CLUSTAL format seed alignment for MF_01941

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MAPZ_STRR6            MSKKRRNRHKKEAQEPQ-----------------FDFDEAKELTVGQAIRKNEEVEAGVL
M5MZC5_STREE          MSKKRRNRHKKEGQEPQ-----------------FDFDEAKELTVGQAIRKNEEVEAGVL
A0A0T8G9C9_STREE      MSKKRRNRQKKEGQEPQ-----------------FDFDEAKELTVGQAIRKNEEVEAGVL
G6J8C7_STREE          MSKKRRNRHKKEGQEPQ-----------------FDFDEAKELTVGQAIRKNEEAEAGVL
G0ICC1_STRES          MSKKRRNRHKKEGQEPQ-----------------FDFDEAKELTVGQAIRKNEEVEAGVL
B1I9H4_STRPI          MSKKRRNRHKKEGQEPQ-----------------FDFDEAKELTVGQAIRKNEEVEAGVL
D6ZQL0_STRP0          MSKKRRNRHKKEGQEPQ-----------------FDFDEAKELTVGQAIRKNEEVEAGVL
D3HAU2_STRM6          MSKKRHDRHITEHQEAQ-----------------FDFDDAKELTVGEAMLKNEEVEAGVL
F2QF68_STROU          MSKKRRDRHKKGHQEPQ-----------------FDFDEAKDLTVGQVIRKNEEVEAGVL
A8AVU7_STRGC          MSKE-NTKPESQEQESI-----------------LDFEEAKEMTIGQAARKSEELEAGVK
A3CPY0_STRSV          MTKEENYSPEEEKKESV-----------------LDFEEAKEMTVGQATRKKEELEAGVN
F8DIP5_STREP          MTEK-DKKALEQETESI-----------------LDFEDAKEMTIGQANRKAEEIEAGVT
F5WZ90_STRG1          MSDKKE---LPSSEEQEG----------------LNLEDVKNMTIGEAVRKDSELKAGVT
H2A4X0_STRMD          MSDKKE---LPSSEEQEG----------------LNLEDVKNMTIGEAVRKDSELKAGVT
F5X522_STRPX          MSDKKE---LPSSEEQEG----------------LNLEDVKNMTIGEAVRKDSELKAGVT
Q1J5H7_STRPF          MSEESKE--VEVTKESQT----------------LGLNEAKSMTIGEAVRKQSEIKAGVT
A0A0H2UW34_STRP3      MSEESKE--VEVTKESQT----------------LGLNEAKSMTIGEAVRKQSEIKAGVT
Q99YL6_STRP1          MSEESKE--VEVTKESQT----------------LGLNEAKSMTIGEAVRKQSEIKAGVT
Q1JKN6_STRPC          MSEESKE--VEVTKESQT----------------LGLNEAKSMTIGEAVRKQSEIKAGVT
Q1JFM7_STRPD          MSEESKE--VEVTKESQT----------------LGLNEAKSMTVGEAVRKESEIKAGVT
C5WIH4_STRDG          MSEESKE--VEVTKESQT----------------LGLNEAKSMTVGEAVRKESEIKAGVT
C0MH24_STRS7          MSEKSKA--FESEAESQN----------------LELHEAKKMTIGEAVRKDSELKAGIT
B4U4I2_STREM          MSEKSKA--FESEAESQN----------------LELHEAKKMTIGEAVRKDSELKAGIT
A0A6D2LUJ9_STRSZ      MSEKSKA--VESEAESQN----------------LELHEAKKMTIGEAVRKDSELKAGIT
B9DV59_STRU0          MSEENKD--FELQNEEQG----------------ISIDKAKQMTVGEAVRKDTELKAGIT
A0A076YYR4_STRAG      MSEDQKHPFFEPKKETDG----------------LEFKDAKEMTVEEAVRKDSEIKAGIT
F8LGV3_STREH          MSEDKTQ---NGYEGSQE----------------LDFQDAKEMTVGEAVRKEAEINAGVT
F8HBC8_STRE5          MSEDKTQ---NGYEGSQE----------------LDFQDAKEMTVGEAVRKEAEINAGVT
Q5M644_STRT2          MSEDKTQ---NGYEESQE----------------LDFQDAKEMTVGEAVRKEAEIKAGVT
A0A0H3MTL4_STRS4      MGEKNSH--HLPLDEEKV----------------LDFEVAKDLTIEEAVKKHKEIEAGVT
Q02XL5_LACLS          MSNKNKKNKNKNKNNNTNKNKNNQKSEQQIGEKTLKLQDLQNFTVGEIVEESKRVDKENE
A2RJC3_LACLM          MSNKNKKNKNKNKNNNTNKNKNNQKSEQQIGEKTLKLQDLQNFTVGEIVEESKRVDKENE
D2BKU0_LACLK          MSNKNKKNRNKNKNNNNNKPKN----EQQIGEKTLKLQDLQDFTVGQIVAESKRVDKENE
A0A1V0NH88_LACLL      MSNKNKKNRNKNKNNNNNKPKN----EQQIGEKTLKLQDLQDFTVGQIVEESKRVNKENE
F9VCG7_LACGL          MTE--EKDKDKNIKNS--------------GEKVLKLGDVSDFTVGEIVKKAQRVDKENS
                      * .                               : :   ..:*: :   :  . .    

MAPZ_STRR6            PEDSILDKYVKQHRDEIEADK-------FATRQYKK---------EEFVETQSLDDLIQE
M5MZC5_STREE          PEDSILDKYVKQHRDEIEADK-------FATRQYKK---------EEFVETQSLDDLIQE
A0A0T8G9C9_STREE      PEDSILDKYVKQHRDEIEADK-------FATRQYKK---------EEFVETQSLDDLIQE
G6J8C7_STREE          PEDSILDKYVKQHRDEIEADK-------FATRQYKK---------EEFVETQSLDDLIQE
G0ICC1_STRES          PEDSILDKYVKQHKDEIEADK-------FATRQYKK---------EELVETHSLDDLIQE
B1I9H4_STRPI          PEDSILDKYVKQHKDEIEADK-------FATRQYKK---------EELVETQSLDDLIQE
D6ZQL0_STRP0          SEDSILDKYVKQHRDEIEADK-------FATRQYKK---------EELVETQSLDDLIQE
D3HAU2_STRM6          PGDSILDKYVKQHKDEIEADK-------FETRQFSKDDLVEKEGIEEIEETQTLDNLLQE
F2QF68_STROU          PEDSILDKYIKQHREEIEADK-------FETRQFKK---------EELASTQNLEEMIQE
A8AVU7_STRGC          EDDSVLDKYIKQHRQEIEAGK-------YTATVQAQ---------KKQDEKAEEAKKETV
A3CPY0_STRSV          ESDNVLDKYIKQHRQEIEAGK-------FETQKIRK---------LQEQEAAQAEQASSD
F8DIP5_STREP          EGDNVLDKYIKQHRAEIEADK-------YDTKMLAK---------EELEKAEELAASETV
F5WZ90_STRG1          ESDGVLDKYIKQHRDEVTSQK-------FEAKLSDF----------DDLDTKALDNFIKK
H2A4X0_STRMD          ESDGVLDKYIKQHRDEVTSQK-------FEAKLSDF----------DDLDTKALDNFIKK
F5X522_STRPX          ESDGVLDKYIKQHRDEVTSQK-------FEAKLSDF----------DNLDTKALDNFIKK
Q1J5H7_STRPF          KDDSILDKYIKQHRDEVSSQK-------FDAKYTE-------------LDTASLDNFIKK
A0A0H2UW34_STRP3      KDDSILDKYIKQHRDEVSSQK-------FDAKYTE-------------LDTASLDNFIKK
Q99YL6_STRP1          KDDSILDKYIKQHRDEVSSQK-------FDAKYTE-------------LDTASLDNFIKK
Q1JKN6_STRPC          KDDSILDKYIKQHRDEVSSQK-------FDAKYTE-------------LDTASLDNFIKK
Q1JFM7_STRPD          ENDSILDKYIKQHRDEVSSQK-------FDAKYTE-------------LDTASLDNFIKK
C5WIH4_STRDG          EDDSILDKYIKQHRDEVSSQK-------FDAKYTE-------------LDTASLDNFIKK
C0MH24_STRS7          EDDSVLDKYIKRHRNEVSSQK-------FDAKYME-------------LDTASLDNFIKK
B4U4I2_STREM          EDDSVLDKYIKRHRNEVSSQK-------FDAKYME-------------LDTASLDNFIKK
A0A6D2LUJ9_STRSZ      EDDSVLDKYIKRHRNEVSSQK-------FDAKYME-------------LDTASLDNFIKK
B9DV59_STRU0          EDDSVLDKYIKQHRQEVASQK-------FETKVSEV----------ESLDTASLDNFIKK
