_GLUAR          ----LTFTSLWGAIGTGLIGCALLMANNVRDIPTDKEVGKITLAVRLGEHNARLSYV-LM
E3H075_ROTDC          ----LTVTGWVSAIAIGLISCALLMANNVRDIPTDRKSGKLTLAVRLGDWRARIAYC-AE
F5XLQ4_MICPN          ----IPWQTWPVAVGIGAIACSILVANNLRDLRGDLVVGKRTLATRLGDTGTRWFYTALI
I6Y0M1_PSEPQ          ----APPASWVAATGIGALASALLVVNNLRDLTADAEVGKRTLATRLGDSGTRVFFVALL
M5A1W1_9ACTN          ----ITWLSIAMGSAAGSLACALLVINNLRDIPTDREVGKQTLAVRLGDARTRWFYV-LL
C7MFJ4_BRAFD          ----PSWVAVLASIAIGLLAVALMLTNNLRDIPTDELSGKRTLAVRLGDRGTRRLYA-AT
C7M0N6_ACIFD          ----LPADGWILAIGLGLAISAILMVNNVRDVDGDRLAGKHTLAVRLGESTTRA---LFV
D6ZKM9_MOBCV          ----LPWQSWALASGLGLLSCALLMVNNLRDIPTDRKSGKVTLAVRLGDAWSRRIYRLFI
K4IN59_BIFAP          ----VDATGILGACVCGLNAVGLLMLNNYRDLDDDRLAGKHTFAVLVGARAAAISIYLVY
K4IPV7_BIFAP          ----VDRHGFIGALVGGLICIPVLEINNYRDIDADPLAGKYTLSSFIGARGTLILMGSCY
A1A0C5_BIFAA          ----ISTEGMLGGANVGLIAVAVLCVNNLRDVETDRTHGKHTWMTALGRRNGTV---FAI
B8DW73_BIFA0          ----VNGNGVYGAVVIGAVSAAVMAVNNLRDVNTDRESGKRTLAVRIGARAFTVCLCVLI
B3DQI5_BIFLD          ----VDVGGLLGAVAAGLFSCLIMMVNNIRDIDEDREHGKCTLAVRLGESGART----LL
I3WJK0_BIFBI          ----VSVLGVLCAVVAGLLSCQILMVNNLRDINEDRRHGKRTLAVRMGERGARV----ML
Q83H01_TROWT          ----VTLSSFLVAVVAGSWSAAILLMNNLRDHESDMQSNKRTFSVLFGVLIARI---VCI
MENA_ECOLI            ----LIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGEVNARRYHACLL
B7LA27_ECO55          ----LIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGEVNARRYHACLL
Q57HC7_SALCH          ----LIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGDVNARRYHACLL
C0Q440_SALPC          ----LIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGDVNARRYHACLL
A0A0H3BR13_SALNS      ----LIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGDVNARRYHACLL
A0A0H3H3Z8_KLEOK      ----VEAVIFLPATACGLLATAVLNINNLRDIDSDRENGKNTLAVRLGPVNARRYHACLL
A0A0H3FLY7_KLEAK      ----IEAVIFLPATACGLLAAAVLNINNLRDIDSDRLNGKNTLAVRLGPVNARRYHSVLL
W1EQ74_KLEPN          ----VEAAIFLPATACGLLATAVLNINNLRDIDSDRQNGKNTLAVRLGPVNARRYHACLL
C5BB80_EDWI9          ----FNRVVMLPATACGLLAAAVLNINNLRDIENDARNGKNTLAVRLGPHIARYYHVALL
A0A384L2R4_YERPE      ----FDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLAVRLGPVVARYYHALLI
A0A433N1U4_9GAMM      ----FDSIVMLPATACGLLATAVLNINNLRDIDNDRISGKNTLAVRLGAEKARFYHTMLL
H8NV38_RAHAQ          ----FDWIVMLPATATGLLSTAVLNINNLRDIETDSANGKNTLAVRLGPVNARRYHAIIL
D3V6W0_XENBS          ----FDLSTVLPATACGLLSVAVLNINNLRDIESDRQNGKNTLAVRLGAKKARYYHAALL
Q6LVI4_PHOPR          ----IDSIIMLPATACGLLAVGVLNINNLRDIDNDRACGKLTLAVRMGPDWGRKYHLFLL
B0UV43_HISS2          ----LNWLIFLPATATGLLATAVLNINNLRDIEQDRKAGKNTLVVRLGAENARIYHCIIL
MENA_HAEIN            ----IDSHIILPAIGSGLLASAVLNINNLRDIEQDAKAGKNTLAVRLGAYKGRVYHCILL
A0A378NC05_MANHA      ----LPIMILLPAFGCGLLSVAVLNINNLRDINQDRQAGKNTLIVRIGSQNGRKYHVALL
K0G771_ACTSU          ----IPAMIFIPAFGCGLLSVAVLNINNLRDINQDKQAGKNTLIVRIGSQNGRIYHVTLL
G1UB90_HAEDU          ----IPIIILLPAFACGLLSVAVLNINNLRDINQDRQAGKNTLIVRIGSDNGRIYHMLLL
F0LRU4_VIBFN          ----IEWSLFLPSLGCGLMAVAVLNVNNMRDIENDAECGKRTVPVRLGQQRAKTYHFLLL
Q9KNQ8_VIBCH          ----IEWSLLLPSLGCGLLAVAVLNVNNMRDIENDAQCGKRTVAVRLGQVRAKQYHFALL
I4AJL1_BERLS          ----ISWDIFLPATSCGLFAVGVLNLNNIRDIKSDILAGKNSIPVRIGKEKANIYHALVI
Q11YA0_CYTH3          ----INSDVFLPAISCGLLSTAVLNVNNLRDIESDALAGKRSIPVRIGPVKGRFYHLFLI
G0J314_CYCMS          ----FDPTLWLPAAAIGLLSTAVLNINNIRDIQSDKAAGKLSIPVRIGKKAAENYHWGLI
