CLUSTAL format seed alignment for MF_01942

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q8P5K2_XANCP          -----------------------------MSESANVAVRPSLRNPKHWPMYLGLAVMVLA
Q5H4E2_XANOR          -----------------------------MPESANVAVRPSLRNPKYWPMYLGLAVMVAA
B2FTS8_STRMK          ------------------------------MSDATTAVRPSLRDPRNWPMFAAMLGAFAI
Q87F59_XYLFT          -----------------------------MSDSTNVTPRPSLLKPAHWPMYVALCGMVLA
D2UC29_XANAP          -----------------------MSDVASAPSSSATHVTPPPRTPRHWSTWLLLGLALLA
L0DTE2_THIND          ----------------------------MTQTPRKQTMARPPLGPSTWPVWPVVGVLWLA
B8GL59_THISH          ----------------------------MARNRR----HESPLRPRYWPYWLAVGLLWVL
B1ZVZ1_OPITP          ----------------------------MARASE-----QPLWFPQHWPSWIGLALFWVA
I1XGS6_METNJ          ----------------------------------MKILSKKFLHPRFWPNWLGLGLMRIS
I1YIL6_METFJ          ------------------------------MTAIMKSLFVTYWHPRHWFSWIGLSLMRLS
A1WZG7_HALHL          -------------MSNAATAPKGRRRGARPTPKDDRLLQLRFLHPRFWGVWLQLGLLRTV
A0A0E1PUK9_ACIBA      -------------------------MSQKQP-YTPGEFQWSFLLPKYWGVWIAITFLMLL
B0V4M5_ACIBY          -------------------------MSQKQP-YTPGEFQWSFLLPKYWGVWIAITFLMLL
Q6FEU5_ACIAD          -------------------------MSQQQA-YIPSKFQWSFLLPKYWGIWIGITLLMLL
B0VAW3_ACIBY          -------------------------MTKPEAQYQSGQFQFSFLSLKYWGIWFTAFILMFL
A0A1E3M247_ACIBA      -------------------------MTKPEAQYQSGQFQFSFLSLKYWGIWFTAFILMFL
Q15SA3_PSEA6          -------------------------------------MSKSLLHPRHWASWFAVLILRII
Q1QU83_CHRSD          --------------------------------MAKHAFPESFAHPRYWPTWLAIGAMRLG
E1V7Q4_HALED          --------------------------------MSEQASSSRFLHPRYWPTWLAIGAMHVG
A1TYS8_MARHV          -------------------------MKKKYRKLPRNTDYSAYRHPRWWPTWLGIAAMWLV
E4PMT5_MARAH          -------------------------MKKKYRKLPRNTDYSAYRHPRWWPTWLGIFLMWCV
B3PC27_CELJU          ---------------------------MSSDNPKSPVFERAFLAPRFWPTWLLLGFFWLI
Q0VM58_ALCBS          -------------------------------MGKRINRPSRLSDPRLYPSWLGVGLFWLV
K0C8J3_ALCDB          ---------------------------------------------------MGLALFWLI
F6AIP4_PSEF1          --------------------------------MDRPVFRRTFLHSRFWPLWAGLGLLWLT
Q9HYZ8_PSEAE          --------------------------------MDRPRFSSAFLHPRYWPLWFGLGLLWLV
W8R9K6_PSEST          --------------------------------MDRSLFRASFLHPRFWLLWLGLGLLWLV
A4XRN5_PSEMY          --------------------------------MDRPRFRAYFLHPRFWPLWLGFGLLWLV
C1DQM3_AZOVD          --------------------------------MDRPHFRAHFLHPRFWGLWLALGLFWLV
I7C4R3_PSEPT          --------------------------------MERPRFRPYYLHPKFWGLWLGLGLLWLV
Q88M40_PSEPK          --------------------------------MERPRFRPYFLHPKFWGLWLGLGLLWLV
C3K0D2_PSEFS          --------------------------------MDRPRFRAVFFHPRFWLLWLGLGLLWLV
Q87YC9_PSESM          --------------------------------MDRPRFKASFLHPRFWPLWLGLGLLWLI
C5BNW3_TERTT          --------------------------------MSRIPFKRRLLHPKFMVSWVGMVLWWLF
Q21HE6_SACD2          ------------------------------MSQSEADSLKAPLHPKYWPTWCVFGLWWLL
LPXL_ECOLI            -------------------MTN------------LPKFSTALLHPRYWLTWLGIGVL-WL
