CLUSTAL format seed alignment for MF_01939

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRPB_ECOLI            ---------MSLHSPGKAFRAALTKE-----------NPLQIVGTINANHALLAQRAGYQ
B7L4Y7_ECO55          ---------MSLHSPGKAFRAALTKE-----------NPLQIVGTINANHALLAQRAGYQ
B5EWP8_SALA4          ---------MSLHSPGQAFRAALAKE-----------NPLQIVGAINANHALLAQRAGYQ
PRPB_SALTY            ---------MSLHSPGQAFRAALAKE-----------NPLQIVGAINANHALLAQRAGYQ
Q4ZUP4_PSEU2          -------MSHDNSTPGQRFRDAVTSE-----------QPLQVVGAINANHALLARRAGFK
Q4KFK3_PSEF5          -------MSSNKSTPGQRFRDAVASE-----------QPLQVVGAINANHALLAKRAGFK
Q9I5E2_PSEAE          -------MSQTSLTPGQRFREAVATE-----------HPLQVVGTINANHALLAKRAGFK
A0A0R4J6Z8_ACIBY      ---------MAKQSAGQLFRDAVAQE-----------KPLQVVGTINANHALLAKRAGYK
B4SS97_STRM5          ------MTASAPFSAGARFREALAAE-----------SPLQVIGAINANHALLAKRAGFR
Q8PBT8_XANCP          ------MTSLPLSSAGARFRAALAAE-----------SPLQVIGAINANHALLAQRAGYQ
G7URW5_PSEUP          ---------MPSSTPGARFRAALAAE-----------SPLQVIGAINANHALLAKRAGYR
A4XU25_PSEMY          ---------MTQLSAGQRFRQALAEE-----------KPLQVIGAINANHALLAKRAGFR
Q8XXW3_RALSO          -MRRPDMTLAPQASPGARFRQALADE-----------SPLQIVGAINANHALLAKRAGYR
Q9K0X5_NEIMB          --------MMSQHSAGARFRQAVKES-----------NPLAVAGCVNAYFARLATQSGFK
Q5F6M5_NEIG1          ---------MSQHSAGARFRQAVKES-----------NPLAVAGCVNAYFARLATQSGFK
A0A0H3KPE0_BURM1      ------MSNTHLQSAGAKFRAAVAAE-----------QPLQVVGAITAYAAKMAQAVGFK
Q63NU3_BURPS          ------MGNPQLISAGAKFRAAVAAE-----------QPLQVVGAITAYAAKMAEAVGFK
Q83DG5_COXBU          ------------MSPGKLFRQAVANE-----------HPLQIVGAINAYCALLAENVGFK
G2KRF1_MICAA          ------------MTPSQAFKSAIVAE-----------KPLQIVGAINAYSALLAREAGFK
PRPB_SHEON            ----------MTQSAGLRFRQALANS-----------KPLQIVGTTNAYFALMAEQTGFQ
A0KKI7_AERHH          -------MSSLTPSAGLRFRTALANE-----------RPLQIVGTINAYMALMAERSGFQ
PRPB_VIBCH            MPNNKVKENPMSLSPGAKFRLAVKTH-----------HPLQIVGTINPYCAMMAKSIGHQ
F0ZZF5_DICPU          ----------MISSPGLLLRQAVLNS-----------KPLQIVGTINAYSAILAEKTGYK
Q8ZWM5_PYRAE          ---MLVKKSEKRGP--GLLREELKRP-----------GIVLVPGVFNALTALMAQDLGFR
PRPB_AERPE            -MAFLYREPLERPG--LVLRELIEKR-----------DIVVAPGVYNPAVALLAERMGFE
Q9HIV0_THEAC          --MSRLKDNINRGP--ATLRDLIKK------------DIVVAPGVFSGISALMAERAGFQ
PRPB1_CORGL           --MNLFSNGVDVGRRRQAFKAALAAP-----------HIARLPGAFSPLIARSIEEAGFE
E8QX94_ISOPI          --MSLSPPGCHDQPDRRVFSPPVGVSAGACLRTAWSEGTVMLPGVFNALTARLAERLGYR
                                        :   :                    *  .   *      *..