I2EY83_EMTOG          ----FSWLNVLPAFSCGLFATGVLNINNIRDIESDTRAGKKTIPARLGKPKAIIYHWFLL
D2QBD3_SPILD          ----FSPLLLLPATSVGLFATGVLNINNIRDIETDTMTGKRSIPARLGLSLAIRYHWGLL
E4RUU5_LEAB4          ----LEWEIALPAISCGALATGVLNINNLRDRTSDEKAGKITLAVRLGRKGTIYYHFLLL
E4T4N3_PALPW          ----FRWDILLPASAIGFLSTGVLNMNNMRDYEADKNAGKTTIVVAMGVKKAAYYHLFLV
G8R827_OWEHD          ----LNWEVFLPATSVGLLAVGVLNLNNMRDIENDRAAGKRTLVVMMGLKGAKIYHGVLI
C7M701_CAPOD          ----LNKVICLPAIAIGLLSVAVLNLNNMRDYENDKRSGKHTLVVKMGIPMAKYYHYYLV
H1ZAR9_MYROD          ----IDPWIILPAVAVGNLSIAVLNINNMRDLDADKMVGKNTLAVKLGRQNAKYYHYFII
D5BHI6_ZUNPS          ----FDWAVLIPAAAIGLLSAGVLNLNNMRDRVPDERSGKITLAVKLGEKGAKTYHYFLI
G0L7N0_ZOBGA          ----LNAMALLPAAAIGFLSAGVLNLNNLRDYESDKKANKNTLIVYIGFSNGKKYHYALL
F0RAE4_CELLC          ----LFTMAFLPAITIGLLSVAVLNLNNLRDIISDKNSGKNTIVVKMGFLNGKKYHYSIL
G2PK12_MURRD          ----LGWSSLLPAISIGLLCVAVLNLNNLRDIVSDKKHGKITMVVKMGFKNGKRYHFLLI
H8XPE4_FLAIG          ----LDWKLILPAIAIGLLSVAVLNLNNMRDIENDKIANKNTLVVKKGLAWAKKYHEVII
F2IBY0_FLUTR          ----LSWILIFPAITIGFLSTAVLNLNNLRDRENDEKVGKRTLVVKLGASNAKKYHYFLI
E4TBG6_RIEAD          ----LDWDIFLPATAVGMMSVSVLNLNNMRDIESDKASGKHTLALKLGFRKAMVYQMILM
I4A276_ORNRL          ----FIPTLLLPASAIGLLSTAVLNLNNMRDLPQDKEKGKITIPVKIGMAKAKKYHSVLL
A0KFP0_AERHH          ----LQWDLLLPATACGLLATAVLNINNVRDIETDAVSGKITLAVRLGRNRAIAYHWVLL
C4L9G5_TOLAT          ----FDPLLILPAAGCGFLATAVLNINNIRDMDTDIATGKRTFAARIGRSWARRYHWFLV
A1SRV4_PSYIN          ----FSWSLLLPATSVGLLSAAVLNINNMRDIYTDKEAHKTTLVVLWGLKNAFIYHLSLI
D5ESR9_PRER2          ----FTWELVLASIACGLVIDALLIVNNFRDRDNDRQAGKNTIIVRLGAKAGLQLYIGVG
I6ZRI5_MELRP          ----ISPLAFWASVPVGALITNILVVNNYRDREEDRMNGKNTLAVLMGEKFTRYQYVFFM
I0AJ70_IGNAJ          ----FTIVSFLVSLPVGALITNILIVNNYRDIEEDKVAGKNTLAVIFGKEFSRYEYIFFL
B3EKW4_CHLPB          ----VTFPVLTAAIAPGLFSVNILLVNNIRDIDTDRKVGKMTLPARIGGGNARWLYLGFT
B3QXE0_CHLT3          ----TTSAAFIVSLAPGAIASNILGVNNIRDIETDAKVNKRTLAVKIGLANAQKLYVFFN
A7NL00_ROSCS          ----VPPLAWAASIPVAMLVTAIIVVNNLRDIVTDRAAGKRTLAVIIGARATRAEYAFLV
A9WBE2_CHLAA          ----FRWIALWAALPIAMLVTAILVVNNLRDAPTDRKAGKRTLAVIFGERFARSEFAILV
B9L3E1_THERP          ----LSGLALLAAVPVGSLITAILVVNNLRDIPTDRAAGKRTLAVRIGERATRWQYAVLV
D0LH50_HALO1          ----VPALAWGAAVPVGCLATAILVVNNVRDRETDARTGKHTLAVRFGREGGVAEYMTLL
I0I761_CALAS          ----LTLPVVLASFAVGALVTAILVVNNYRDIETDRRAGKRTLAVRLGRRGTQLEYVILL
E4NMD2_HALBP          PPNTLPFDAFVASLAVAALSTNILVVNNVRDKEEDETTGKRTLAVRFGYTFSRGEYLAML
A0A1U7EWI7_NATPD      PEGTLPAAAVVAGLPAAGFSTAILVVNNIRDRETDAEAGKHTLAVILGYRLSRIEWSLMA
L0IAV4_HALRX          PPEAITALALLAGVPIGALATAILVVNNLRDIDTDRETGKRTLAVRYGRRFSKYQWASLV
Q07ZK1_SHEFN          ----TTMTAWLLGCAIGFFNAAIMLVNNTRDISTDTKAGKNTLAVRIGEAQAKVLYQSFV
Q12NM3_SHEDO          ----TSQEAWLLGAAIGSLNAAIMLVNNVRDINTDAKAHKRTLAVRLGQGQARVFYQTLV
Q6APS3_DESPS          ----LVASAFLVAIPPGLLITAIMVINNLRDIDTDSRSGKKTLAVILGRSRTILEYRLLL
B1ZZ52_OPITP          ----IYPDVLLAAVPIGLLATNILVVNNYRDVETDAAAGKRTLVVRWGRRAARLQHAGSL
D5EKA8_CORAD          ----VTAEVFAVGLACGLLVNNILVVNNYRDREEDVLANKRTLIVLLGRSFGMLLYLTST
F8L8Z7_SIMNZ          ----LSSIAILAGLAPGLISTAILTSNNMRDVKEDRIAGKKTLPVRFGLTFGRLEYALCL
Q2S2V4_SALRD          ----LPTEVLLAGGGPGLLSIGILLVNNVRDVAEDRRAGKRTLVVRFGRRFGVAAYGACL
C7RR98_ACCPU          ---SIRSPALLAGAMVGLFGAAVITVNNTRDLAIDARVGRRTLAVVLGRRSAAWVYTAEM
G8QJX2_AZOOP          ---GLSRAALALANMSGLFAAAVIVVNNTRDRAGDARAGKRTLAVRLGLTGCRVEYGLLM