A0A076YYR4_STRAG      EEDSILDKYIKQHRDEVASQK-------FETKSSDF----------ANLDTASLDDFIKK
F8LGV3_STREH          ETDSILDKYIKQHREEVASQK-------FSKKIEA------------DGDTSPLDAFIQK
F8HBC8_STRE5          ETDSILDKYIKQHREEVASQK-------FSKKIEA------------DGDTSPLDAFIQK
Q5M644_STRT2          ETDSILDKYIKQHREEVTSQK-------FSKKIEA------------DGDTSPLDAFIQK
A0A0H3MTL4_STRS4      EDDGLLDRYIKQHRAEIESQK-------FETKINH-------------LPLVEVADEEKN
Q02XL5_LACLS          ENESVLDKYIRQHRGEIEDAKNKNLDEFIQSEREHIEPSADKAEVQEKVLEQEAEDASKD
A2RJC3_LACLM          ENESVLDKYIRQHRGEIEDAKNKNLDEFIQSEREHIEPSADKAEVQEEVLEQESEDASKD
D2BKU0_LACLK          ENESVLDKYIRQHRGEIEEAKSKNLDEFIQAERTNIEVPVEE---EKEAKSEKLQEVSKE
A0A1V0NH88_LACLL      ENESVLDKYIRQHRGEIEEAKSKNLDEFIQAERTNIEVPVEE---EKEAKSEKLQEVSKE
F9VCG7_LACGL          ESESVLDKYIRQHRGEIEAVKNQALEKYIQTER-------------KKMDQEEAADSKEE
                        :.:**:*:::*: *:   *                                       

MAPZ_STRR6            MREAVEKSE------------------ASSEEV---------------------------
M5MZC5_STREE          MREAVEKSE------------------ASSEEV---------------------------
A0A0T8G9C9_STREE      MREAVEKSE------------------ASSEEV---------------------------
G6J8C7_STREE          MREAVEKSE------------------ASSEEV---------------------------
G0ICC1_STRES          MREAVEESE------------------ASSEEV---------------------------
B1I9H4_STRPI          MREAVEESE------------------ASSEEV---------------------------
D6ZQL0_STRP0          MREAVEESE------------------AYSEEV---------------------------
D3HAU2_STRM6          LREETGVTS------------------PASEDE---------------------------
F2QF68_STROU          VRESSESSEQVDDSDVVAE--------ESIEEI---------------------------
A8AVU7_STRGC          LTDETKE--------------------EVIASP---------------------------
A3CPY0_STRSV          LTDFIKERRQ-----------------EVESEQ---------------------------
F8DIP5_STREP          A--------------------------EVAEAV---------------------------
F5WZ90_STRG1          QREELVNNGIVGESALKENEATPKAVDFEAEKV---------------------------
H2A4X0_STRMD          QREELVNNGIVGESALKENEATPKAVDFEAEKL---------------------------
F5X522_STRPX          QRAELVNSGLVGESALKENEATPKAVDFEAEKV---------------------------
Q1J5H7_STRPF          QREALSKAGLVDDEPVSAE--SAEQDSTLVEEV---------------------------
A0A0H2UW34_STRP3      QREALSKAGLVDDEPVSAE--SAEQDSTLVEEV---------------------------
Q99YL6_STRP1          QREALSKAGLVDDEPVSAE--SAEQDSTLVEEV---------------------------
Q1JKN6_STRPC          QREALSKAGLVDDEPVSAE--SAEQDSTLVEEV---------------------------
Q1JFM7_STRPD          QREELSKAGLVDDEPVSAE--SAEQDSTLVEEV---------------------------
C5WIH4_STRDG          QREELSKAGLVDDDFVENEPDATELSEPSSEGV---------------------------
C0MH24_STRS7          QREELSKAGLVDVEPVDEA--------STEEKP---------------------------
B4U4I2_STREM          QREELSKAGLVDVEPVDEA--------STEEKP---------------------------
A0A6D2LUJ9_STRSZ      QREELSKAGLVDVEPVDEA--------STEEKP---------------------------
B9DV59_STRU0          QREELAKTGFFNQTSEEQK---------LETEA---------------------------
A0A076YYR4_STRAG      QREELSAMLAAEE---------------LSKKL---------------------------
F8LGV3_STREH          QRQEFADSGLISQSMANESINSTTATEEVTPVTFGFGATDNKADETQSHIDKQLPNAPVE
F8HBC8_STRE5          QRQEFADSGLISQSMANESINSTTATEEVTPVTFGFGATDNKADETQSHIDKQLPNAPVE
Q5M644_STRT2          QRQEFADSGLIGQTLANESTNSMTADETVIPITSGFGTTETKADDTQ---------APID
A0A0H3MTL4_STRS4      QGHESAEEVEANESSLTEV------SEEIAPIV---------------------------
Q02XL5_LACLS          KAVIEKNTDSESTSAVENKSETDEVKIESKSNLPEEKATEKVTDKKSE------------
A2RJC3_LACLM          KAVIDKNTDSESTSAVENKSETDEVKIESESDLPEEKATEKVTDKKSE------------
D2BKU0_LACLK          --EIDENDE-----LAASKIDSEKVTDSSDSDLSAENKDLEVADKESE------------
A0A1V0NH88_LACLL      --EIDENDE-----LAASKIDSEKVTDSSDSDLSAENKDLEVADKESE------------
F9VCG7_LACGL          VTALEENSD--------VKADEGSEASAPEAEHTETPESDEVTPSKEA------------
                                                                                  

MAPZ_STRR6            ------------------------------------------------------------
M5MZC5_STREE          ------------------------------------------------------------
A0A0T8G9C9_STREE      ------------------------------------------------------------
G6J8C7_STREE          ------------------------------------------------------------
G0ICC1_STRES          ------------------------------------------------------------
B1I9H4_STRPI          ------------------------------------------------------------
D6ZQL0_STRP0          ------------------------------------------------------------
D3HAU2_STRM6          ------------------------------------------------------------
F2QF68_STROU          ------------------------------------------------------------
A8AVU7_STRGC          ------------------------------------------------------------
A3CPY0_STRSV          ------------------------------------------------------------
F8DIP5_STREP          ------------------------------------------------------------
F5WZ90_STRG1          ------------------------------------------------------------
H2A4X0_STRMD          ------------------------------------------------------------
F5X522_STRPX          ------------------------------------------------------------