Q32E85_SHIDS          -------------------MTN------------LPKFSTALLHPRYWLTWLGIGVL-WL
B7LFG5_ECO55          -------------------MTN------------LPKFSTALLHPRYWLTWLGIGVL-WL
A0A029IWM4_ECOLX      -------------------MTN------------LPKFSTALLHPRYWLTWLGIGVL-WL
D2TT60_CITRI          -------------------MTN------------LPKFSAALLHPRYWLTWLGIGAL-WL
A8AI25_CITK8          -------------------MTN------------LPKFSVALLHPRYWLTWLGIGAL-WL
A6T7D0_KLEP7          -------------------MTH------------LPKFSPALLHPRYWLLWLGIGLL-WL
Q8ZQ24_SALTY          -------------------MTK------------LPKFSVALLHPRYWLTWLGIGAL-WL
C9Y0W5_CROTZ          --------------MNGIFMTH------------LPQFSRALLHPRYWLTWLGIGLL-YL
A7ME71_CROS8          -------------------MTH------------LPQFSRALLHPRYWLTWLGIGLL-YL
E3GC97_ENTLS          -------------------MTH------------LPKFSAALLHPRHWLTWIGIGAL-WL
A0A6I4L5F5_9ENTR      -------------------MSN------------LPKFSRALLHPRYWLLWLGIGFL-WL
I2BAG9_SHIBC          -------------------MTH------------LPRFTRSLLHPRYWLTWFGIAAL-YL
A0A0H3CNJ6_ENTCC      -------------------MTQ------------LPKFTVTLLHPRYWLTWLGIGFL-WL
A4W967_ENT38          -------------------MTH------------LPKFSAALLHPRYWLTWFGVGLL-WL
Q6D6A6_PECAS          -------------------MTQ------------IPSFNRSLLHPRYWLTWLGIGIL-YL
E0SHR8_DICD3          -------------------MTQ------------LPSFHRSLLHPRYWPTWSGIVLL-YL
A0A0H3NW53_YERE1      --------------------MQ------------APSFNRSLLHPRYWLTWLGLGIL-YL
A8GCZ7_SERP5          -------------------MTQ------------VPSFNRSLLHPRYWLTWLGIGLL-YL
H2IUW8_RAHAC          -------------------MTQ------------VPTFNRSLLHPRYWITWMGLGLL-YA
D8MQP0_ERWBE          -------------------MTQ------------LPQFTRALLHPRYWHTWLGIGFL-YL
B2VDK0_ERWT9          -------------------MTQ------------LPQFSRALLHPRYWFTWLGIALL-YV
E6WDD9_PANSA          -------------------MTQ------------LPQFSRELLHPRYWLTWFGIGIL-YL
E1SJK3_PANVC          -------------------MTQ------------LPQFSRELLHPRYWLTWLGVASL-YL
Q2NU53_SODGM          -------------------MTT------------LPVFNRSLLHPRYWLTWLGIGAL-YL
D3V2Q6_XENBS          -------------------MIQ------------APSFERSFLHPRYWLTWLGIGIL-YL
D3VC59_XENNA          -------------------MIQ------------APSFHRSFLHPRYWLTWFGIGIL-YL
Q7N5W5_PHOLL          -------------------MIQ------------APSFQRSLLHPRYWPTWFGISLL-YL
B4EYY3_PROMH          -------------------MIK------------SPPFKTSFLQPKYWLTWLGIGLL-YL
A0A140NRT4_PROSM      -------------------MIQ------------APKFDKSLLHPRYWLTWFGIGLL-YV
C5BHH1_EDWI9          ----------------MSDNHV------------YPQFQRSMLHPRYWLTWLGIGIF-YL
A0A0H3CIG6_ENTCC      -------------------MTK------------LPQFSLAFFHPRYWLSWTGIAAL-WC
Q7VR13_BLOFL          -------------------MER------------LPIFKFSLLMPRFWIIWLGIAIL-YI
LPXL_HAEIN            -----------------MKNEK------------LPQFQPHFLAPKYWLFWLGVAIW-RS
E1W6J3_HAEP3          -----------------MKNEK------------LPQFQPHFLAPKYWGFWLGVAIW-RS
B0UT07_HISS2          -----------------MAKTS------------IPQFNIEFLKPKYWLFWLGFLFF-RL
Q9CME5_PASMU          -----------------MANDK------------LPTFQKRFLKPKHWGFWLGVALW-RL
A6VP05_ACTSZ          -----------------MPKKH------------LPQFEKSYLHPKHWGFWLAVGLF-WL