PRPB_ECOLI            AIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVART
B7L4Y7_ECO55          AIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVART
B5EWP8_SALA4          AIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVART
PRPB_SALTY            AIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVART
Q4ZUP4_PSEU2          AIYLSGGGVAAGSLGIPDLGITGLEDVLIDVRRITDVCDLPLLVDVDTGFGSSAFNVART
Q4KFK3_PSEF5          AIYLSGGGVAAGSLGVPDLGITGLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVART
Q9I5E2_PSEAE          AIYLSGGGVAAGSLGLPDLGISGLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVART
A0A0R4J6Z8_ACIBY      AIYLSGGGVAAGSLGLPDLGISNLDDVLTDVRRITDVCDLPLLVDADTGFGASAFNIART
B4SS97_STRM5          AIYLSGGGVAAGSLGLPDLGINTLEDVLIDVRRITDVCDLPLMVDIDTGFGPSAFNIART
Q8PBT8_XANCP          AIYLSGGGVAAGSLGLPDLGINTLEDVLIDVRRITDVCELPLLVDVDTGFGPSAFNIERT
G7URW5_PSEUP          AVYLSGGGVAAGSLGMPDLGINTLEDVLVDTRRITDVCDLPLLVDIDTGFGASAFNIERT
A4XU25_PSEMY          AIYLSGGGVAAGSLGLPDLGINTLDDVLTDVRRITDVCDLPLLVDIDTGFGPSAFNIERT
Q8XXW3_RALSO          VIYLSGGGVAAGSLGLPDLGISGLDDVLTDVRRITDVCDVPLLVDVDTGFGASAFNVART
Q9K0X5_NEIMB          AIYLSGGGVAACSCGIPDLGITTMEDVLIDARRITDNVDTPLLVDIDVGWG-GAFNIART
Q5F6M5_NEIG1          AIYLSGGGVAACSCGIPDLGITTMEDVLIDARRITDNVDTPLLVDIDVGWG-GAFNIART
A0A0H3KPE0_BURM1      AVYLSGGGVAANSLGIPDLGISTMEDVLIDANRITNATDLPLLVDIDTGWG-GAFNIART
Q63NU3_BURPS          AVYLSGGGVAANSLGIPDLGISTMDDVLVDANRITNATNLPLLVDIDTGWG-GAFNIART
Q83DG5_COXBU          AIYLSGGGVAN-TLGLPDLGITDLHDVLEDARRITAATHLPLLVDIDTGFG-GAFTIARA
G2KRF1_MICAA          AIYLSGAGVANASFGLPDLAVTTLNDVVEDARRITGRVDLPLLVDIDTGWG-GAFNIART
PRPB_SHEON            ALYLSGAGVANASYGLPDLGMTSMNDVLIDAGRITSATQLPLLVDIDTGWG-GAFNIART
A0KKI7_AERHH          AIYLSGAGVANASYGLPDLGMTSLNDVLIDAERITAATRIPLLVDIDTGWG-GAFNIART
PRPB_VIBCH            AIYLSGGGIANASYGLPDLGITTLNDVLVDVERITNACDLPLLVDIDTGFG-GAFNIART
F0ZZF5_DICPU          AIYLSGGGVAAASFGLPDLGITTLNDVVEDIRRITRVTKLPILVDADTGFGNSAFNIART
Q8ZWM5_PYRAE          AVYVSGAAVTASMA-LPDLGLITMDEMVRAVKYIVDAVDIPVIVDIDTGYG-EALNVMRA
PRPB_AERPE            ALYLSGAAITGSLA-MPDLGLITLSELAMFTSYITRVVRVPVIVDADTGFG-EAINVERT
Q9HIV0_THEAC          ASYLSGSGVAGMMG-LPDLSVTTLPEIAAEAYRITTVSSLPLIVDVDTGFG-ETVNVMRT
PRPB1_CORGL           GVYVSGAVIAADLA-LPDIGLTTLTEVAHRARQIARVTDLGVLVDADTGFG-EPMSAART