Q1J5H7_STRPF          ------------------------------------------------------------
A0A0H2UW34_STRP3      ------------------------------------------------------------
Q99YL6_STRP1          ------------------------------------------------------------
Q1JKN6_STRPC          ------------------------------------------------------------
Q1JFM7_STRPD          ------------------------------------------------------------
C5WIH4_STRDG          ------------------------------------------------------------
C0MH24_STRS7          ------------------------------------------------------------
B4U4I2_STREM          ------------------------------------------------------------
A0A6D2LUJ9_STRSZ      ------------------------------------------------------------
B9DV59_STRU0          ------------------------------------------------------------
A0A076YYR4_STRAG      ------------------------------------------------------------
F8LGV3_STREH          PEVIAEPESQSSEVIITSTNADRFITSETEKFDLGDALADSSTLTNHPAYNDALVDNIDD
F8HBC8_STRE5          PEVIAEPESQSSEVIITSTNADRFITSETEKFDLGDALADSSTSTNQPAYNDALVDNIDD
Q5M644_STRT2          SEITVKPESESSETIITSTNADRFITSEAEKFDLGEALTATTTSTNQQVDNTAMVDNVDD
A0A0H3MTL4_STRS4      ------------------------------------------------------------
Q02XL5_LACLS          ------------------------------------------------------------
A2RJC3_LACLM          ------------------------------------------------------------
D2BKU0_LACLK          ------------------------------------------------------------
A0A1V0NH88_LACLL      ------------------------------------------------------------
F9VCG7_LACGL          ------------------------------------------------------------
                                                                                  

MAPZ_STRR6            ---------------------PSSEDILLPLPLDDEEQ----------GLDPLLLDDENP
M5MZC5_STREE          ---------------------PSSEDILLPLPLDDEEQ----------GLDPLLLDDENP
A0A0T8G9C9_STREE      ---------------------PSSEDILLPLPLDDEEQ----------GLDPLLLDDENP
G6J8C7_STREE          ---------------------PSSEDILLPLPLDDEEQ----------GLDPLLLDDENP
G0ICC1_STRES          ---------------------PSSEDILPPLPLDDEEQ----------GLDPLLLEDETP
B1I9H4_STRPI          ---------------------PSSEDILPPLPLDDEEQ----------GLDPLLLEDENP
D6ZQL0_STRP0          ---------------------PSSEDILPPLPLDDEEQ----------GLDPLLLEDENP
D3HAU2_STRM6          ---------------------LSQ--------FDDLE---------------LTRVSETP
F2QF68_STROU          ---------------------ENEETTQFVPPLQDEEST---------EIEPLVLTETEP
A8AVU7_STRGC          ---------------------KSPGLEAEVSQAFSD-------------------EPEDK
A3CPY0_STRSV          ---------------------EIPTARLTAAETASEPEA---------APNPLGSRSQRS
F8DIP5_STREP          ---------------------EAPEVTETVLEQRPE------------------MDAIST
F5WZ90_STRG1          --------------------EDTQETSQEVPVSENVASENDSTIQQENVSIEIPNADSAV
H2A4X0_STRMD          --------------------EDTQETSQEVPLSEDVASENDSTIQQESVSIEIPNADSAV
F5X522_STRPX          --------------------EDTQETSQEVPVSEDVASENDSTIQQENVSIEIPNADSAV
Q1J5H7_STRPF          --------------------AEDLAPMETTAVVTGIPVE------------ATVPVLDLD
A0A0H2UW34_STRP3      --------------------AEDLAPMETTAVVTGIPVE------------ATVPVLDLD
Q99YL6_STRP1          --------------------AEDLAPMETTAVVTGIPVE------------ATVPVLDLD
Q1JKN6_STRPC          --------------------AEDLAPMETTAVVTGIPVE------------ATVPVLDLD
Q1JFM7_STRPD          --------------------AEDLAPMETTAVVTGIPVE------------ATVPVLDLD
C5WIH4_STRDG          --------------------PDELASVEAAAVTTGIPVE------------AMVPVT--D
C0MH24_STRS7          --------------------AGETSFIEPLAARADTSAA------------ATDSASDFT
B4U4I2_STREM          --------------------ADETSLIEPAAAKAGTPAL------------ATDSASDFT
A0A6D2LUJ9_STRSZ      --------------------ADETSLIEPAAAKAGTPAL------------ATDSASDFT
B9DV59_STRU0          --------------------EEDLALSSKRNDHVSHGIT------------DEIKEDQKP
A0A076YYR4_STRAG      --------------------DNSVSQEQDTEANAVSPKE------------ESSQEQENS
F8LGV3_STREH          NNPLIANIDDPEPQNPVVANIDDTEPQASNPLLDDVTISDTIDLAAIASTVAGVTGVKAD
F8HBC8_STRE5          NNPLIANIDDPEPQNPVVANIDDTEPQASNPLLDDVTISDTIDLAAIASTVAGVTGAKAD
Q5M644_STRT2          ----------PEPESTLPADDKASEPQASKPLLEDVEVSETIDSDAIATTVAGVTGVKAD
A0A0H3MTL4_STRS4      ---------------------EELSVTPMETLEETVIAS-------------TVAMEGLS
Q02XL5_LACLS          ----------EAKAGKNDLVLDPVVMVDAPVSTLPEQKESPS---VEKIEEIDEPVEELP
A2RJC3_LACLM          ----------EAKAGKNDLVLDPVVIVDAPVSTLPEQKESPS---VEKIEEIDEPVEELP
D2BKU0_LACLK          ----------ETKKSKNDLVLDPVVMVDAPVSTLPEQKEAPQVEEVKKTEPTDEEEAESP
A0A1V0NH88_LACLL      ----------ETKKSKNDLVLDPVVMVDAPVSTLPEQKEAPQVEEVKKTEPTDEEEAESP
F9VCG7_LACGL          ----------NFKE-KNKSEFDEVEIADDVPPVVPVSVEGAE---KESAPKQVEETESQT
                                                                                  

MAPZ_STRR6            TEMTEEVEEEQ--NLSRLDQEDSEK-----------------------------------
M5MZC5_STREE          TEMTEEVEEEQ--NLSRLDQEDSEK-----------------------------------
A0A0T8G9C9_STREE      TEMTEEVEEEQ--NLSRLDQEDSEK-----------------------------------
G6J8C7_STREE          TEMTEEVEEEQ--NLSRLDQEDSEK-----------------------------------
G0ICC1_STRES          TEMTEEVEEEQ--NLSRLDQEDSEK-----------------------------------
B1I9H4_STRPI          TEMTEEVEEEQ--NFSRLEQEDSEK-----------------------------------