C4ZL14_THASP          ---ALGHLDLLAGLAVGAPAAAVLLVNNYRDLAGDLRAGRRTLAALLGAEGARRAFALLV
A1WW86_HALHL          ---SISPPALVMGVTLGLPAAAVLLVNNLRDREGDREAGRATLAILLGPVGSVWLFGGLL
Q2RNW3_RHORT          ---GWSLPAVILGAVLGLPAAGVLLVNNTRDHDDDRLAGRRTLAIRLGPGKARTLYAGML
H6SP86_PARPM          ---TVTLAALLLGLGVGLTAAAVLLVNNTRDREGDTRAGRRTLAIRLERPGINRLYAWFM
W5X374_BDEBC          ---EWYSEAMILGLQIGFHATVLIAINNLRDHKGDALVNKKTMAVRFGEKFSRYEIAFLA
D6YW76_WADCW          ---VVTVQSLVAGAQAGLLATVLIAVNNMRDIEGDAKAKKCTLPVRFGLTFARWQVTALL
Q6MCB2_PARUW          ---FVNQTVFIGAIQMGFLAMIPNAVNNLRDRQSDAKVDKKTLAVRFGTTFACWEITFFA
B2UL43_AKKM8          ESLAVYNAGIVTGIQCGLLCAVMISVNNIRDRKEDLTTGKRTLAVRLGEGKARAMAQSFI
B8FA11_DESAL          ---EISKTVIVAGMGPGFLAAMLMSVNNLRDIASDTRTGKRTVAVMLGERRARIFSLSLL
E1X1B0_HALMS          ---EFNLDIIILGLGPGLISAAIMSVNNLRDIESDSKTQKVTIATLVGEKFARAFTLSLV
Q7MT15_PORGI          ----FPSDLWHLGAAMGFAGVNILIVNNYRDYEEDRKSGKRTILVKKGRDLGPKLYLACG
F4KKK2_PORAD          ----ITTQSFLVATAMGAVAVNILVVNNYRDYEEDRKNDKRTSIVRLGQEFAPKFYLANI
H8MKQ6_CORCM          ----LSGDVVLAGLSMGLIAAGILAVNNLRDRETDVLAGKRTLVVRFGRRFGQWEYTLAV
W8YD75_BACTU          --------SVLISIPIGILVGAINMSNNIRDIEEDIKGGRKTLVILLGREKAVVTLAVAF
Q81BK6_BACCR          --------SVLISIPIGILVGAINMSNNIRDIEEDIKGGRKTLVILLGREKAVVTLAVAF
A0A0F6FRY2_BACTK      --------SVLISIPIGILVGAINMSNNIRDIEEDIKGGRKTLVILLGREKAVVTLAVAF
A0A0F7RFG2_BACAN      --------SVLISIPIGILVGAINMSNNIRDIEEDIKGGRKTLVILLGREKAVVTLAIAF
MENA_BACSU            --------SILISIPIAILVGAINLSNNIRDIEEDKKGGRKTLAILMGHKGAVTLLAASF
F2F7P2_SOLSS          --------AVIISVPSMILVGAIMLSNNIRDIVGDTEGGRKTMAILVGRHNAVTVLAGFF
B1YK29_EXIS2          --------AIAISIPVSILIGSILLANNIRDLDNDKVNGRKTIACLVGHQKAVYVLIAFF
I0JPY9_HALH3          --------VILVSIPVAIFVGAILLANNIRDRVGDADNGRRTLAILFGHKGSIRFLTVLF
Q8Y6K7_LISMO          --------IVYVSIPVMVLVGNLLLANSIRDLVPDKKNGRLTLAILLGRKWATVLFAAAF
A0AJD1_LISW6          --------IVYVSIPVMVLVGNLLLANSIRDLVPDKKNGRLTLAILLGRKWAIVLFAAAF
Q4L545_STAHJ          --------VVWISIPIVITIGLINMANNIRDRVKDQASGRKTLPILLGKRASITFMAVMY
A0A0E1VIS7_STAA3      --------VIWLSVPIVITIGLINMANNIRDRVKDKASGRKTLPILLGKNASLTFMAIMY
A0A166NHB3_STAPS      --------AFWISIPIVITIGLINMSNNIRDRVKDSQSGRRTLPILLGKRGSLIFLATFY
B9E7P8_MACCJ          --------PAIASIPVSINIGMINMANNIRDRVKDKESGRKTFVILVGKTLAIYTMAALY
C8WXX2_ALIAD          --------ALWVSIPIGLLIGAILFANNMRDMAQDAEGGRRTMVILIGRERGRVLFASVF
Q67QI7_SYMTH          --------ALWVAVPIGILIGAILLANNIRDIEADRAGGRHTLPIVLGRGAAVGVLAGSF
Q1AUL4_RUBXD          --------VALAALPIGGLVAAILLANNIRDMDSDRRGGRRTLPIVLGRRGGILIYRALL
D8GIH8_CLOLD          --------VLLLSIPIGLLTTAILHANDIRDIYHDKKAGIKTLSIMTGKTNACYIYYGLV
Q9X1L4_THEMA          --------ALLVSIPVGIATDLILLANEIRDSEFDRRSGIKTLPILIGDRAASFLYAVLT
A2BMF3_HYPBU          --------AAAASVPLGLLVAAVLLANNIRDVENDRESGAYTLAVRIGRRSAIKLYQSMI
B8FCL3_DESAL          --------LLLVSAPFGALVSLVLLANNLRDAEFDRRQGISTIPVRFGGRSGRLLFAGLI
Q1MQB4_LAWIP          --------SFFASLPISFLVTAIMHANDLRDIQHDKLANISTVAIWLELKSSLVLYRILC
Q1MQB6_LAWIP          --------IFFVSIPIAFLVTAIMHANDLRDIEYDNASGIKTIALWLGFKRSLLLYKVIC
B8CY37_HALOH          ----NSWYPVLVGLPVSFLITGMQHSNELRDYENDMKNGIKTAPVIMGFERARYYYYFLI
I4C2Q9_DESTA          ----SIEKAWAVSIPIGLMVAMILYYQSLPDIKTDKSVGKRTIAVRLGNPAAIWGFRVFA
F3ZW58_MAHA5          ----LSWTPIYASLPMALLITAVLFINEYPDYEQDKAAAKNNLLVHLGKERGLPLYYILM
                                  .             :.  *   *      .                  