E8QX94_ISOPI          GVYFSGGALSAGWAGLPDIGLLTQTEFVEQLAVIVRATSLPVLADADTGFG-EAVNVGRT
                        *.**. ::     :**:.:    :.      *.      ::.* * *:*  ...  *:

PRPB_ECOLI            VKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTD
B7L4Y7_ECO55          VKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTD
B5EWP8_SALA4          VKSIAKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTD
PRPB_SALTY            VKSIAKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTD
Q4ZUP4_PSEU2          VRSMIKAGAAAIHIEDQVGAKRCGHRPNKEIVSQQEMVDRIKAAVDARTDDSFVIMARTD
Q4KFK3_PSEF5          VKSMIKFGAAAIHIEDQVGAKRCGHRPNKEIVSQQEMVDRIKAAVDARTDDSFVIMARTD
Q9I5E2_PSEAE          VKSMIKFGAAAMHIEDQVGAKRCGHRPNKEIVSQQEMVDRIKAAVDARSDDSFVIMARTD
A0A0R4J6Z8_ACIBY      TKSLIKFGAAAMHIEDQVGAKRCGHRPNKAIVTQEEMVDRIKAAVDARGDDSFVIMARTD
B4SS97_STRM5          VKSLIKAGAAACHIEDQVGAKRCGHRPGKEIVSQGEMVDRVKAAADAKTDPDFFLIARTD
Q8PBT8_XANCP          IKSLIKAGAAGCHIEDQVGAKRCGHRPGKEIVSQGEMVDRVKAAADAKTDPAFFLIARTD
G7URW5_PSEUP          IKSLIKAGAAACHIEDQVGAKRCGHRPGKEIVSQSEMADRVKAAADAKTDADFFLIARTD
A4XU25_PSEMY          IKNLIKAGAAAAHIEDQVGAKRCGHRPGKEIVSCEEMVDRVRAAADAKTDPDFFLIARTD
Q8XXW3_RALSO          TRSLIKFGAAAMHIEDQVGAKRCGHRPNKEIVSKDEMVDRIKAAVDARTDPGFVVMARTD
Q9K0X5_NEIMB          IRNFERAGVAAVHIEDQVAQKRCGHRPNKAIVSKDEMVDRIKAAVDARVDENFVIMARTD
Q5F6M5_NEIG1          IRNFERAGVAAVHIEDQVAQKRCGHRRNKAIVSKDEMVDRIKAAVDARVDENFVIMARTD
A0A0H3KPE0_BURM1      IRSFINAGVAAVHIEDQVGQKRCGHRPGKECVPTDEMVDRIKAAVDARTDDQFVIMARTD
Q63NU3_BURPS          IRSFIKAGVGAVHLEDQVGQKRCGHRPGKECVPAGEMVDRIKAAVDARTDETFVIMARTD
Q83DG5_COXBU          IKEMERAQVAAVHMEDQVAQKRCGHRPGKELVNTNEMVDRIKAAVDVKSN-DFVLIARTD
G2KRF1_MICAA          VREFERAGVACVHIEDQVAQKRCGHRPGKELVDKFEMGDRVKAAVDARS--DLLIMARTD
PRPB_SHEON            IKEFEKIGVAAVHMEDQVSQKRCGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTD
A0KKI7_AERHH          VRVFERAGVAAVHMEDQVAQKRCGHRPNKAVVSQEEMCDRIKAAVDARENGEFVIMARTD
PRPB_VIBCH            IKAMEKAGAAAVHMEDQVAQKRCGHRPNKAIVSQQEMVDRVKAAVDARINPEFVIMARTD
F0ZZF5_DICPU          IQEFELAGAAGCHIEDQVSAKRCGHRPGKQIVSLEEMVDRIKAAVAARKDPNFVIMARTD
Q8ZWM5_PYRAE          VREFEAIGAAGVQLEDQVLPKKCGHLSGKALIPPDEMAKKIRAAVEARRNPDFVIIARTD
PRPB_AERPE            VRELERAGAAAIQIEDQVMPKKCGHLQGKALISPEDMVKKIIAAVGARR--DALIVARTD