B8F8K7_HAEPS          -----------------MIDKP------------LPPFQRAFLHPKYWGLWLGLGIF-KL
A3N0R0_ACTP2          ----------------MTENKN------------IPPFELRFLHPKYWGLWLGLGLF-KL
Q7VM88_HAEDU          ----------------MSKDNK------------NPAFEWRFLLPKYWGLWIGFAIF-KL
F4HAP4_GALAU          -----------------MKNQQ------------LPQFRFSFFLPKYWPLWFGIVLF-RL
Q5DZN9_ALIF1          -----------------MKTVP------------SPKFTWALLSPKYWLVWLSFSFLAVL
Q87LU9_VIBPA          -----------------MNIVP------------PPLFSYQLLKPKYWSVWLAFGALAII
Q5E8M9_ALIF1          -----------------MSKYP------------APKFSSALLHPKYWGVWFGFGFLFAI
Q7MPT1_VIBVY          -----------------MTTAT------------KPAFSISLLHPKYWPVWLGFGLLAIL
A0A0Q2M6I7_VIBFU      -----------------MSQDK----------YGKPQFTLSLLHPKNWGVWLGFGTLALI
Q87T91_VIBPA          -----------------MSKDK----------YTQPEFSLSLLHPRNWGVWLGFGLLAII
B7VHJ9_VIBA3          --------------MMVMTTKNSPASSTVQHVINKPPFTLALLHPKYWGVWFGFGLLAFI
Q9KVD3_VIBCH          --------------MSTMSQDK----------YSKPEFSFSLLHPKYWGVWLGFGLLALL
Q6LQJ6_PHOPR          -----------------MSNFT------------PPTFTKALLHPRYWLTLFFVGLM-YV
Q87NX3_VIBPA          -----------------MNKYK------------KPEFKAKFLLPRYWGTLILIGVM-YS
Q6LFU9_PHOPR          -----------------MSKFT------------PPTFKKAFLHPRYWPTLMMISIL-YL
A8GZ72_SHEPA          -----------------MSKYT------------VPTFSLAMLHPKYWCVLLIISIS-YL
A0A029HTZ1_ECOLX      -------------------MFP------------KCKFSREFLHPRYWLTWFGLGVL-WL
F4T1H6_ECOLX          -------------------MFP------------KCKFSREFLHPRYWLTWFGLGVL-WL
LPXP_ECOLI            -------------------MFP------------QCKFSREFLHPRYWLTWFGLGVL-WL
M7R9F1_SALDU          -------------------MFP------------QSKFSRAFLHPRYWLTWFGVGVL-WL
Q8ZNA3_SALTY          -------------------MFP------------QSKFSRAFLHPRYWLTWFGVGIL-WL
A9MII1_SALAR          -------------------MFP------------QSKFSRAFLHPRYWLTWFGVGVL-WL
D2THV2_CITRI          -------------------MSP------------TRKFSRAFLHPRYWLTWFGLGFL-WL
A8ADL6_CITK8          -------------------MFP------------QCKFSRALLHPRYWLTWFGLTVL-WL
A0A0H3CPL3_ENTCC      --------------------MS------------QSHFKRAFLHPRYWFTWFGLGVL-WL
A4WD01_ENT38          --------------------MS------------QCKFQRAFLHPRYWLTWFGLGLL-WL
A6T7M9_KLEP7          ---------------------M------------ACVFNKQLLHPRNWLTWFGLGIL-WL
B5XSE4_KLEP3          ---------------------M------------ACVFNKQLLHPRNWLTWFGLGIL-WL
E3G5Y9_ENTLS          ---------------------M------------AKAFDSALLRPRYWLTWFGLGSL-WL
I2BA98_SHIBC          MLRSLTPTQPLPSLHRLYSMTQ------------HQRFTTALLHPRYWLTWSGLGLL-WL
E6WBT8_PANSA          -------------------MKK------------TGHFCSQLLHPRYWFTWFGLGVL-WL
E1SIU5_PANVC          -------------------MKN------------TGKFSSSLLHPRYWFTWFGLGVL-WL
A7MEL3_CROS8          -------------------MNH------------VTPFSRALLHPRYWFTWFGLGLL-WL
H2IUB8_RAHAC          --------------------MN------------SPRFRASFLQPRYWLTWFGLGVL-FL
A0A0H3FE86_RAHSY      --------------------MN------------SPRFRASFLHPRYWLTWFGLGVL-FL
A0A0U1QZM3_YERP3      -------------------MIK------------PQKFHISLLHPRYWLTWFGLGVL-FL