D6ZQL0_STRP0          TEMTEEVEEEQ--NLSRLEQEESEK-----------------------------------
D3HAU2_STRM6          LVEASETEDIP--TLYRVTDSEDGK-----------------------------------
F2QF68_STROU          KQINEEQEEETYTPLSRSAQTEPETG----------------------------------
A8AVU7_STRGC          TQVDLEPVAPVSTPVTEDSYEEDDEK----------------------------------
A3CPY0_STRSV          EQEDAVPVAPVQKTSYGPIPEPLDEKELQ-------------------------------
F8DIP5_STREP          ELPAKIKFGPTSTEPIEEAEDLPEEI----------------------------------
F5WZ90_STRG1          SEPTPEAASAVVADDKNSEAIALET-----------------------------------
H2A4X0_STRMD          PEPTPEAASAVVADDKNSEAITLET-----------------------------------
F5X522_STRPX          SEPTPEAASAVVADDKNSEAIALET-----------------------------------
Q1J5H7_STRPF          PSERVIPEPQITKEEPKRDQFLSED-----------------------------------
A0A0H2UW34_STRP3      PSERVIPEPQITKEEPKRDQFLSED-----------------------------------
Q99YL6_STRP1          PSERVIPEPQMTKEEPKRDQFLSED-----------------------------------
Q1JKN6_STRPC          PSERVIPEPQMTKEEPKRDQFLSED-----------------------------------
Q1JFM7_STRPD          PSERVIPEPQMTKEEPKRDQFLSED-----------------------------------
C5WIH4_STRDG          PVEKTIPEPQVTQEQPVSEQFFTDT-----------------------------------
C0MH24_STRS7          GQP---ADDAVSERPAEVESILSDS-----------------------------------
B4U4I2_STREM          GQL---ADDAVSERPAEVESILSDS-----------------------------------
A0A6D2LUJ9_STRSZ      GQL---ADDAVSERPAEVESILSDS-----------------------------------
B9DV59_STRU0          VFDQVEPVVPIVDSSREDDQVAFLD-----------------------------------
A0A076YYR4_STRAG      VTPVPPLNTEAEPTATEPDSTIADS-----------------------------------
F8LGV3_STREH          EEKTTPKVSMAVNHPSAEDRISSESISPSHK-----------------------------
F8HBC8_STRE5          EEKITPKVSMAVNRPSAEDRISSESISPSHK-----------------------------
Q5M644_STRT2          EAKATPKVSMTVSRPSAEDKISSGSISPSHK-----------------------------
A0A0H3MTL4_STRS4      SVADDSSLELEEDETEDLDHSEGAD-----------------------------------
Q02XL5_LACLS          LEEEKVTVPIMMSANEVPMEEVKDDESPETS--------KVEKSEAEPK---EPEEEKNS
A2RJC3_LACLM          LEEEEVTVPIMMSANEVPMAEVKDDESPETS--------KVEKSEAEPK---EPEEEKNS
D2BKU0_LACLK          QDEKVVAAPVMMSANEVPMDEPSEPEISETD--TKTDSIIDEKSEVEPKVTEEPAEEIKS
A0A1V0NH88_LACLL      QDEKLVAAPVMMSANEVPMDEPSEPEISETDADTKTDSIIDEKSEVEPKVTEEPAEEIKS
F9VCG7_LACGL          QDFPELSNQVPESKEEVAETSPTEEPVSTDD--------------------------QEL
                                                                                  

MAPZ_STRR6            ---------------KSKKGFILTVLALVSVIICVSAYYV---------YRQVARSTK--
M5MZC5_STREE          ---------------KSKKGFILTVLALVSVIICVSAYYV---------YRQVARSTK--
A0A0T8G9C9_STREE      ---------------KSKKGFILTVLALVSVIICVSAYYV---------YRQVARSTK--
G6J8C7_STREE          ---------------KSKKGFILTVLALVSVIICVSAYYV---------YRQVARSTK--
G0ICC1_STRES          ---------------KSKKGFVLTALALVSVIICVSAYYV---------YRQVNRSTK--
B1I9H4_STRPI          ---------------KSKKGFVLTALALVSVIICVSAYYV---------YRQVNRSTK--
D6ZQL0_STRP0          ---------------KSKKGFVLTALALVSVIICVSAYYV---------YRQVNRSTK--
D3HAU2_STRM6          ---------------SKKKWVLYGILAALVVLILGTGYYI---------YRQVARSTK--
F2QF68_STROU          ---------------SKKKGVIIIASVVAAILVLAGTYYV---------YRQVSRSNQ--
A8AVU7_STRGC          -------------TGSGSKKVIYALVALLAVAGIAATAYFAMNR--NQAGKTVTSSSS--
A3CPY0_STRSV          ---------VPKTPFYKKKAFLYPVLGLLGIAVAGTGLYFALGH--NWGHKTVTSSSSST
F8DIP5_STREP          ----------PSNAGKRIKTVLYSVLGLAIVGSAIFVTYNWMHSRGTSGGTTVVSSSS--
F5WZ90_STRG1          ---------ADEQPTYKNKRVIIGGLAALVVAIFGVAYGLNYTRESS---TSVASSSTS-
H2A4X0_STRMD          ---------ADEQPTHKNKRVIIGGLAALVVAIFGVAYGLNYTRESS---TSVASSSTS-
F5X522_STRPX          ---------ADEQPTYKNKRVIIGGLAVLVVAIFAVAYGLNYTKEPS---TSVASSSTS-
Q1J5H7_STRPF          ---------SHHPAKQNTKKGWLIALFLLLLAILAVVFGWNHFLRQDSGKTTQTASKQT-
A0A0H2UW34_STRP3      ---------SHHPAKQNTKKGWLIALFLLLLAILAVVFGWNHFLRQDSGKTTQTASKQT-
Q99YL6_STRP1          ---------SHHPAKQNTKKGWLIALFLLLLAILAVVFGWNHFLRQDSGKTTQTASKQT-
Q1JKN6_STRPC          ---------SHHPAKQNTKKGWLIALFLLLLAILAVVFGWNHFLRQDSGKTTQTASKQT-
Q1JFM7_STRPD          ---------SHHPAKQNTKKGWLIALFLLLLAILSVVFGWNHFLRQDSGKTTQTASKQT-
C5WIH4_STRDG          ---------DASNPRQ--KRGWLIALLLLLLAILATVFGWN-YLKQDNTKTNKAASSPT-
C0MH24_STRS7          ---------YAS--RRSKKKKPLFAILLALLTLAASAFALNYIYQLSKHKPQPKATISK-
B4U4I2_STREM          ---------YAS--RRSKKKKPLFAILLALLTLAASAFALNYIYQLSKHKPQPKATISK-
A0A6D2LUJ9_STRSZ      ---------YAS--RRSKKKKPLFAILLATLTLVASAFALNHIYQLSKHKPQSKATVSK-
B9DV59_STRU0          ---------SERSGNKKSKKKFLLALLSLLLLLVGGAFGLNVLKQNDSGTTNTKVSSQQ-
A0A076YYR4_STRAG      ---------EEYKSSSKKRGGIVGTLIALILLLIVAIFGYNYFKNNNSTNSQTATSQSS-
F8LGV3_STREH          ------SAFDGDIPVYRRKGVVIGALAVLALAIIGGSYALYKGTHSQSAKTTSTASSAV-
F8HBC8_STRE5          ------SAFDGDIPVYRRKGVVIGALAVLALAIIGGSYALYKGTHSQSAKTTSTASSAV-
Q5M644_STRT2          ------GVFDGDIPVYRRKGVVIGALTVLALAIIGGSYALYKVTHSQSAKTTSTASSAV-
A0A0H3MTL4_STRS4      -------------RDQKKKFYFWSAVGLSMIGVMATALVWMNSVNKSNTATSSSSTSTS-
Q02XL5_LACLS          DLNEEAKETPEASKIEEAPTDLVQEPKENTADIPDKVITADKVAPVLTSEKIAPKSESQE
A2RJC3_LACLM          DLNEEAKETPEASKIEEAPTDLVQEPKENTADIPDKVITADKVAPVLTSEKIAPKSESQE