Q9HIV0_THEAC          VRMMEDAGAAAIHIEDQEQPKKCGHLNGKRVIDRDNMVRKIRAAVSTRKDEDFMIIARTD
PRPB1_CORGL           VAELEDAGVAGCHLEDQVNPKRCGHLDGKEVVRTDVMVRRIAAAVSARRDPNFVICARTD
E8QX94_ISOPI          VQLYEQAGAAGLHLEDQELPKRCGHLSGKRLIDPATMVAKIRAAVQARRDPAFLIVARTD
                              ..  ::***   *:***  .*  :    *  :: **. .:     .: ****

PRPB_ECOLI            ALAVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ------VPILANITEF
B7L4Y7_ECO55          ALAVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ------VPILANITEF
B5EWP8_SALA4          ALAVEGLEAALDRAQAYVDAGADMLFPEAITELSMYRQFADVAQ------VPILANITEF
PRPB_SALTY            ALAVEGLEAALDRAQAYVDAGADMLFPEAITELSMYRRFADVAQ------VPILANITEF
Q4ZUP4_PSEU2          ALAVEGLESALERAAACIEAGADMVFPEAITELAMYKQFANRAG------VPILANITEF
Q4KFK3_PSEF5          ALAVEGLESALERAAACIEAGADMVFPEAITELEMYKIFADRVK------APILANITEF
Q9I5E2_PSEAE          ALAVEGLQAAIDRACACVEAGADMIFPEAMTELAMYKEFAAAVK------VPVLANITEF
A0A0R4J6Z8_ACIBY      ALAVEGLQAAIDRAGAYIEAGADMLFPEAITELDMYKQFAQKTG------VPILANITEF
B4SS97_STRM5          AIQVDGVDKAIERAIACVEAGADGIFAEAAYDLDTYRRFVDAVK------VPVLANITEF
Q8PBT8_XANCP          AIQMEGVDAAIERAIACVEAGADGIFAEAAYDLETYQRFVDAVR------VPVLANITEF
G7URW5_PSEUP          AIQVEGVDRAIERAIACVEAGADGIFAEASYDLGTYKRFVEAVK------VPVLANITEF
A4XU25_PSEMY          AIQAEGVDAAIERCQAYVEAGADGIFAEAAYDLPTYQRFVEALK------VPVLANITEF
Q8XXW3_RALSO          ALAVEGLDRAIERAVACVEAGADAIFPEAMTDLSMYRRFVDAVK------VPVLANITEF
Q9K0X5_NEIMB          ALAVEGLDAAIERAQACVEAGADMIFPEAMTDLNMYRQFADAVK------VPVLANITEF
Q5F6M5_NEIG1          ALAVEGLDAAIERAQACVEAGADMIFPEAMTDLKMYRQFADAVK------VPVLANITEF
A0A0H3KPE0_BURM1      AAAAEGIDSAIERAVAYVEAGADMIFPEAMKTLDDYRRFKAAVK------VPILANLTEF
Q63NU3_BURPS          AAAAEGIDAAIERAIAYVEAGADMIFPEAMKTLDDYRRFKEAVK------VPILANLTEF
Q83DG5_COXBU          AYAVEGLKATIDRACTYVEAGADMIFAEALENINDYPTFCKAVK------VPVLANMTEF
G2KRF1_MICAA          ALAGEGLDGVIERCVHYVECGADMIFAEAMTDLSHYKKIKDAVK------VPVLANLTEF
PRPB_SHEON            AVAVEGLEAGIERAKAYIAAGADMIFAEALTELDQYRHFKAQVK------APILANMTEF
A0KKI7_AERHH          ALAVEGIGPALERAAAYVAAGADMIFAEAVTELGQYDLFKQAAG------VPILANMTEF
PRPB_VIBCH            ALAVEGMDSAIERAIACVEAGADMIFPEAMTELKQYEQFSTALRSATGKPVPILANITEF
F0ZZF5_DICPU          ALANEGIDSAIKRSKAYIEAGADMLFPEALTELSQYELFSKNLPN-----IPILANITEF