I3U7I4_ADVKW          -------------------MKY------------SRNFQSTFLHPRYWLTWFGLGVL-FL
A8GK79_SERP5          -------------------MKR------------PQKFKMALLHPRYWFTWFGLGCL-FL
D8MXQ9_ERWBE          -------------------MKS------------SPRFTRRLLHPRYWITWIGLGIL-FL
Q6D938_PECAS          -------------------MSIMKI---------KQTFTRALLHPRYWTTWFGLGVL-FL
E0SLT7_DICD3          -------MSCMVSLLKLAVMALKKIFIMT-----QQTFTRELFHPRYWLLWFGLAVL-FL
Q2NUW6_SODGM          ------------------MMSQ------------PQKFSPALFHPRYWLTWFGLGVL-WL
C5B908_EDWI9          -------------------MKK------------PLHFRHAFLHPRYFSLWLGIGLL-YL
B4ET77_PROMH          -------------------MYA------------KNSFSLHLLHPKYFLTWLGVFIL-FL
A0A140NJD6_PROSM      -------------------MYA------------KNLFSLKLLHPKYATTWLGIVIL-FL
A1SRE1_PSYIN          -------------------MSS-------------YKLQLNFCHPKYWLTWLGILLL-FL
A4SIG5_AERS4          -------------------MAH----------EHAPRLEPHLFHPRYWGSWIGLSLLWLL
A0KPL5_AERHH          -------------------MAH----------DNAPRLEPRLFHPRYWASWFGLSLLWLL
H2FVE0_OCESG          -------------------MQD----------HRLPPFRAALLHPRFWPAWLGLGSLWLL
C4L9B3_TOLAT          ---------------MRATQLP----------DTAPRLTAGLFHPRYWPQWFGHAVLWLI
D4ZFU0_SHEVD          -------------------MVE------------KAQFSTHLFHPKYWLLWFGVGLM-RL
B1KE77_SHEWM          -------------------MVE------------KAQFSNHLFHPKFWLLWLGVGLM-RL
A3QAN2_SHELP          -------------------MVE------------NAQFSAQFFHPKYWLIWLGVGFM-RL
Q8EAZ1_SHEON          -------------------MVE------------KAEFSSSLYHPKHWPMWFGVFMM-RI
Q07Y77_SHEFN          -----------------MSVVE------------KAEFSSDLYHPKHWPMWFGVGLM-RL
A1S3I2_SHEAM          ------------MQQSEPQVVE------------SAQFSNHLYHPKYWLLWLGVGLM-RA
Q12RC8_SHEDO          ----------------MLVVVE------------KAQFSTHLLHPKYWLLWFGVALM-RT
Q5QY19_IDILO          -------------------MIE------------PPKFKFYFLHPKFWLTWLGVFIL-YS
Q47WI8_COLP3          ---------------MSSNKVL------------QPDFKLSFLLPKYWLTWLGVFIL-YT
F2G7H2_ALTMD          ----------------MAAAIK------------APKFKLSFLGPKFWPVWLGVFIL-YM
F5ZC15_ALTNA          ----------------MAAAIK------------APKFKLSFLTPKFWPVWLGVFLL-YI
Q15PT3_PSEA6          ---------------MSPSFVQ------------APTFTLAFFHPRFWLTWVGIVLL-YA
                                                                                  

Q8P5K2_XANCP          GRL-PWLLQRALGRGVGWVAMRLAG--TRRRAAEVNLKLCFPEQDDAWRARLLRDSFDAL
Q5H4E2_XANOR          GRL-PWTLQRAIGRGVGWVAMRLAG--TRRRAAEVNLKLCFPEQDDAWRARLLRDSFDAL
B2FTS8_STRMK          ARL-PWMLQRALGRGVGWITWRLLG--SRRRAAEVNLQLCFPEKDEAWRQRLVRDSFDAL
Q87F59_XYLFT          ARL-PWGLQRRLGRVIGAMALRLVG--TRRCAAEINLQLCFPTHNEAWRKKLLHENFDAL
D2UC29_XANAP          ARL-PWCLQRALGRGIGWLALRLAG--TRRHAAATNLALCFPEQSDAWRAHLLRESFDAL
L0DTE2_THIND          TRL-PFTWQHALGRGIGRLFQRLGR--SRREVTRVNLRLCFPEKTEQERETLLRRHFEAA
B8GL59_THISH          SKL-PMGLQRWMGYRIGDLFHAFGR--RRRHIARVNVDLCFPDWSESERARLVREHFRAV
B1ZVZ1_OPITP          TRL-PWGVQRALGRALGTAVYYLLP--IRRHVVHVNLRLCFPEKTERERRTLARAHYHSL
I1XGS6_METNJ          IYL-PKSWQLFAGHSLGRLMRLFMK--DRERVAKRNLELCFPEMSLKARKDLLNENMLTM
I1YIL6_METFJ          ALL-PVMGQRFAGKVIGQMMWWFAR--DRADIAKRNLALCFPDLTPQQRHHLLHKTMQTM