D2BKU0_LACLK          DSKEDSTENNQALE-SGAEEKVTESPKETKSDIPDKVITAESVSPHLLAETTSFKADKVE
A0A1V0NH88_LACLL      DSKEDSTENNQALE-SGAEEKVTDSPKETKSDIPDKVITAESVSPHLLAETTSFKADKVE
F9VCG7_LACGL          ENSIEAEENVKDEEKESAPVEEAQLPQEDIVVPLEKTPIAGETVPTPLPVTPAVESETSA
                                                                             :    

MAPZ_STRR6            -------------------------------------------EIETSQSTTAN----QS
M5MZC5_STREE          -------------------------------------------EIETSQSTTAN----QS
A0A0T8G9C9_STREE      -------------------------------------------EIETSQSTTAN----QS
G6J8C7_STREE          -------------------------------------------EIETSQSTTAN----QS
G0ICC1_STRES          -------------------------------------------EIETSQSTTAN----QS
B1I9H4_STRPI          -------------------------------------------EIETSQSTTAN----QS
D6ZQL0_STRP0          -------------------------------------------EIETSQSTTAN----QS
D3HAU2_STRM6          -------------------------------------------EIQTSQSTTNT----QS
F2QF68_STROU          -------------------------------------------EIQSSQAASSDDQGTQT
A8AVU7_STRGC          -------------------------------------------QASKKTSSSSSS-SENK
A3CPY0_STRSV          S------------------------------------------QSSKKSSSSSSSDNTAK
F8DIP5_STREP          -------------------------------------------SKSSSTSKSSSSETQAQ
F5WZ90_STRG1          -------------------------------------------TTKKSTSSSSSAAVAKK
H2A4X0_STRMD          -------------------------------------------ITKKSTSSSSSAAAAKK
F5X522_STRPX          -------------------------------------------TTKKSTSSSS-SAVAKK
Q1J5H7_STRPF          -------------------------------------------KTSLQTDSAKKATRLKA
A0A0H2UW34_STRP3      -------------------------------------------KTSLQTDSAKKATRLKA
Q99YL6_STRP1          -------------------------------------------KTSLQTDSAKKATRLKA
Q1JKN6_STRPC          -------------------------------------------KTSLQTDSAKKATRLKA
Q1JFM7_STRPD          -------------------------------------------KTSLQTDSAKKATRLKA
C5WIH4_STRDG          -------------------------------------------TQTSKTAASKKAQQLKA
C0MH24_STRS7          -------------------------------------------KARSKTSTVNQTSKTRA
B4U4I2_STREM          -------------------------------------------KARSKTSTVNQTSKTKA
A0A6D2LUJ9_STRSZ      -------------------------------------------KARSKASTANQTSKTKA
B9DV59_STRU0          -------------------------------------------SSSKDS----KASLAKK
A0A076YYR4_STRAG      -------------------------------------------SSKATTTSSEEDKKASQ
F8LGV3_STREH          -------------------------------------------TSSSSK------DTAAA
F8HBC8_STRE5          -------------------------------------------TSSSSK------DTAAA
Q5M644_STRT2          -------------------------------------------ISSSSK------GASAS
A0A0H3MTL4_STRS4      -------------------------------------------QTSSTA-----SSSTDA
Q02XL5_LACLS          EPQESAEEKTTDGKAKNRKTPIIIGLCAIVLIAAGAVGFAQYNNHQKPKTVQTTK-SSQT
A2RJC3_LACLM          EPQESAEEKTTDGKAKNRKTPIIIGLCAIVLIAAGAVGFAQYNNHQKPKTVQTTK-SSQT
D2BKU0_LACLK          E----NAAKITDEKSKNRKKPIIIGLCAIVLIAAGAIGFAQYNSHQKGQTVQTSQ-SSQS
A0A1V0NH88_LACLL      E----NAAKITDEKSKNRKKPIIIGLCAIVLIAAGAIGFAQYNSHQKGKTVQTSQ-SSQS
F9VCG7_LACGL          Q--------EEQPKKKKDKRPLIIGLCALVLLAAGGAGYALYNHNNNEKAVNQAAVENKA
                                                                                  

MAPZ_STRR6            DVDDFNTLYDAFYTNSNKTALKNSQFDKLSQLKTLLDKLE-GSREHTLAKSKYDSLATQI
M5MZC5_STREE          DVDDFNTLYDAFYTDSNKTALKNSQFDKLSQLKTLLDKLE-GSREHTLAKSKYDSLATQI
A0A0T8G9C9_STREE      DVDDFNTLYDAFYTDSNKTALKNSQFDKLSQLKTLLDKLE-GSREHTLAKSKYDSLVTQI
G6J8C7_STREE          DVDDFNTLYDAFYTDSNKTALKNSQFDKLNQLKTLLDKLE-GSREHTLAKSKYDSLATQI
G0ICC1_STRES          DVDDFNTLYDAFYTDSNKTALKNSQFDKLSQLKTLLDKLE-GSREHTLAKSKYDSLATQI
B1I9H4_STRPI          DVDDFNTLYDAFYTDSNKTALKNSQFDKLSQLKTLLDKLE-GSREHTLAKSKYDSLATQI
D6ZQL0_STRP0          DVDDFNTLYDAFYTDSNKTALKNSQFDKLSQLKTLLDKLE-GSREHTLAKSKYDSLATQI
D3HAU2_STRM6          DVEEFNNLYDAFYTDSNKTALKNSQFDKLSQLKTLLDKLE-GSREYTLAKSKYDSLAIQI
F2QF68_STROU          ALKDFNDLYDTFYTDANKTALKNSQFDKLSQLKTLLDKLE-GSREYTLAKSRYDSLATQI
A8AVU7_STRGC          ALKKFNDLYDSFFTDKNKLALKNSSFANLDQLKAALEALK-NDKEYTVAKAKYDSLVKQI
A3CPY0_STRSV          NLKAFNDEYAAFFTDSNQTAVKNSKFGDLEKLKTLLEKLK-GSKDYDAAKSKYDSLVKQI
F8DIP5_STREP          KLEEFTKAYDAFFVDKSKSGLKNDKFGDLENLKKLLDKLE-GSSDYNTAKTKYEDLVKQV
F5WZ90_STRG1          AKTAFDDAYAAFFTDDTKTKLKNSEFDNISSLKEKLDDLK-DTDYYDDAKKEYDTLAAQI
H2A4X0_STRMD          AKTAFDDAYAAFFTDDTKTKLKNSEFDNISSLKEKLDDLK-DTDYYDDAKKEYDTLAAQI
F5X522_STRPX          AKRAFDDAYAAFFTDDTKTKLKNSEFDNISSLKEKLDDLK-DTDYYDDAKKEYDTLAAQI
Q1J5H7_STRPF          AAKAFEKQYGTFYTDATKSKLKNSAFATLPDLEAALKALE-GSAYYDKAKAKVDSLKKAI
A0A0H2UW34_STRP3      AAKAFEKQYGTFYTDATKSKLKNSAFATLPDLEAALKALE-GSAYYDKAKAKVDSLKKAI
Q99YL6_STRP1          AAKAFEKLYGTFYTDATKSKLKNSAFATLPDLEAALKALE-GSAYYDKAKAKVDSLKKAI
Q1JKN6_STRPC          AAKAFEKQYGTFYTDATKSKLKNSAFATLPDLEAALKALE-GSAYYDKAKAKVDSLKKAI
Q1JFM7_STRPD          AAKAFEKQYGTFYTDATKSKLKNSAFATLPDLEAALKALE-GSAYYDKAKAKVDSLKKAI
C5WIH4_STRDG          DVKAFEKKYSAFYTDATKSNLKNSAFTNLPELEKALKSLE-GSSYYDKAKEKVDALKKAI
C0MH24_STRS7          NAKAFEDLYKTFFTDNDKTTLKNSAFDQLPDLEAALKRLE-GTAYYDKAKEKVTGLKKQV