D2PVS5_KRIFD          ALAFILAVLCA-LATPW-------------ALLGLIALPLAARAVRTVVS-------DAV
A6W5N5_KINRD          VGAFAAALLTA-PWHPW-------------VLLVLAAGTLAQRPLRTVLG-------GAR
MENA_MYCTU            AVAGVLTFVLM-LATPW-------------CVVGLVAAPLALRAAGPVRS-------GRG
K0KFH5_SACES          TIPFVITLAIS-LRVPL-------------ALLGFLALPLVALGVLRVLK-------GSK
C4LLA5_CORK4          AMPVVASILLAFIATPW-------------ALIGLVAAPVLGLAARPIVS-------HAE
R0JJJ1_CORCT          STPFIMSICLAFVAWP--------------ALIAIIIFPLALKAAGPIRN-------NAT
D6Z868_SEGRD          AAPFLITLGLA-VIHPW-------------TLLSLLAALILVKPASEVRH-------GAR
E8NG47_MICTS          VIAPFVISAFLALFYP-------------VAWLTLIALLGALSSVLIVWT-------YRT
B0RCZ9_CLAMS          VAIAYAVVVFFFLFYP-------------KALLVLFTLVLALPAAIIACT-------GRT
B2GHK2_KOCRD          LLVGMLLPLLLVPHNP-------------WVLLVYAMSPLAVGAASTVLQ-------TPE
E1VYH2_GLUAR          LALAILLPLLATGNFP-------------WMWLILITFIPAVAPSLLMLR-------EQK
E3H075_ROTDC          MLIALLLGAFVVPHNP-------------WFLVTFILLGPTVHSCVTVLF-------KQG
F5XLQ4_MICPN          AAAVAALVLVAATTTW-------------WALLGLGGIALLVPAVRTVLG-------GAQ
I6Y0M1_PSEPQ          VAGAVSVLGVMALSTP-------------WAGLGLLGFVLVLGPAARLLG-------GAI
M5A1W1_9ACTN          VVASFALLAVAAFERP-------------WALLGFAAAPLAFAPSKAVLG-------GAT
C7MFJ4_BRAFD          VLLPFVLMVPVIIAHP-------------LAALVLLAVPLAVGPLRRVRA-------GAA
C7M0N6_ACIFD          TLVAASVVAVALATW--LATDRLVAVAA-VAVVGLV---AAPSAIAPVVG-------GAK
D6ZKM9_MOBCV          YIALLLSLTVLFVPWPEIFPGGFIQWTS-GFVVQLVLWLGALLTMRPVRT-------HQT
K4IN59_BIFAP          ILSLVLGLIQFVPAVMR------HGLPG-FPLVLILLPVAAVFLLICRTF---------A
K4IPV7_BIFAP          ALAVILGVVESWSLSNG------SLAVV-WPRLLCLLPILAMAVATTVAS---------S
A1A0C5_BIFAA          ALLSVAVLLLAAYILL-------LSTPA-MPTIAILAVTCAMCAAAAV---------AIA
B8DW73_BIFA0          ALVMLAMVIPWSVMWI-------HMDSD-LPNLSVLGGYCAVLGEIALILLTVVVEFNVA
B3DQI5_BIFLD          IVCCVAAWAIALLMCA-------TLWWP-WGAVLLISGVGIPVRMVSS----------VN
I3WJK0_BIFBI          GVCCVVAWAIGVWVVM-------LLWTP-WGGILMLSGIGVPWRMVTS----------TG
Q83H01_TROWT          ALIAVPYIVVAILLIEL------PFIGY-VFLTLLLSAPIVIILATAV-----------T
MENA_ECOLI            MGSLVCLALFNLFSLH-SLWGW----------LFLLAAPLLVKQARYVMREM-------D
B7LA27_ECO55          MGSLVCLALFNLFSLH-SLWGW----------LFLLAAPLLVKQARYVMREM-------D
Q57HC7_SALCH          LGALLCLALFNLLSLH-SPWGW----------LFILAAPLLIKQARYVMRER-------E
C0Q440_SALPC          LGALLCLALFNLLSLH-SPWGW----------LFILAAPLLIKQARYVMRER-------E
A0A0H3BR13_SALNS      LGALLCLALFNLLSLH-SPWGW----------LFILAAPLLIKQARYVMRER-------E
A0A0H3H3Z8_KLEOK      FGAPLCLALFNLLSLH-NPWGW----------LFLLATPLLVKQARYVMRER-------D
A0A0H3FLY7_KLEAK      LGAPLCLALFNLLALH-SLWGW----------LFILAIPLLVKQTRFVMRER-------E
W1EQ74_KLEPN          LGALLCLALFNLLALH-SAWGW----------LFILATPLLVKQARYVLRES-------D
C5BB80_EDWI9          GGAVLCLALFALLDLH-SLVGW----------LFVLAVPMLYRHASYVLHQR-------S
A0A384L2R4_YERPE      GAAIFCLALFSILHLH-SWHGW----------IFLLAIPLLGKHALFVLRDP-------T
A0A433N1U4_9GAMM      LLAPVCLGLFATFYLH-SLAGW----------LFILALPLLIQQARYVLRET-------S
H8NV38_RAHAQ          TAAVLCLVIFSALHLP-HWTGW----------LFILALPMLAKHLMRVMKST-------T
D3V6W0_XENBS          ICAILCLAAFTLLHLK-SWSGW----------LFLLAVPLLLKHMWKVLHDQ-------T
Q6LVI4_PHOPR          TGSIVCLALFAGLELR-SPFGW----------LFILSAPLLFQHGKQVFQST-------D
B0UV43_HISS2          LLSALSYIIFALYTFT-HWSNF----------IFILSFPLLIKHAHFVYRNK-------N
MENA_HAEIN            SVAALCYLAFAVATAI-SWTNY----------LFVLAMPLLAKHAIFVYCSQ-------Q
A0A378NC05_MANHA      VLAVISYLIFAISEFE-HWYSF----------IFLLSVPLLAKHARFVYQHK-------D
K0G771_ACTSU          ILAVVSYLIFAISEFQ-HWYSF----------LFLLAVPLLAKHGLFVYRHK-------D
G1UB90_HAEDU          TLAVICYLIFAIIEGN-HWYNY----------LFLLAVPLLVQHALFVYRYQ-------E
F0LRU4_VIBFN          TGAVIAFASYLLMQGKPVWISL----------PFLLSLIMVTKHGRAVWATE-------Q
Q9KNQ8_VIBCH          FGAVAAFAGYLVLQDKPLWISL----------PFLLCLSVVTRHGRAVWFTE-------Q