A1WZG7_HALHL          VTL-PHRARMAFGAGIGELAWHMAP--QRRRLVLRNLELSFPELSEQRRQTIARENFRLM
A0A0E1PUK9_ACIBA      AIL-PWAIQWRLAHGLANLAWKYLK--SRRKTTIRNLEVCFPEWTPEKVQQQAKQVFVDM
B0V4M5_ACIBY          AIL-PWAIQWRLAHGLANLAWKYLK--SRRKTTIRNLEVCFPEWSPEKVQQQAKQVFVDM
Q6FEU5_ACIAD          AIL-PWGIQWRLAHGLANLAWKYLK--SRRKTTIRNLEVCFPEWSPEEVEKQAKRVFIDM
B0VAW3_ACIBY          AYL-PWAIQWRLAKLFSKIAWTLLG--SRRKTTLRNLGACFPEKTPEQIEAKAKSVFTDT
A0A1E3M247_ACIBA      AYL-PWAIQWRLAKLFSKIAWTLLG--SRRKTTLRNLGACFPEKTSEQIEAKAKSVFTDT
Q15SA3_PSEA6          ALL-PFKVKMLAGTAFGKIGYRFFK--HRRHITTTNIALCFPEKSEAEQEQLVKDIFVAN
Q1QU83_CHRSD          AWL-PWRVKMALGHVIGLAAWRFAR--SRRRITETNLALCFPELAERERARLVRETFIAN
E1V7Q4_HALED          AWL-PWRLKLWVGKLIGLAAWRFAK--RRRRIAETNIQLCFPEFDEARQQRLVKDAFIAN
A1TYS8_MARHV          AQL-PLRLQWWLGKIAGLLAWRLAK--SRRHIAEVNIRLCFPELNQQQQAALVRNAFIAN
E4PMT5_MARAH          SRL-PIRVQWWLGKMAGLLAFRLAR--SRRHIAEVNIRLCFPELTSAQQSALVRKAFIAN
B3PC27_CELJU          AQL-PVRLNQAVGYGLGWLLFYLAP--ARRRIAAINIEYCFPELDARARDNMVRGVIYAC
Q0VM58_ALCBS          GQL-PWTVLLAAGRGLGHLAWHLTK--KRRHVVQTNIRFCFPELSAEEQETLARRCMVST
K0C8J3_ALCDB          GQL-PWDLLLALGRGIGHVAWWLAR--KRRHIAVTNLRLCFPELSDTEREALARKVMVST
F6AIP4_PSEF1          VQL-PYGALLRLGRGLGWLMYHAAG--SRRRIATRNLELCFPQMPADKRERLLKENFAST
Q9HYZ8_PSEAE          VQL-PYPVLLMLGRGLGALMYRLVG--SRREIAARNLELCFPEKSPAERERLLKENFASS
W8R9K6_PSEST          VQL-PYRVLLLLGRGLGVVMYRTAR--SRRHIARRNLQLCFPELSDMDRERLLRENFAST
A4XRN5_PSEMY          VQL-PYGLQLKLGRALGWLMYRTAG--SRRRIAARNLELCFPAKSAAERERLLRENFAST
C1DQM3_AZOVD          AQL-PYAWLLRLGRWLGALTYRLAG--SRRRIARRNLELCFPELSADERERLLRENFASM
I7C4R3_PSEPT          VQL-PYRVLLKIGAALGAVMYCFAG--ERRRIAARNLELCFPELSIDERQRLLKANFAST
Q88M40_PSEPK          VQL-PYRVLLKIGAALGAVMYRFAG--ERRRIAARNLELCFPELSVDERQRLLKANFAST
C3K0D2_PSEFS          TQL-PYRALLTIGRLLGAGMYRVAG--ERRRIAARNLELCFPEKSAKERKRLLKENFAST
Q87YC9_PSESM          VQL-PFRVLLIIGRALGAVMYRVAT--DRKNIASRNLELCFPHLSAAERKRLLKENFAST
C5BNW3_TERTT          VQLLPLGAQFWLGNRLGDLLLKLNV--SRTKIARQNIAVCFPDMDPQRQELMVRDTLRAT
Q21HE6_SACD2          VVLLPLPIQMWLGGKLGRLAAKLSE--RRARITRKNLELCFPEKNEQEREALFWESMESA
LPXL_ECOLI            VVQLPYPVIYRLGCGLGKLALRFMK--RRAKIVHRNLELCFPEMSEQERRKMVVKNFESV
Q32E85_SHIDS          VVQLPYPVIYRLGCGLGKLALRFMK--RRAKIVHRNLELCFPEMSEQERRKMVVKNFESV
B7LFG5_ECO55          VVQLPYPVIYRLGCGLGKLALRFMK--RRAKIVHRNLELCFPEMSEQERRKMVVKNFESV
A0A029IWM4_ECOLX      VVQLPYPVIYRLGCGLGKLALRFMK--RRAKIVHRNLELCFPEMSEQERRKMVVKNFESV
D2TT60_CITRI          VVQLPYPLIYRLGHLLGHLALRLMK--QRAKVARRNLELCFPDMSEQERQALVVKNFESV
A8AI25_CITK8          VVQLPYPVIYKLGCAMGRLALRFMK--RRARIAHRNLELCFPQMSEQERHQMVVKNFESV
A6T7D0_KLEP7          VVQLPYPLIYRLGNAIGRLAMRFMK--RRAKIAYRNLELCFPEKSEQERHRMVVMNFESV
Q8ZQ24_SALTY          VVQLPYPVIYKLGCALGHLARRVMK--RRAKIAYRNLELCFPEMSAQERHTMVVKNFESV
C9Y0W5_CROTZ          VVLLPYPVIWRLGRGMGRLALRLMR--RRARIAHRNLELCFPEMSEAEREALVVKNFESV
A7ME71_CROS8          VVLLPYPVIWRLGRGLGRIAKRLMK--RRARIAHRNLELCFPDMSDAEREALVVKNFESV
E3GC97_ENTLS          IVQLPYSVIYRLGTGLGRLSLLLMK--RRAEIAYRNLELCFPQMSAAQRHEMVVKNFESV
A0A6I4L5F5_9ENTR      LVQLPYPVIYRLGTALGRLAMRVMK--SRARIARRNLELCFPEMSAADREALLVKNFESL