B4U4I2_STREM          NAKAFEDLYKTFFTDNDKTTLKNSAFDQLPDLEAALKRLE-GTAYYDKAKEKVTGLKKQV
A0A6D2LUJ9_STRSZ      DAKAFEDLYKTFFTDNDKTTLKNSAFDQLPNLETALKRLE-GTAYYDKAKEKVTGLKKQV
B9DV59_STRU0          AYKAFDKGLKAFYLDDEMTKLKNSEMTHLDDLTKKLDALK-NTNYYDKAKEKWESLKKQI
A0A076YYR4_STRAG      NLDNFNKSYANFFVDDKKTQLKNSEFDKLSELEKKVDALK-GTKYYGKVKVKFDSLKRQI
F8LGV3_STREH          DNKAFEEMYKNFFTDDEQTKLANDQFGKLSDLEKLLKKLE-KTKYYDAAKKKYDNLKKQI
F8HBC8_STRE5          DNKAFEEMYKNFFTDDEQTKLANDQFGKLSDLEKLLKKLE-KTKYYDAAKKKYDNLKKQI
Q5M644_STRT2          DNKAFEDMYKNFFTDDEQTKLANDQFGKLSDLEKLLKKLE-KTKYYDAAKTKYDNLKKQI
A0A0H3MTL4_STRS4      NVTAFEQLYNSFFTDSSLTKLKNSEFGKLAELKVLLEKLDKNSDSYTKAKEQYDHLEKAI
Q02XL5_LACLS          DLDKFEKQYDSFFTDKSHNVLKNSQFENLAALETLVNSHK-NSMAWSNAVSETESLTDQI
A2RJC3_LACLM          DLDKFEKQYDSFFTDKSHNVLKNSQFGNLAALETLVNSHK-NSMAWSNAVSETESLTDQI
D2BKU0_LACLK          DLDKYQKQYDAFFTDKSHTILRNSQFSKLSALETLVYAHK-NSMAWSNAVSDTESLKDQI
A0A1V0NH88_LACLL      DLDKYQKQYDAFFTDKSHTILRNSQFSKLSALETLVDAHK-NSMAWSNAVSDTESLKDQI
F9VCG7_LACGL          NLNAFNKAYDEFFTDADHQVLKNSNFDQLSALKNKLKTLK-GS-DFDTAETKVNALETQI
                          :      *: :     : *. :  :  *   :   .        .      *   :

MAPZ_STRR6            KAIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
M5MZC5_STREE          KAIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
A0A0T8G9C9_STREE      KVIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
G6J8C7_STREE          KAIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
G0ICC1_STRES          KAIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
B1I9H4_STRPI          KAIQDVNAQFEKPAIVDGVLDTNAKTKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
D6ZQL0_STRP0          KAIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
D3HAU2_STRM6          KAIQDVNAQFEKPAIVDGVLDTNAKAKSDAKFTD-----IKTGNTELDKVLDKAISLGKS
F2QF68_STROU          KAIQDVNALFESPAITDGVLDTNAKAKADAKFTE-----IKTGNTELDKLLDKAISLGKS
A8AVU7_STRGC          SAIQAVNSQFETAAIKDGVLDTNAKVKGDATFTE-----TKTGNDNLDKLISSAISQGKG
A3CPY0_STRSV          SAIQSVNSQFDGGAITDGVLNKEAKANTNATFSD-----VSSGNAKLDEVLKAAIAQGRG
F8DIP5_STREP          SAIQKVNSQFSSPVIKDGVLDANAKAKSDATFAE-----TKTGNEKLDSLLNEAVAQGRS
F5WZ90_STRG1          TAIQTINALFESNVIVNGEK-ASATVKSDANFDNLSSDLLNTGNANLDTLLQSAITDGKN
H2A4X0_STRMD          TAIQTINTLFESNVIVNGEK-ASATVKSDANFDNLSSALLNTGNANLDTLLQSAITDGKN
F5X522_STRPX          TAIQTINALYESNVIVNGEK-ASATVKSDANFDNLSSDLLNTGNANLDTLLQSAITDGKN
Q1J5H7_STRPF          AAITAVNGKFVSDVVVDGEK-VSAEVKADANFDDLSSATLTTGNANLDAVLQASITEGRQ
A0A0H2UW34_STRP3      AAITAVNGKFVSDAVVDGEK-VSAEVKADANFDDLSSATLTTGNANLDAVLQASITEGRQ
Q99YL6_STRP1          AAITAVNGKFVSDVVVDGEK-VSAEVKADANFDDLSSATLTIGNANLDAVLQASITEGRQ
Q1JKN6_STRPC          AAITAVNGKFVSDVVVDGEK-VSAEVKADANFDDLSSATLTTGNANLDAVLQASITEGRQ
Q1JFM7_STRPD          AAITAVNGKFVSDAVVDGEK-VSAEVKADANFDNLSSATLTTGNANLDAVLQASITEGRQ
C5WIH4_STRDG          TAITAVNGKFVSDTIVDGNK-VAAEVKPDANFDDLSSATLTTGNANLDAVLQASITEGRQ
C0MH24_STRS7          TAIQAVNGKFTTAAIVNGEK-VAAEVKADANFDDLASDTLTTGNAKLDSLLQSSIKAGRE
B4U4I2_STREM          TAIQAVNGKFTTAAIVNGEK-VAAEVKADANFDDLASDTLTTGNAKLDLLLQSSIKAGRE
A0A6D2LUJ9_STRSZ      TAIQAVNGKFITAAIVNGEK-IAAEVKADANFDDLASDTLTTGNAKLDSLLQSSIKAGRE
B9DV59_STRU0          TAIQTVNGKFSTEAIKDGQK-TAATIKSDANFDDFTADSLKTGNATLDKLLQEVVSDGRK
A0A076YYR4_STRAG      DAVKAVNDKFKSPAVVDGKKSEKLEVKDGANFDSLDSKTLNTGNASLDSLLHSIVSTGRN
F8LGV3_STREH          EAVQKINSQFESDALVDGSYNASIAVKSDANFNNLPESVTTTGNASLDSTIQEAIKGGKT
F8HBC8_STRE5          EAVQKINSQFESDALVDGSYNASIAVKSDANFNNLPESVTTTGNASLDSTIQEAIKGGKT
Q5M644_STRT2          EAIEKVNSKYESDALVDGSYNASISVKSDANFNDLSERVTNTGNASLDSIIQEVIKGGKT
A0A0H3MTL4_STRS4      AAIQAINGQFDKEVVVNGEIDTTATVKSGE-----SLSATTTGISAVDSLLASVVNFGRS
Q02XL5_LACLS          NAIKKVNALFTSAAITDGKLDSAAKIVTNVKIPE----TPKTSNETLNKLLTQAIDLAKS
A2RJC3_LACLM          NAIKKVNALFTSAAITDGKLDSAAKIVTNVKISE----TPKTSNETLNKLLTQAIDLAKS
D2BKU0_LACLK          NAIKKVNALFTSAAITDGKLDSSAKVVANVKVPE----TPKTTNETLNKLLTQAIDLAKS
A0A1V0NH88_LACLL      NAIKKVNALFTSAAITDGKLDSSAKVVANVKVPE----TPKTTNETLNKLLTQAIDLAKS
F9VCG7_LACGL          KAVEKVNALFNKSAIVDGELNKEAQVKAAVSIPA----VPKTENEKLNKVLAQAINMAKT
                       .:  :*  :   .: :*                      .     ::  :   :  .: 

MAPZ_STRR6            QQTSTSSSSSS---QTSSSSSSQASSNTTSEPKPSSS----NETRSSRS-----------
M5MZC5_STREE          QQTSTSSSSSS---QTSSSSSSQASSNTTSEPKPSSS----NETRSSRS-----------
A0A0T8G9C9_STREE      QQTSTSSSSSS---QTSSSSSSQASSNTTSEPKPSSS----NETRSSRS-----------
G6J8C7_STREE          QQTSTSSSSSS---QTSSSSSSQASSNTTSEPKPSSS----NETRSSRS-----------
G0ICC1_STRES          QQTSTSSSSSS---ETSSSSTSQTSSNTTSETSPSSSNAASNETRSSRS-----------
B1I9H4_STRPI          QQTSTSSSSSSSS-QTSSSSSSQASSNTTSETSPSSSNAASNETRSSRS-----------
D6ZQL0_STRP0          QQTSTSSSSSS---ETSSSSTSQTSSNTTSETSPSSS----NETRSSRS-----------
D3HAU2_STRM6          QQTSTSSSSSS---ETSSSSSSQASSNTTSETSPSSSNAASNETRSSRS-----------
F2QF68_STROU          QQTSASSSSSS-------SSTSQASSSSATESNASSTTPSTSNTAPAR------------
A8AVU7_STRGC          QQTVSQSAGGQ----GTASNTTPAPAETTPTAPTTNNT--DQSVITGGS-----------
A3CPY0_STRSV          QQIPTPAP---------ATDQGGTGAGTSGGSSASGSG--ASSSYSGY------------
F8DIP5_STREP          QQVATPAPVTG----TGGTEASNATPAPAVNATTSGAGT-ASPGYSGY------------
F5WZ90_STRG1          QL-------------AALASSSSQEASASTSSQTESAS--SSDTSTTQT-V---------