I4AJL1_BERLS          IGAWLSAILFL-ILNYQKISN----------LIFLIILPLFIWNIIQVFKRK-------D
Q11YA0_CYTH3          AAAWVCASIYV-FNHFTSVFN----------VLYLATLPLFIWHLVLVFKTK-------E
G0J314_CYCMS          ISALVLLLLFV-IIEH-AYGA----------LAYLLMAPSILKTGWAVAKFE-------A
I2EY83_EMTOG          SFGMISMLIFS-YLQAAS--N----------YYYIICFPLFFINGIKVSRLP-------N
D2QBD3_SPILD          IAGMACALIYS-FFTDASALG----------YLYVLAFPLFFLNGRAVATHN-------R
E4RUU5_LEAB4          ALAMFCAWLYI-DLKNGN-------------WYYLLSFPLILLNGFQVAKSE-------N
E4T4N3_PALPW          AGAALLAVIYT-LLNYHSAWQ----------WLFVLSFPILFLNLKKVFTYK-------D
G8R827_OWEHD          ILAFDCVFLYN-ALMDNSFWS----------NLYFISIPFLVANLFSVMRSF-------D
C7M701_CAPOD          ILAMVAMLGFS-VMRLQMRWE----------LLYLVAFLPLIGHLLTVKRNT-------E
H1ZAR9_MYROD          AFALVAFVVYA-IYSAKPLIN----------FVFVLAYFPFVKHLVFVKNNT-------N
D5BHI6_ZUNPS          IGAIFLMTIYS-ALIFEGWDD----------IIFYIAFIPLILHLKRVMQNE-------S
G0L7N0_ZOBGA          VSAFICILVFS-ILNFKSWAT----------YLPLLAFIPIFLHLKRVYRTD-------R
F0RAE4_CELLC          ITSFISVLIFT-IYNYTNVLN----------FMWLLAYIPIAKHFIKVLKMK-------D
G2PK12_MURRD          LMALISFALYL-WMENYGWKQ----------SFFMLAFAPLLIHLRKVMMTK-------D
H8XPE4_FLAIG          LVASLSFMLFC-TLLRVPLFP----------ILAI--NIPLIFHLRKIKSAQ-------H
F2IBY0_FLUTR          LSAFTSWILFL-IFT-KNWLG----------FISLIPIILFIKHLLFVSKNT-------V
E4TBG6_RIEAD          QLPLILVLAFL-MLNQLHERGN------YYAFIVMILLFPMMALRRRIMQVN-------E
I4A276_ORNRL          FSPFILMDIYF-IINDVSLPG--------YFFNALLPFAQKMNIRVTENVI---------
A0KFP0_AERHH          GAALLTTIAFL-LTQPASFWP----------WIFLPAMKPLTDAAKTLRQS-------FD
C4L9G5_TOLAT          LGGGLMAMVYI-VLRAQTAWP----------WLCLPAWGPLILSAWVVATS-------QD
A1SRV4_PSYIN          VGAFICAVYYFSQLENVQAWQ----------FIFLLSFSPLIKSCLILKEAISKDI--RD
D5ESR9_PRER2          VGAMILGGTFLLNGHL---------------LAFVFPFIYLVLHFITYLKIKR----IYQ
I6ZRI5_MELRP          ILS--YAVLFV-VYFTYKNTIAVF--------LPLLSLPLSIKLIRMIFTLK--------
I0AJ70_IGNAJ          LLS--FFVPFI-LYFKFNFTGTIF--------LPYLSFPLAILLAKMIFNYH--------
B3EKW4_CHLPB          IVA--YFVPVW-MWMT-GYSLWVM--------LSWLSLPLAVSQTKTLFGSD--------
B3QXE0_CHLT3          FLA--FFPPVF-LFMT-GYSASVF--------LPFLSAPMAIRLSQKVYRLK--------
A7NL00_ROSCS          IGA--FLALPI-FWLSGVTGPGVM--------LAWLAAPLAIAPLRTMLTGE--------
A9WBE2_CHLAA          IGA--FVSLPL-AWMWGGASPFTL--------LAWLTAPMALNLIDFVNRER--------
B9L3E1_THERP          AGA--YLVPVL-LWLLGWAGPAVL--------LPSLTLPLALRLVGVVLRGAE-------
D0LH50_HALO1          LLS--YITPLV-LLATGLAGWRVL--------LPWLTVPLALEQVRVLLAGAE-------
I0I761_CALAS          TFA--YVMVFV-LWLLLDAGAWVL--------LALLTLPLAVQLVHTLTAAVD-------
E4NMD2_HALBP          ALA--YLVPVW-FATRQTFGGVVF--------LPLVTLPYAISVARTVLTKTS-------
A0A1U7EWI7_NATPD      GLG--YAIPVV-FWL-DGYPATVL--------LPLVTAPLAIAIGRTVWNRTD-------
L0IAV4_HALRX          GLA--YLIPVW-LWIDTELSTFVL--------VPVLTIPHAILVGRLVWREVD-------
Q07ZK1_SHEFN          YLP--FGIIIAGFLLGSLDGLPVL--------LSGTSLIIARNLSREFYDNS--------
Q12NM3_SHEDO          YLP--YGIIISAFLLGFLPGFAVG--------LSGLSLVYARSLSRQFHELS--------
Q6APS3_DESPS          LCA--YLVPLVMFLTGT--SYFIL--------MPFFSLPLAIKLWGEVEHCL--------
B1ZZ52_OPITP          L----IALLVPGWFCWTEGTLWRL--------LPLAILPLAGSHVRRLRAAQT-------
D5EKA8_CORAD          T----TAAAVTVWLVFRGYGLWVL--------LGLLPISRSFVLAMGLRQATG-------
F8L8Z7_SIMNZ          V----IAGMIPIALVMMTGKHFAS--------LLATLTLVPAAPLIKSALRET-------
Q2S2V4_SALRD          VGALLLAGLLAAGLFGTTPHPWAA--------LPLGLLPLAIGPIRRLSETTD-------
C7RR98_ACCPU          --LLPFVL-LPGLAVLAGGGLQLA--------VPLLLLPLALRHIGRFRRAAD-------
G8QJX2_AZOOP          --LAPFVL-LGWLAA-SGHHLAAG--------LPLLALPPALLLVVRFARATP-------
C4ZL14_THASP          --LLPIPT-LILIAA--SGAPGAI--------LGLVGAPALAPLVWRFGRAEG-------
A1WW86_HALHL          A-GVALGL-LGMVAF-GVPWTGAA--------LGLAVLPFGVRIWRALMGAAS-------
Q2RNW3_RHORT          --GLAFAL-LVTLGFVAPPMAGAL--------LGLTCLPLAWRAARRFAQATT-------
H6SP86_PARPM          --GGAVAS-VGLMALSTPVLWGGL--------AVLACVPLARKAIRAFWQAED-------