Q8ZWM5_PYRAE          AVGVTGFEDAVERALLYLEAGADVIFPEALRSEEEFREFARRV------KAPLLANMTEF
PRPB_AERPE            ARGVEGFEKAVERAQLYVEAGADIIFPEALTSLEEFREFARRV------KAPLLANMTEF
Q9HIV0_THEAC          ARSVNGLEDAIDRANAYLEAGADAVFTEALESREEFVEMRKKV------KGYLMANMTED
PRPB1_CORGL           AAGVEGIDAAIERAKAYLDAGADMIFTEALHSEADFRYFRHAIP-----DALLLANMTEF
E8QX94_ISOPI          ARSVEGLDAACDRARRYVEAGADAVFPEALESLEEFARFAREI------PVPLVANMTEF
                      *    *.    .*.   : .**: :*.**      :  :             ::**:** 

PRPB_ECOLI            GATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELY
B7L4Y7_ECO55          GATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELY
B5EWP8_SALA4          GATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELY
PRPB_SALTY            GATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELY
Q4ZUP4_PSEU2          GATPLFTVDELREADVSLVLYPLSAFRAMNKAAENVYGAIRRDGSQKNVIDSMQTRMELY
Q4KFK3_PSEF5          GATPLYTTEQLKSVDVSLVLYPLSAFRAMNKAAENVYTAIRRDGTQQNVIDTMQTRMELY
Q9I5E2_PSEAE          GATPLFTTDELASADVSLVLYPLSAFRAMNKAAENVYTAIRRDGTQKNVIDTMQTRMELY
A0A0R4J6Z8_ACIBY      GSTPLFTTEELASADVSLALYPLSAFRAMNKAAETVYETLRKEGTQKNVVDIMQTRKELY
B4SS97_STRM5          GATPLFSRDELASAGVAIQLFPLSAFRAANKAAENVYQAVRRDGHQRNVVESMQTREELY
Q8PBT8_XANCP          GKTPLFTRDQLAQAGVAIQLFPLSAFRAANKAAEAVYTAIRRDGHQNAVLESMQTREELY
G7URW5_PSEUP          GATPLFTRDELASVGVAIQLYPLSAFRAMNKAAENVYTAIRRDGHQKAVLDTMQTREELY
A4XU25_PSEMY          GATPLFTRDELASVGVAIQLYPLSAFRAANKAAESVYTSIRQNGHQKDVIELMQTRAELY
Q8XXW3_RALSO          GQTPLFTRDELASAGVAMILYPLSAFRAMNKAAENVYAAIRRDGTQKNVVDAMQTRMELY
Q9K0X5_NEIMB          GSTPLYTQSELAENGVSLVLYPLSSFRAASKAALNVYEAIMRDGTQAAVVDSMQTRAELY
Q5F6M5_NEIG1          GATPLYTQSELAENGVSLVLYPLSSFRAASKAALNVYEAIMRDGTQAAVVDSMQTRAELY
A0A0H3KPE0_BURM1      GSTPLFTVDELREANVDIALYCCGAYRAMNKAALNFYETVRRDGTQKAAVPTMQTRAELY
Q63NU3_BURPS          GSTPLFTLDELKGANVDIALYCCGAYRAMNKAALNFYETVRRDGTQKAAVPTMQTRAQLY
Q83DG5_COXBU          GKTPLYTAAQLADHGVKMVLYPRSADRAMSKAALAVYEDIKKHGVQTASLPFMQTREALY
G2KRF1_MICAA          GKTDYYTTTQMADAGVDMTLYPLSAFRAMSRAAEMVYATIRKDGTQKDAVPSMQTREELY
PRPB_SHEON            GQTQLFNKEELAQAGADMVLYPLGTFRAANQAALKVMQALMNDGHQRNVLDTMQTRADLY
A0KKI7_AERHH          GKTELFDKETLAAHGVDMVLYPLSASRAANQAALNVYQHLRQDGHQRAVVDTMQTRESLY