H2A4X0_STRMD          QL-------------AALASSSSQEVSASSSSQTESAS--SSDTSTTQT-V---------
F5X522_STRPX          QL-------------AALASSSSQEASASISSQTESATQSSSDTSTTPT-V---------
Q1J5H7_STRPF          QL-------------ASKAEAAKAANEQEAQDQ-------AAQGQSTSV-----------
A0A0H2UW34_STRP3      QL-------------ASKAEAAKAANEQEAQAQ-------AAQGQSTSV-----------
Q99YL6_STRP1          QL-------------ASKAEAAKAANEQAVQDQ-------AAQGQSTSV-----------
Q1JKN6_STRPC          QL-------------ASKAEAAKAANEQAAQAQ-------AAQGQSTSV-----------
Q1JFM7_STRPD          QL-------------ASKAEAAKAANEQAAQTQ-------AAQGQSTSV-----------
C5WIH4_STRDG          QL-------------ATKAEAAKAASDQAAAQSQQATEVPAAQTSSATV-----------
C0MH24_STRS7          QL-------------ASRS-ATQAASTPAASVSPASPAAPQAPAVPAPV-----------
B4U4I2_STREM          QL-------------ASRS-ATQAASTPAASASPASPAAPQAPAVPAPV-----------
A0A6D2LUJ9_STRSZ      QL-------------ASRS-ATQAASTPAASALPASPAAPQVPAVPAPV-----------
B9DV59_STRU0          QVDDKNKAEKEKADAQAKADAEQKAAQDAATAEQANAAQSATTTSGATTGA---------
A0A076YYR4_STRAG      QVK------------QSEEQASSNKVSDTQITEQPN----VTNGQSSSS-----------
F8LGV3_STREH          QLEE-----------KAKAASATSAATAADSANTASPAAPSGDNTSGAASTGGGAAASNT
F8HBC8_STRE5          QLEE-----------KAKAASATSAATAADSANTASPAAPSGDNTSGAASTGGGAAASNT
Q5M644_STRT2          QLEE-----------KGKAASATSAVTASESVNTATP---SGDNTSGAANS---------
A0A0H3MTL4_STRS4      QQE-----------VASATVASEAAVTRNQGADETVSTGVPATTEVASTTV---------
Q02XL5_LACLS          QVAKESSAQAS----ASSAEAKANQGAGTQTSSSSTTSQSSSTTNASSS-----------
A2RJC3_LACLM          QVAKESSAQAS----ASSAEAKANQGAGTQTSSSSTTSQSSSTTNASSS-----------
D2BKU0_LACLK          QVAKESSAKAS----ASAAEAKANQGATSQSSTSSTASQSNSTTTPSSAAS---------
A0A1V0NH88_LACLL      QVAKESSAKAS----ASAAEAKANQGATSQSSTSSTASQSNSTTTPSSAAS---------
F9VCG7_LACGL          QQSEAKAKEEQ----AAAAQNNAATQPANQNS-GQAAGNSASTDTPSGTTG---------
                      *                                                           

MAPZ_STRR6            ---------------------------------EVNMGLSSA----------GVAVQRSA
M5MZC5_STREE          ---------------------------------EVNMGLSSA----------GVAVQRSA
A0A0T8G9C9_STREE      ---------------------------------EVNMGLSSA----------GVAVQRSA
G6J8C7_STREE          ---------------------------------EVNMGLSSA----------GVAVQRSA
G0ICC1_STRES          ---------------------------------KVNMGVSSA----------GVAVQRSA
B1I9H4_STRPI          ---------------------------------EVNMGVSSA----------GVAVQRSA
D6ZQL0_STRP0          ---------------------------------EVNMGLSSA----------GVAVQRSA
D3HAU2_STRM6          ---------------------------------EVNMGLSSA----------GVAVQRSA
F2QF68_STROU          ---------------------------------DTNGGLSGD----------GVNLQRSA
A8AVU7_STRGC          ---------------------------------TGYGGLSST----------GVALQRNL
A3CPY0_STRSV          -------------------------------------GLPSN----------GVNLQRDL
F8DIP5_STREP          -------------------------------------GLPSD----------GVPLQRNL
F5WZ90_STRG1          ------------------------------SGASGYGITSYD----------ASTLQRSL
H2A4X0_STRMD          ------------------------------SGASGYGITSYD----------ASTLQRSL
F5X522_STRPX          ------------------------------SGASGYGITSYD----------ASTLQRSL
Q1J5H7_STRPF          -------------------------------APSGYGLTSYD----------PASLQRHL
A0A0H2UW34_STRP3      -------------------------------APSGYGLTSYD----------PASLQRHL
Q99YL6_STRP1          -------------------------------APSGYGLTSYD----------PASLQRHL
Q1JKN6_STRPC          -------------------------------APSGYGLTSYD----------PASLQRHL
Q1JFM7_STRPD          -------------------------------APSGYGLTSYD----------PASLQRHL
C5WIH4_STRDG          -------------------------------TSSGYGITAYN----------PASLQRQL
C0MH24_STRS7          -------------------------------VPM-YGITGYD----------PSILQRDL
B4U4I2_STREM          -------------------------------APM-YGITGYD----------LSILQRDL
A0A6D2LUJ9_STRSZ      -------------------------------APM-YGITGYD----------PSILQRDL
B9DV59_STRU0          ------------------------------QAPATGGTYGTA----------ASGIQRNL
A0A076YYR4_STRAG      ------------------------------AATINNQAAGTA----------SGNLERNR
F8LGV3_STREH          SGAQNGSANS-GAAGSTGATGGTTGGSAAASTVVTRGITNYN----------PSILQRDR
F8HBC8_STRE5          SGAQNGAANSPGSTGSAGATGGTTGGSAAASTVVTRGITNYN----------PSILQRDR
Q5M644_STRT2          --------------GVTGVAGGVSSGTAATSTVVTRGIMNYN----------PSILQRDR
A0A0H3MTL4_STRS4      -----------------------------SGSTTDFGIAVPA----------GVVLQRDR
Q02XL5_LACLS          -------------------------TNSNANASTNGNGLSSN------------GVNLEV
A2RJC3_LACLM          -------------------------TNSNANASTNGNGLSSN------------GVNLEV
D2BKU0_LACLK          -----------------------AGSSTNASTSSNANGLSSN------------GVNLEV
A0A1V0NH88_LACLL      -----------------------AGSSTNASTSSNANGLSSN------------GVNLEV
F9VCG7_LACGL          -----------------------AATQQQAGKNTAQGGASSSTVVAADGAQNPTGATPDN
                                                                                  

MAPZ_STRR6            SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
M5MZC5_STREE          SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
A0A0T8G9C9_STREE      SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