W5X374_BDEBC          F-APFAL---NIYWWFEGFKIPAI--------VSLFALPLAIKVTRNVFKTEP-------
D6YW76_WADCW          I-TAFGL---NLFWFLKGELWTAL--------LPFAAAPIAISLIKGIWSQTP-------
Q6MCB2_PARUW          I-IPFIV---GIAWWFVNQPYLTL--------FPLGSSPLAFRLIKTIWETKQ-------
B2UL43_AKKM8          L-AAYITLPTSSRALHLNLSHTWW--------MWIPSILFGGYLMLLIRKTPA-------
B8FA11_DESAL          L-FSWLM--PLVYLGEHPAKLIVI--------AAPLSAQFFKDHWRAISNAPL-------
E1X1B0_HALMS          L-LSTFI--PYYAYLKLNLSWSIL--------ATITCYPFFLT-WKQIAKAPI-------
Q7MT15_PORGI          LLSMMVLYPFFSAG---------------GLLLLLLYLAFFMTNYRRLLREE--------
F4KKK2_PORAD          LLAWLLSIVAFKGNI-------------WGIVLLLPYLLYALSVYRQMIHVT--------
H8MKQ6_CORCM          AGAFALPLIAWALSPA----------HPRAWLFTLVGLPLAAVQIRAIWRED--------
W8YD75_BACTU          FIAYLWIAVIVLMGYI-----------SPWALVMFLGLRKPISAIQSFQKGAKD------
Q81BK6_BACCR          FIAYLWIAVIVLMGYI-----------SPWALVMFLGLRKPISAIQSFKKGAKD------
A0A0F6FRY2_BACTK      FIAYLWIAVIVLMGYI-----------SPWALVMFLGLRKPISAIQSFQKGAKD------
A0A0F7RFG2_BACAN      FIAYLWIAVIVWMGYI-----------SPWALVMFLGLRKPISAIQSFQKGAKD------
MENA_BACSU            AVAYIWVVGLVITGAA-----------SPWLFVVFLSVPKPVQAVKGFVQNEM-------
F2F7P2_SOLSS          IVSYIWIAGLVILGHL-----------TPWALLVLLSVKKPIEAIKLFRAKEK-------
B1YK29_EXIS2          AAAIISLLIAVLAFNV-----------TWWALLALLSIPLMIKAVKLFWRDLP-------
I0JPY9_HALH3          LIAYGLTIALIIFSIL-----------PYWSFITLFSVAKGYQAIQGFKGKSQ-------
Q8Y6K7_LISMO          LFSYVFEIALIFTQDA-----------PWWTLLILLSLPEAIRAVRRFIGKTS-------
A0AJD1_LISW6          LFSYVFEIALIFTQDA-----------PWWTLLILLSLPEAIRAVRRFVGKTS-------
Q4L545_STAHJ          IIAYVFVVYTALFVDGG----------SLFYLLVLLSFPMPVKAIRRFKKNDI-------
A0A0E1VIS7_STAA3      FIAYAFIVLTIIIKPGG----------SLFYLLALLSFPMPVKVIRRFKKNDT-------
A0A166NHB3_STAPS      AIAYLFVIYTALFKDGG----------SLFYLLVLLSFPLPVKVYRRFQKNDT-------
B9E7P8_MACCJ          LVSFLAVFYLVFTKPYG----------SLFMLLVLLSFNLPIKAVRRFLHGNT-------
C8WXX2_ALIAD          VAAYLVVVAMVALGVL-----------TPFALLVLLTVPTAVYVVRLYYQYTE-------
Q67QI7_SYMTH          VLAYAIAVGLVATGRL-----------TPWALLILLSLPKAWPPVRLFLRERE-------
Q1AUL4_RUBXD          AEAYVSALALVLAGTV-----------PAACLAALLSLPLARSLWRGIASSTQ-------
D8GIH8_CLOLD          YLSYISVLAMTYYRVT-----------PIWSLLCLITLPTALKNINKLRISNRS------
Q9X1L4_THEMA          GLIYVFIVILVSTGVF-----------RVISLVSLVSLPLYIRVIKQLFQKSAG------
A2BMF3_HYPBU          LAPYIILVVLYTAKLV-----------PLASLVALASLPLAVSLARLMSREVPV------
B8FCL3_DESAL          ALSFGGVAVMAIFGPL-----------PIWSLAVLLALPLAWPMFKMVSQDIPD------
Q1MQB4_LAWIP          LGAFVSLIFVVAFGLV-----------PITGILPLALTPYLNSKLKRLRASEID------
Q1MQB6_LAWIP          IMAFVVLVCLVALRIL-----------PTVALLPLVLFPLLIRKFQRIKYPDIT------
B8CY37_HALOH          ISAYISLVLLITYNLLPLWTT-----------LAFITIPLAYLPVKKVATATS-------
I4C2Q9_DESTA          AASLISIAGLVLFGVVHPVAL-----------LSLVTILQVYGIDRMIRMSRD-------
F3ZW58_MAHA5          LLPYTIIIAFIARGILPAGAL-----------LTMFTVPLAAKAVITAHRYWYD------
                                                                                  

D2PVS5_KRIFD          GPALIPVLQGTGLTELLYAVGLAAGL----------ALGG----
A6W5N5_KINRD          GRDLIPVLKDTGQLELLTGALLALGL----------AL------
MENA_MYCTU            GRELIPVLRDTGLAMLVWALAVAGAL----------AFGQLS--
K0KFH5_SACES          GRDLIPVLQHTGFAMLVWAVATTATL----------FLA-----
C4LLA5_CORK4          GKDLIPVLGMTGRAMVVWALVTTLAL----------WLG-----
R0JJJ1_CORCT          GKDLIPVIGSTGRAMALWAVLTGLAL----------AFS-----
D6Z868_SEGRD          GQALIGALGATGAAMLAWAALTAAAL----------CLFERGLL
E8NG47_MICTS          PRELITALQVTSFTSVAYGALLFWAF----------LA------
B0RCZ9_CLAMS          PKELILSLQLTSMAALTFGLGLGAAF----------AF------
B2GHK2_KOCRD          RRELIPVLKQCGFINLGVTVLYAVAV----------LVYQYVG-
E1VYH2_GLUAR          LSNLVLVLKQTGIVNMVYALLFALAI----------VIEVFA--
E3H075_ROTDC          -PALIPVLKQAGIVALIYSILVAISVWLHGLNLLSNTVEVFTGY
F5XLQ4_MICPN          GPALIAVLKATGSAELTYALGLAVGL----------AFF-----