I2BAG9_SHIBC          VVLLPYPVIYRIGCGLGFLAKRILK--RRVKIAHRNLELCFPEMSEAERQRHVDGNFRSV
A0A0H3CNJ6_ENTCC      LVQLPYPVIFRLGKSLGRLAQMFMK--RRARIAYRNLELCFPDMSEAERHDMVTRNFESV
A4W967_ENT38          LIQLPYPLLYRLGCGLGHLAHRFMK--RRVRITHRNLELCFPEMSEPERQVLLKKNFESV
Q6D6A6_PECAS          IVLLPYPVLYRIGTALGHLAMRLLP--QRVKIAARNLEMCFPQMPQAERNALLRKNFESV
E0SHR8_DICD3          LVLLPYPLIYRIGAGLGRLSMRFLK--RRVAIAHRNLQLCFPDMPEEQRKQLVKKNFESV
A0A0H3NW53_YERE1      LVLLPYPVIYTLGTSLGRFAMRFLK--RRKRITQRNLELCFPDMPKSERDELLLKNFESV
A8GCZ7_SERP5          LVLLPYPIIYRLGTSLGRFSMRFLK--RRVAIAQRNLVLCFPDMPQAERDALVVQNFESV
H2IUW8_RAHAC          LVLLPYPIIYRIGTGLGRFSMRFLK--HRYKIARRNIELCFPDMHPEQREDMIVKNFESV
D8MQP0_ERWBE          LVLLPYPVLYYIGCGLGRLSMRFLR--KRVNIAHRNLELCFPTMPEAEREAMVVRNFESV
B2VDK0_ERWT9          LVLLPYPVLYYVGCGLGRLSMRFLK--RRVDVARRNLELCFPEMPAAEREALMKRNFESL
E6WDD9_PANSA          LVLLPYPVLYVIGCGLGRIARRFLK--RRVKIAQRNLELCFPDMPVSERDAMVKHNFESV
E1SJK3_PANVC          LVLLPYPLLYVLGCNIGRIGMRFMK--RRVNIARRNLELTFPDMPVNEREAMVKHNFESV
Q2NU53_SODGM          LVLLPYPLLYALGTRLGRLAMRFMR--HREAIARRNLQLCFPAMPEAEREALLRQNFESV
D3V2Q6_XENBS          LVLLPYPVIYWIGTRLGRLSQRFLK--KRAKIAERNLALCFPDMSPEKRNELLVKNFESV
D3VC59_XENNA          LVLLPYPAIYWMGTRLGRLSQRVLK--KRAKVAERNLILCFPDMSPEKRHEWLVKNFESV
Q7N5W5_PHOLL          LVLLPYPIIYRIGTRLGRFSMHFLK--KRAKVAERNLELCFPDMPQEERNALLIKNFESV
B4EYY3_PROMH          LVLLPYPVIYWLGTRLGRLSKVFLK--KRVQIAERNLELCFPDMPKNEREALVNKNFESV
A0A140NRT4_PROSM      LVLLPYPMIYWMGTRLGLLSKHLLK--KRAQIADRNLALCFPEMSLEKRQHYIDKNFESV
C5BHH1_EDWI9          MMLLPYPWLYRLGKMLGKTAMRFMK--TRVEVTRRNLALCFPQMPEAQREAWVIQNFESV
A0A0H3CIG6_ENTCC      IVQLPYPLLLRIGHGLGRLAMRLLP--RRVDIARRNLELCFPDMKKDEREKLLQRNFESV
Q7VR13_BLOFL          IVLLPYPVIYYLGINIGRAMKYIML--YRVQIIRKNLDLCFPHLTDSEKKTLLNKNCESM
LPXL_HAEIN            ILCLPYPILRHIGHGFGWLFSHLKVGERRAAIARRNLELCFPDMPENEREVILQENLRSV
E1W6J3_HAEP3          LLLLPYPILRHIGNGLGWLFSKLKVGKRRAAIARRNLELCFPKMPEQEREAILQENLRAV
B0UT07_HISS2          ILLLPYPILLKIGNGLGSLFSHLKIGQRRTKIARQNLQLCFPHYSEQEINDILQSNLKAT
Q9CME5_PASMU          IVCLPYPILHKLGNGLGWLLAKSTVGQRRANIARRNLQLCFPHYSADQIETLLHANLKAT
A6VP05_ACTSZ          ILCLPYPVLRKIGLGLGRLFAKLKVGKRRAKIARRNLELAFPNMPLQQREQILRQNLNSV
B8F8K7_HAEPS          ILCLPYPILAKVGKGLGKLFTRLGLDKRRMRIAKRNLELCFPDYTACQIDEILAQNAESV
A3N0R0_ACTP2          ILCLPYPVLVVLGKGIGKLFAKLGFGKRRMRIARRNLELCFPDYSAERIQAILAKNIESV
Q7VM88_HAEDU          ILCLPYPILVKIGRSLAKLFSTLSFGKRRIAVARRNLALCFPDYSAEQIEAILIKNVESV
F4HAP4_GALAU          MLLLPYPCLVKIGHGLGKLFSKFKFGKRRLAIARRNLELCFPEMSELQRQDLLKQNIYAI
Q5DZN9_ALIF1          VNVLPFVVLKRIGNGIGCLSKFCLK--KRANVARKNLALCFPHYSQTEIERLVNENFKNT
Q87LU9_VIBPA          VNVLPYVVLRILGRSIGCVAMQLMK--RRYKIALRNLQLCFPDYTDWQCKDVVRKNFQYT
Q5E8M9_ALIF1          VTLLPYKVTYKLGRSLGLLGLKLGK--SRAHVARRNLELAFPEMESSEREAIIVENFKNS
Q7MPT1_VIBVY          VTILPYKLQLWLGRSLGHFAMRFAK--SRVHVARRNLELAFPEMGQQEREAIVVENFKNT
A0A0Q2M6I7_VIBFU      VNLLPYAVLLKLGQSLGLLGMRLGK--KRVHVAKRNFELAFPDKGSDEVEQMVVENFKNT
Q87T91_VIBPA          VNILPYRLLLSLGRSLGKLGMRYGK--KRVHIAKRNLELAFPEKTPEEVQHIVEENFKNT
B7VHJ9_VIBA3          VNILPYRVLLLLGRSLGALGARYGK--KRVAVATRNLELAFPDKPADEVAAMVSENFKNT