G6J8C7_STREE          SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
G0ICC1_STRES          SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
B1I9H4_STRPI          SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
D6ZQL0_STRP0          SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGDQYILERVNIVNGN------
D3HAU2_STRM6          SRVAYNQSAIDDSNNSAWDFADGVLEQILATSRSRGYITGNQYILERVNIVNGN------
F2QF68_STROU          SRVPYNQSAVDDSNNPAWTFADGVLEQVLATSRARGYITGNQYILERVNIVNGN------
A8AVU7_STRGC          SRVPYNQAVIDDVNNPAWVFNPGILEKILKISRERGYITGDQYIIERVNIIKGN------
A3CPY0_STRSV          SRVPYNQAAIDDVNNPAWIFNPGVLEKILQTSRERGYISGDNYILERVNIIKGN------
F8DIP5_STREP          SRVPYNQAAINDVNNPAWVFGDGILEKVLNIARKRGHITGNQYILERVNIINGN------
F5WZ90_STRG1          SRVPYSDSAIADSSNSAWTFADGVLDKIVATSQSRGYFSGNDYILEKVNIINGN------
H2A4X0_STRMD          SRVPYSDSAIADSSNSAWTFADGVLDKIVAISQSRGYFSGNDYILEKVNIINGN------
F5X522_STRPX          SRVPYSDSAIADSSNSAWTFADGVLDKIVATSQSRGYFSGNDYILEKVNIINGN------
Q1J5H7_STRPF          SRVPYNQDVIADRANPSWAFNPGVLEKIVATSQARGYISGNQYILEPVNIINGN------
A0A0H2UW34_STRP3      SRVPYNQDVIADRANPSWAFNPGVLEKIVATSQARGYISGNQYILEPVNIINGN------
Q99YL6_STRP1          SRVPYNQDVIADRANPSWAFNPGVLEKIVATSQARGYISGNQYILEPVNIINGN------
Q1JKN6_STRPC          SRVPYNQDVIADRANPSWAFNPGVLEKIVATSQARGYISGYQYILEPVNIINGN------
Q1JFM7_STRPD          SRVPYNQDVIADRANPSWAFNPGVLEKIVATSQARGYISGNQYILEPVNIINGN------
C5WIH4_STRDG          SRVPYNDSLIADSGNPAWAFNPGILEKIVATSQARGYISGNQYILEPVNIINGN------
C0MH24_STRS7          SRVPYNQAMIADTGNPAWAFNLGVLERIVATSQARGYISGNDYILEPVNIINGN------
B4U4I2_STREM          SRVPYNQAMIADTGNPAWAFNPGVLERIVATSQARGYISGDDYILEPVNIINGN------
A0A6D2LUJ9_STRSZ      SRVPYNQAMIADTGNPAWAFNPGVLERIVATSQARGYISGNDYILEPVNIINGN------
B9DV59_STRU0          SRVPYNNAAIADSTNAAWLFNPGVLEKIIATSQARGYFTGNNYYLEPVNIINGN------
A0A076YYR4_STRAG      SRVPYNNAAIADTGNPAWIFNPGVLEKIVATSQARGYFSGNNYILEPVNIINGN------
F8LGV3_STREH          SRVPYNANVVADTSNPAWTWADGVLDKIINESHSRGYFSGDNFILEPVNIINGN------
F8HBC8_STRE5          SRVPYNANVVADTSNPAWTWADGVLDKIIETSHSRGYFSGDNFILEPVNIINGN------
Q5M644_STRT2          SRVPYNANVVADTSNPAWTWADGVLDKIIATSHSRGYFSGDNFILEPVNIINGN------
A0A0H3MTL4_STRS4      SRVPYNQAMIDDVNNEAWNFNPGILENIVTISQQRGYITGNQYILEKVNIINGN------
Q02XL5_LACLS          SAARVQPQAGINPNDPAFTWGAGIKEMVLNKARERGYITGDNYILVPTAIHTTNGSQGFP
A2RJC3_LACLM          SAARVQPQADINPNDPAFTWGAGIKEMVLNKARERGYITGDNYILVPTAIHTTNGSQGFP
D2BKU0_LACLK          SAARVQTQAGVNTNDPAFTWGAGIKEMVLNKARERGYITGDNYILVPTAIHTTNGSQGFP
A0A1V0NH88_LACLL      SAARVQPQAGVNTNDPAFTWGAGIKEMVLNKARERGYITGDNYILVPTAIHTTNGSQGFP
F9VCG7_LACGL          SNARVQPQANLNPQDPAFTWNPGIRDKVLNIARQRGYISGNDFILLPVAIHTM--TSGYM
                      * .  .     :  : :: :  *: : ::  :: **:::* :: :  . * .        

MAPZ_STRR6            -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
M5MZC5_STREE          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
A0A0T8G9C9_STREE      -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
G6J8C7_STREE          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
G0ICC1_STRES          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
B1I9H4_STRPI          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
D6ZQL0_STRP0          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
D3HAU2_STRM6          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGAGHADDLDY--
F2QF68_STROU          -----GYYNLYKPDGTYLFTLNCKTGYFVGNGSGHADDLDY--
A8AVU7_STRGC          -----GYYNLFKPDGTYLFSINCKTGYFVGNGPGYADSLDY--
A3CPY0_STRSV          -----GYYNLFKPDGTYLFSINCKTGYFVGNGPGHADSLDF--
F8DIP5_STREP          -----GYYNLFKPDGTYLFSINAKTGYFVGNGKGHSDALDY--
F5WZ90_STRG1          -----GYYNMFKADGTYLFSINCKTGYFVGNASGNSDALDY--
H2A4X0_STRMD          -----GYYNMFKADGTYLFSINCKTGYFVGNASGNSDTLDY--
F5X522_STRPX          -----GYYNMFKADGTYLFSINCKTGYFVGNASGNSDALDY--
Q1J5H7_STRPF          -----GYYNMFKPDGTYLFSINCKTGYFVGNGKGYADALDY--
A0A0H2UW34_STRP3      -----GYYNMFKPDGTYLFSINCKTGYFVGNGKGYADALDY--
Q99YL6_STRP1          -----GYYNMFKPDGTYLFSINCKTGYFVGNGKGYADALDY--
Q1JKN6_STRPC          -----GYYNMFKPDGTYLFSINCKTGYFVGNGKGYADALDY--
Q1JFM7_STRPD          -----GYYNMFKPDGTYLFSINCKTGYFVGNGKGYADALDY--
C5WIH4_STRDG          -----GYYNMFKPDGTYLFSINCKTGYFVGNAKGYSDALDY--
C0MH24_STRS7          -----GYYNMFKPDGTYLFSLNCKTGYFVGNGKGHAEDLDY--
B4U4I2_STREM          -----GYYNMFKPDGTYLFSLNCKTGYFVGNGKGHAEDLDY--
A0A6D2LUJ9_STRSZ      -----GYYNMFRPDGTYLFSLNCKTGYFVGNGKGHAEDLDY--
B9DV59_STRU0          -----GYYNMFKSDGTYLFSINCKTGYFVGNASGYADGLDY--
A0A076YYR4_STRAG      -----GYYNMFKLDGTYLFSINAKTGYFVGNAPGRADSLDY--
F8LGV3_STREH          -----GYYNLYLPDGTYLFSINCKTGYYVGNGSGHSDKLDY--
F8HBC8_STRE5          -----GYYNLYLPDGTYLFSINCKTGYYVGNGSGHSDKLDY--
Q5M644_STRT2          -----GYYNMYLPDGTYLFSINCKTGYYVGNGSGHSDKLDY--
A0A0H3MTL4_STRS4      -----GYYNMFKPDGTYLFSINCKTGYFVGNGAGHSDALDY--
Q02XL5_LACLS          AGIVSGYYNLYAPDGRYLVSINAKTGFFVGNGSGHADNLDYSE
A2RJC3_LACLM          AGIVSGYYNLYAPDGRYLVSINAKTGFFVGNGSGHADNLDYSE
D2BKU0_LACLK          AGIVSGYYNLYAPDGRYLVSINAKTGFFVGNGSGHADNLDYDA
A0A1V0NH88_LACLL      AGIVSGYYNLYAPDGRYLVSINAKTGFFVGNGSGHADNLDYDA
F9VCG7_LACGL          AGQVAGYFNLYRPDGSYLLTINNKTGYFFGNGKGLPTDFG---
                           **:*::  ** **.::* ***::.**. * .  :.