I6Y0M1_PSEPQ          GRDLIAMLQATSFTELAMAAGLLLGA----------VVGR----
M5A1W1_9ACTN          GPALIPVLGATGKLQLAFGFAATVGL----------AISS----
C7MFJ4_BRAFD          GRDLIPVLGATGRLELVYSLLLLTGL----------LL------
C7M0N6_ACIFD          GRPLVASLAATGRLTLVLGLAFALAA----------WLAA----
D6ZKM9_MOBCV          GKALIVALRNTGFLTLAYGALLGLLF----------ALL-----
K4IN59_BIFAP          RGQVPKAFGMAGKGTLVSALCWSAGLLLQL--------------
K4IPV7_BIFAP          RNRFSRAFALSGYTDLLTGFCWLGVCLL----------------
A1A0C5_BIFAA          RKKYGEALPLCTFSSLALAVTYVCCVVFA---------------
B8DW73_BIFA0          KREYRSAMRNLSWIALAVALVFVGLTMSI---------------
B3DQI5_BIFLD          KRQFRPALPAASFQTLLFAVVLAVSVTL----------------
I3WJK0_BIFBI          RKEFRKALSDACFQPPFFAVILLISLMV----------------
Q83H01_TROWT          SKEFAIAFRLGIICLIPFAIFFTWGLAS----------------
MENA_ECOLI            PVAMRPMLERTVKGALLTNLLFVLGIFLSQWAA-----------
B7LA27_ECO55          PVAMRPMLERTVKGALLTNLLFILGIFLSQWAA-----------
Q57HC7_SALCH          PAAMRPMLERTVKGALLTNLLFVIGILLSQWAV-----------
C0Q440_SALPC          PAAMRPMLERTVKGALLTNLLFVIGILLSQWAV-----------
A0A0H3BR13_SALNS      PAAMRPMLERTVKGALLTNLLFVIGILLSQWAV-----------
A0A0H3H3Z8_KLEOK      PVAMRPMLERTVKGALLTNLLFVIGIICSRLVG-----------
A0A0H3FLY7_KLEAK      PVAMRPMLERTVKAALLTNLLFVIGIIGSKLAA-----------
W1EQ74_KLEPN          PLAMRPMLEKTVKGALLTNLLFVIGIIASKLMA-----------
C5BB80_EDWI9          PEAMRPMLENMVKSALLTNLLFAIGTVLS---------------
A0A384L2R4_YERPE      AAGMRPMLEQMVKAALLTNILFAVGLVFS---------------
A0A433N1U4_9GAMM      AFSMRPMLEKTVKGALLTNILFAVGVILS---------------
H8NV38_RAHAQ          STEVRPLLEHMVKTALLTNVLFAVGLLLN---------------
D3V6W0_XENBS          SEGMRPMLVQMVKAALLTNVLFSIGLVFN---------------
Q6LVI4_PHOPR          GAALRPMMATMVKCALLTNLLFAAGVILA---------------
B0UV43_HISS2          PLHLRPMLAQMSLLALFTNLLFSLSLLVN---------------
MENA_HAEIN            PSELRPILAQMSMISLLINILFSLGLLIG---------------
A0A378NC05_MANHA      PKELYPILGQMAGLALLTNLLFSLGIVLG---------------
K0G771_ACTSU          PIELLPILGQMAGLALITNLLFSLGIFLG---------------
G1UB90_HAEDU          PIELRPMLGKMAALALLTNLLFSIGIMLG---------------
F0LRU4_VIBFN          PAQIAPMLPVIVKCSLVTNLLFVGVVIAQTLTS-----------
Q9KNQ8_VIBCH          PAQIAPMMPVVVKTSVITNLLFVGVIIAQTLTS-----------
I4AJL1_BERLS          -MELDPLLKQLAISTLFFVILFGISFIL----------------
Q11YA0_CYTH3          PRLLDPYLKQLALSTLLFVITYGIGISYF---------------
G0J314_CYCMS          PEKLDPYLKVMAMSTLFCVLFFGIGWLIF---------------
I2EY83_EMTOG          P---DPMLKQMALSTLVFVLSFGLSQILF---------------
D2QBD3_SPILD          PVELNARLGQLALTTLLFVILFGLGQVV----------------
E4RUU5_LEAB4          P---DPYLKTLSLTSLFFVIVFGLSLIFR---------------
E4T4N3_PALPW          ALELYPELPRLSMASLVFAVTFGIGLIL----------------
G8R827_OWEHD          AEDFDPLLKRLAITTLLFALTFGIGQVL----------------
C7M701_CAPOD          LKQLDKELKIVALSTFLLSVLFFVGILIHIF-------------
H1ZAR9_MYROD          PRELDSQMKIVALSTFLVSVLFSLALIL----------------
D5BHI6_ZUNPS          PALLDPELKVLALSTFGMSLLFAVGQIF----------------
G0L7N0_ZOBGA          NDQIDPELKKLALSTFLLSVLMYISCNIFL--------------
F0RAE4_CELLC          SLTMDPELKVVALSSFLFAILFYFSFNNFL--------------
G2PK12_MURRD          PGELDIELKKVALSTFLLALLFLISVNIFL--------------
H8XPE4_FLAIG          YADFEPELKKVALSTFALSLLFWVSLLINNI-------------
F2IBY0_FLUTR          PKELDSQLKIVALGTFFISILYVISVSINQWVL-----------
E4TBG6_RIEAD          PKELDPFLKQVGIITLVMSILLAVGLNYF---------------
I4A276_ORNRL          PAELDGELKKTALLTLAFAIFCGLGLVFN---------------
A0KFP0_AERHH          GEVLTGALKKTAISAFLFSLLLSIGLALS---------------
C4L9G5_TOLAT          PVLLDKQLKRTAISSLLFNLLLAIGFALD---------------
A1SRV4_PSYIN          GQVFNDELKNTALSTFVFSLLFALVLI-----------------
D5ESR9_PRER2          GKALNLCLGETARNIFIYGVCVSLGLLLV---------------
I6ZRI5_MELRP          GKDLNRTLELTAKLSALYGVLFAAGILL----------------
I0AJ70_IGNAJ          GQQLNKTLEVSAKYSALYGLLFSAGMIL----------------