Q9KVD3_VIBCH          VNLLPYPVLLKIGRGLGQFSMRFGK--KRVHIARRNLELAFPTMSQSEIDAFVLENFKNT
Q6LQJ6_PHOPR          ISWLPYFIQYRMGQGVGRLAMRFMK--KRRKIIERNLELCFPNMSKDEREVMIKKNIDNT
Q87NX3_VIBPA          LSLLPFNIQLALGRGIGRLAMRIMK--KRQVTIRRNLELCFPHMGESQREAILKDNIDNS
Q6LFU9_PHOPR          ISWLPYFIQFRMGQGVGWLSFRLAS--RRRETVKRNLELCFPDMSEPERDALIHKNQENT
A8GZ72_SHEPA          CSLLPYAIQIRLGKLVGRVVLSFMK--RRTRTIKRNLELCFPDMTDAEREKLTKQNIENT
A0A029HTZ1_ECOLX      WVQLPYPVLCFLGTRIGTMARPFLK--RRESIARKNLELCFPQHSAKEREKMIAENFRSL
F4T1H6_ECOLX          WVQLPYPVLCFLGTRIGTMARPFLK--RRESIARKNLELCFPQHSAEEREKMIAENFRSL
LPXP_ECOLI            WVQLPYPVLCFLGTRIGAMARPFLK--RRESIARKNLELCFPQHSAEEREKMIAENFRSL
M7R9F1_SALDU          LVQLPYPVLRFLGTRTGKLARPFLK--RRESIAQKNIELCFPTLSREEREKLIAENFHSL
Q8ZNA3_SALTY          LVQLPYPVLRFLGTRTGKLARPFLK--RRESIAQKNIELCFPTLSREEREKLIAENFHSL
A9MII1_SALAR          LVQLPYPVLRFLGTRTGKLARPFLK--RRESIAQKNIELCFPALSWEEREKLLAENFHSL
D2THV2_CITRI          LVQLPYPVLCFLGTRTGTLARPFLK--RRESIARKNLELCFPTYSSEQRETMITENFRSL
A8ADL6_CITK8          LVLLPYPVLRFLGTRTGRLARPFLK--RRESIARKNLELCFPNLTPEEREKMIVENFHSL
A0A0H3CPL3_ENTCC      LVQLPYPMIRVLGSRLGSASRHFLK--RRESIARKNLELCFPQYNAQQRETLIAENFKSI
A4WD01_ENT38          LVQLPYPAIRVLGSRLGSASRHFLK--RRESIARRNLELCFPNDTPAQREKLIKENFKAI
A6T7M9_KLEP7          IVQLPYPLLHFIGTSAGRLSRRFLK--RREHIARRNIELCFPDMSPAARETLIDQNFMSL
B5XSE4_KLEP3          IVQLPYPLLHFIGTSAGRLSRRFLK--RREHIARRNIELCFPDMSPAARETLIDQNFMSL
E3G5Y9_ENTLS          LVQLPYPLLYIIGSSLGRAARPFLK--RRERIAAKNLELCFPEMSVSDRNRLIEQNFVSL
I2BA98_SHIBC          LVQLPYPLIAIIGRGAGRTSRRFLA--RREQIARRNIALCFPQLSAQKREELISENFASL
E6WBT8_PANSA          LVQLPYPILIRLGAAAGKLSRRFLK--RRERITRRNIELCFPHISDEEKELMIAGNFASL
E1SIU5_PANVC          LVQLPYPVLMRLGAGAGKISRHFLQ--RRERITRRNIELCFPGISEEKTEHMIAGNFASL
A7MEL3_CROS8          LVQMPHPLLMRLGAFLGRNSRRFLK--RREKILRRNLELCFPNFSEAQKEQLIQENFLSL
H2IUB8_RAHAC          LVQLPYPVLNRLGIWLGRTSMRFLK--RRVSITRRNLQLCFPDLPSDQVEARIISNFESL
A0A0H3FE86_RAHSY      LVQLPYPVLNRLGIWLGRTSMRFLK--RRVSITRRNLQLCFPDLPADQVEARIISNFESL
A0A0U1QZM3_YERP3      LVQLPYPLLNKLGVWLGRTSMRFLK--RRVSIARRNLELCFPDMDKQVLEQTIIGNFESL
I3U7I4_ADVKW          LVQLPYPILHRLGIWMGRCSMRFLK--RRVGITRRNLELCFPTMDQALREQRVRANFESL
A8GK79_SERP5          LVQLPYPVLHKLGIWMGRTSMRFLK--RRVSITRRNLELCFPDMDVEQRERKVTGNFESL
D8MXQ9_ERWBE          LVQLPFPLLEKLGTWMGRTSMRFLK--RRIRITRRNLELCFPEMPADQLEQHIVKNFESL
Q6D938_PECAS          LVQLPYPLLMKIGSSAGRLSRIFLK--RRVSIARRNLELCFPAISDDEREAMINSNFASL
E0SLT7_DICD3          LVQLPYPLLMRLGSWLGRSSRHFLK--RRVSIARRNLELCFPDMPVSQREAMLKANFASL
Q2NUW6_SODGM          LVQLPYPVLRRLGGFLGRMSKPFLK--RRVSIARRNLELCFPDMDRTRLEDTVNSNFTSL
C5B908_EDWI9          LVQMPYRWLCALGRFLGLCAMRLMA--RRVSIARQNLTLCFPQKTPEQIEYIVRENFKSL
B4ET77_PROMH          LVQLPYTWLLFLGKHLGLLSRFFIK--RRVSIIKKNLELCFPNKSKKDIDKLVMENLSAL
A0A140NJD6_PROSM      LVQLPYKWLVRLGAFLGVNSKYFIK--RRVSIIKRNLELCFPNKNRKEIDDLVIENLRSL
A1SRE1_PSYIN          SSFLPYGHLLAIGKFLGQITARMAK--SRYKIAYRNIELCFPNLSPSEITTKVQTNFENT
A4SIG5_AERS4          V-LLPWRSQMWLGRQLGTLARVLLK--SRVKIARRNLELTMPELTKDEREKLLRQNFESV
A0KPL5_AERHH          V-LLPWRSQMWLGCQLGSLARKLLK--SRVKIARRNLELAMPELTKDEREKLLKQNFESV