PRPB_VIBCH            GQTPLYSGEQLAAVNVDMVLYPLSAFRAMNKAAENVYRHLLEHGNQEALLDQMQTRKELY
F0ZZF5_DICPU          GKTPLFKTEELHKAGVSIVLYPLSGFRAASAATLNVYKTILNEGTQESVVSTMQPRMELY
Q8ZWM5_PYRAE          GVSPLIPAKKLEEFGYKFVIFPVTALRVAMYAIREVFKTILREGTQASWLDKMFTRKELY
PRPB_AERPE            GKTPYITVDQFREAGYKIVIFPVTTFRASLKASETVLREIMEKGTQKDILDKLYTRTEFY
Q9HIV0_THEAC          GKSPLLSVAELREIGYDIVIFPLTAFRGMLKAIGDIYRDLLKDGTQRNFLDRIMRRSEFY
PRPB1_CORGL           GKTTLLSADVLEEIGYNAVIYPVTTLRIAMGQVEQALAEIKEHGTQEGWLDRMQHRSRLY
E8QX94_ISOPI          GKSPLLEFRDLAALGYKAVLYPLTAFRAAMHAAEAILTELRQVGHQRDWLSRMQSRARLY
                      * :       :        ::     *            : . * *   :  :  *  :*

PRPB_ECOLI            ESINYYQYEE-------KLDNLFARSQVK---
B7L4Y7_ECO55          ESINYYQYEA-------KLDDLFARSQVK---
B5EWP8_SALA4          ESINYYQFEE-------KLDALYRNKKS----
PRPB_SALTY            ESINYYQFEE-------KLDALYRNKKS----
Q4ZUP4_PSEU2          DAIDYHTFEQ-------KLDALFAQKKG----
Q4KFK3_PSEF5          ERIDYHSFEQ-------KLDALFAQKKG----
Q9I5E2_PSEAE          DRIDYHSFEQ-------KLDALFAQKKNA---
A0A0R4J6Z8_ACIBY      ERINYYAFED-------YLDNAFAKKK-----
B4SS97_STRM5          DRIGYHAFEQ-------QLDALFAAKK-----
Q8PBT8_XANCP          ERIGYHDYEQ-------RLDALFARKGA----
G7URW5_PSEUP          DRIGYHAFEN-------KLDALFSRNKAG---
A4XU25_PSEMY          DRIGYHAFEQ-------KLDALFAAGKK----
Q8XXW3_RALSO          DSIGYHDYEA-------KLDALFAQSRG----
Q9K0X5_NEIMB          EHLNYHAFEQ-------KLDKLFQK-------
Q5F6M5_NEIG1          EHLNYHAFDQ-------KLDKLFQK-------
A0A0H3KPE0_BURM1      DFLGYHEYER-------KLDELFAQGKK----
Q63NU3_BURPS          DYLGYYAYEE-------KLDQLFNQGRN----
Q83DG5_COXBU          EVLNYHAYED-------KLNQLFKRKEDD---
G2KRF1_MICAA          KVLDYYAYEQ-------KLDALFGKK------
PRPB_SHEON            KYLGYHAFED-------KLDQLFSQDK-----
A0KKI7_AERHH          DFLGYHHYEQ-------TLDRLFTSRD-----
PRPB_VIBCH            AYLHYHEYED-------KLDQLFSQPS-----
F0ZZF5_DICPU          QYLDYFKYEN-------ELDKLFGTQNNKDEK
Q8ZWM5_PYRAE          ELIKYYDYERIDGEISSYIDNIYKKPRGERHG
PRPB_AERPE            DLIGYHDYEKRDAEVSRKAEELLARHNNSRTG
Q9HIV0_THEAC          DVIGYYDYEK--------EDNVFYKI------
PRPB1_CORGL           ELLRYEDYNV-------FDQHIFTYRKGENNE
E8QX94_ISOPI          DLLDYRDWEE-------RDRALWSASGSERPS
                        : *  ::