B3EKW4_CHLPB          GRALNAVLAGTGRVMTLYGFLFSAGLLVPALSALFL--------
B3QXE0_CHLT3          GKPLNEVLAGTGVFLTIHGLLFSVGLILASF-------------
A7NL00_ROSCS          GRALNPALKGTARLHLAFGLLLALGMAV----------------
A9WBE2_CHLAA          GRALNKALVGAGRLHLAFGVLFAIGLLFG---------------
B9L3E1_THERP          GPSLNPVLKRTGQLQLLFAMLFALGLLG----------------
D0LH50_HALO1          GHALNLCLQRTAKLMLAFGLLFATGLAL----------------
I0I761_CALAS          GPTLNRTLAGTARLALLFSLLLATGIVLG---------------
E4NMD2_HALBP          GEALNPALERTGKLLAIHSLLFGIGLSFGGLPL-----------
A0A1U7EWI7_NATPD      GEALNPALQRTGKLLFAHSVCFALGFAAPAVI------------
L0IAV4_HALRX          ---LNFALERTGMLLTLYAITFAGGLILA---------------
Q07ZK1_SHEFN          GEALNPILGQTAKLTMIFSVLFSIGLYFSLT-------------
Q12NM3_SHEDO          GAELNPILAQTALLSLVFSLLFSLGWYLGLS-------------
Q6APS3_DESPS          GTELNSTLAKTAKLSLMFSLGFAVGLVLGA--------------
B1ZZ52_OPITP          PVELIALLVDTGKLLALYALLAGASFVTG---------------
D5EKA8_CORAD          PLDYLDALKGAGLVVAGYGLTLSFGLWLGA--------------
F8L8Z7_SIMNZ          --KLEPLLPKTGKWMSLYTLAFLIGWFL----------------
Q2S2V4_SALRD          PEKLNPLLGATGRILVLWALLFAVGWNL----------------
C7RR98_ACCPU          GPVFNALLAATARLQLFFGVLLTLAIVV----------------
G8QJX2_AZOOP          GTGHNLLLGRTAQLQLLFSFLLLLGCLFRPG-------------
C4ZL14_THASP          GPALNALLVDTARAGTRTGLLAAAGIVFVSSL------------
A1WW86_HALHL          GEDYNQCLARTGVFQLLLALVAGAGLVVGAYLHGAA--------
Q2RNW3_RHORT          AADFADCLGRTAGLETALALTIGLGLAMLS--------------
H6SP86_PARPM          PCVFNLCLKRTAGFQVVLCGCLCVGLIVTRVVF-----------
W5X374_BDEBC          GPIYNKFLGQAAGLHLVFGILIAIGFYL----------------
D6YW76_WADCW          GVIYNRFLEMAALVHMLVGTSIGIGLAIS---------------
Q6MCB2_PARUW          GTSYQASFAQSILLIFSFGLLLAVACLMRIAE------------
B2UL43_AKKM8          DSRMNRVLALSSLHLLLYLATYTILPTR----------------
B8FA11_DESAL          DKKMNLVLAATGQYTFVYSLLFAIGVAV----------------
E1X1B0_HALMS          DSKLNLALANTGKYLFLYCAVFSLGALL----------------
Q7MT15_PORGI          GTALNALLVRTAKAISLLALVAIAMLFLAR--------------
F4KKK2_PORAD          GSQLNAVLRRTSMGVVLLAVVHIAAYLIDGLLL-----------
H8MKQ6_CORCM          GGALNPHLGRTAGLGLVFAVLLSAGLSL----------------
W8YD75_BACTU          PGYMRIAMKSTAMTNTIFGFLLSAGLLISYLF------------
Q81BK6_BACCR          PGYMRIAMKSTAMTNTIFGFLLSAGLLISYLF------------
A0A0F6FRY2_BACTK      PGYMRIAMKSTAMTNTIFGFLLSAGLLISYLF------------
A0A0F7RFG2_BACAN      PGYMRIAMKSTAMTNTIFGFLLSAGLLISYLF------------
MENA_BACSU            PMNMIVAMKSTAQTNTFFGFLLSIGLLISYFR------------
F2F7P2_SOLSS          PLEVMPAMKYTAQTNTIFGFLLAVGLLVSYFI------------
B1YK29_EXIS2          PQELMPGMAQTGKVNTIFGLLLAISLTIANL-------------
I0JPY9_HALH3          PLEMMPAMVATAKTNTMYGILLGISLLLEISIPLG---------
Q8Y6K7_LISMO          PITMVPAMKSTSKALTIFGITLALAYLLSLLSRNLFM-------
A0AJD1_LISW6          PITMVPAMKSTSKALTIFGITLAIAYLLSLLSRNLFM-------
Q4L545_STAHJ          PASMMPAMAATGKTNTIFGVLYALGIYISALLGGI---------
A0A0E1VIS7_STAA3      PPTMMPAMAAAGKTNTFFGLLYALGIYISALFAGI---------
A0A166NHB3_STAPS      PQSMMPAMAASGKTNTLFGLLYALGIYISALLGGV---------
B9E7P8_MACCJ          PIELMPAMKVTGQFNTVFGLLFARGLYMAGLTAI----------
C8WXX2_ALIAD          PAKLHKAVKGTSNLLFRFGVLMVCAFLVSTLRF-----------
Q67QI7_SYMTH          PVRLHPAVKGVAQLLAGFGGLMTLGLLLSVWV------------
Q1AUL4_RUBXD          PARLDAVVKRTAGLHLLFGVLYSLGVLLG---------------
D8GIH8_CLOLD          NSKLATLDQETAKLQGQFGVILIISILFSYIR------------
Q9X1L4_THEMA          R-KNAREIADVDKMSALAEMILFVSMILGLLR------------
A2BMF3_HYPBU          D-----ADPRTAKLVVAFGVPYILGTLASAIANAI---------
B8FCL3_DESAL          D-----ADAQTARLDTVFGVLLLASLVLEHVL------------
Q1MQB4_LAWIP          N-ELIVLEGWTAQFHFLFGVFYVVGVLLWGIIQVIL--------
Q1MQB6_LAWIP          V-EIKNLVKWTAGFHFLFGLFFIIGILLSPFVYV----------
B8CY37_HALOH          QNDLKGIDYQMARLNIQFGIFLSGAIIISKYM------------
I4C2Q9_DESTA          WQDLHDRGGRMRLFYLTNGLLLILAAALS---------------
F3ZW58_MAHA5          DEKLMPANASTILCHLSLSALLAIGFIV----------------