H2FVE0_OCESG          VTLLPWRAQMALGRALGRLSMRLLT--SRVKVARRNLELALPEREERERERLLKANFDSV
C4L9B3_TOLAT          V-QLPYPVLMQLGAALGWLTMKILP--RRVRIARTNLQLAFPEWDEETREQQIRENFANV
D4ZFU0_SHEVD          TQLLPLSIQMKLGSLIGRLAKAVMG--SRVNTAKRNLELCFPEMSASERQDLLNRNFEET
B1KE77_SHEWM          TQLLPLSAQMKIGAGLGRLAKKLLG--SRVHTAKRNLELCFPDMPQAEQEVLLNKNFEET
A3QAN2_SHELP          TQLLPLRAQMKLGQGIGRLAMAIAG--SRVNTAKCNIALCFPEMSQAEQQQLLTRNFEET
Q8EAZ1_SHEON          TQVLPLSWQMKLGKGMGRLVKALAA--SRTHTARCNLALCFPDMPETEREALLTRNFEET
Q07Y77_SHEFN          SLLLPLSWQMKIGRGIGRLVMKVAG--GRTHTAKRNIDLCFPDMSHADKQQLLERTFEET
A1S3I2_SHEAM          LSLLPLHWQMSLGKGLGQLVRILAG--SRSNTARRNLELCFPNMSDAERDALFKRNFEET
Q12RC8_SHEDO          TQVLPLHLQMKLGASLGRLVMRLAG--SRTRTAKRNISLCFPQMSAQEQQTLLVQNFEET
Q5QY19_IDILO          VSWLPYRLQLAMGRGLGLLFKKLMP--RRVNIARTNLKLCFPEYSNEKIETLLTENMKNT
Q47WI8_COLP3          ISWLPFKLQLFMGRMLGRLLMKIGS--KRKHVALTNLRLCFPDKSEDELQILLKKNFENT
F2G7H2_ALTMD          ITWLPLPVIRAIGGGTGKLIALIVP--KRAKVAKRNLALWNPSLNESDINALYKENIRRT
F5ZC15_ALTNA          ITWLPLPVIRFIGGGAGKLIAKIVP--KRVRVAKRNLELWNPSLSESEVQALLKENVRRT
Q15PT3_PSEA6          ISWLPYRLQTYVGKGLGKLLLVFAK--KRVNIAKRNLALCFPDYTPAARQKILDANLDNA
                          *       .   .           *      *.    *                  

Q8P5K2_XANCP          GVGLFEFARAWWGSIATIRPRMQIE--GLEHLQRLQEQKRGVLLVSGHFMTLEMCGRLLC
Q5H4E2_XANOR          GVGMFEFARAWWGSIDAIRPGVQIE--GLEHLQQLQQQKHGVLLVSGHFMTLEMCGRLLC
B2FTS8_STRMK          GVGVFECIRAWWGSIDSIRPQVQIE--GLEHLRQMQAEGRGVLLVSGHFMTLEMCGRLLC
Q87F59_XYLFT          GVGLFEFARAWWGSIDVIRAGIHVE--GLEHLRQLQREGRGVLLVSGHFMTLEICGRLLC
D2UC29_XANAP          GVGVFEFARAWWGSIAPMRCHARIE--GLEHLQRLQAQGRGVLLVSGHFMTLEICGRLLC
L0DTE2_THIND          GTGLLETVSGWWAPARRFDGHYTLE--GVEHLDRALERGHGALLLSAHFTTLEFCARILS
B8GL59_THISH          GFALFETTLSWWASDARLRKLVRLE--GLEHLEQALARGKGVLLLSAHFTTLELAGRLLT
B1ZVZ1_OPITP          ALGLFETCNAWWTDAVALPRH-RLI--GREHLERAIALGHGVIVLTSHVTTLEICGRIMT
I1XGS6_METNJ          GMMPIETAISWWASDKSLNKRVEYH--GLEHIQNALAKGKGVLLLTGHFTSMELGGRLIM
I1YIL6_METFJ          GMMPIETALSWWGSDEALAKRVDYH--GLQHLQEALAKGKGVLLLTGHFTSMELGGRLIL
A1WZG7_HALHL          GIGVVETAMGWWLPMERIAELFEVH--GQEHLEAARASDRGVLLLSCHMLGLELSAARVL
A0A0E1PUK9_ACIBA      MLGIFETLNAWYK-PYWFKNRVTIE--GLEHITNAQAQGKGVLLLGTHSTLLDAGGYVCA
B0V4M5_ACIBY          MLGIFETLNAWYK-PYWFKNRVTIE--GLEHITNAQAQGKGVLLLGTHSTLLDAGGYVCA
Q6FEU5_ACIAD          MLGIFETLNAWYC-PQWFKHRCTIE--GLEHITNAQKQGQGVLLLGTHSTLLDAGGYLCA
B0VAW3_ACIBY          MIGIFEALNAWYC-PAWFKKRVHIE--GLEHLNDN--RDRGILLLGTHSTLLDAGGAACT
A0A1E3M247_ACIBA      MIGIFEALNAWYC-PAWFKKRVHIE--GLEHLNDN--RDRGILLLGTHSTLLDAGGAACT
Q15SA3_PSEA6          GIGFFEIAWAWWAKPESLRKRFSVQ--GLEVLKAATTNNQGVLLIGGHYTHLDLAGMMVN
Q1QU83_CHRSD          GKGILETATGWCRDPEHLRHRVIFK--GEEHMMQALAQGKGALIIGVHFSTLDLGGALHS
E1V7Q4_HALED          GIGILETATGWCRDPEHLRHRVVFE--GQEHMARVQAEGKGALIIGIHFSTLDLGGALHS
A1TYS8_MARHV          GIGLLEIGIAWFRDPARLTGITQVH--GLEHFEQALAGGKGVLLLGGHYSTLDLGGSLVT
E4PMT5_MARAH          GIGLLELGIAWFRNPAKLTGITRVH--GLEHFEDALAGGRGVLLLGGHYSTLDLGGSLVT
B3PC27_CELJU          GLSFAETAMGLWGAKDKMRGRYELT--GLEHIENALAEGKGVLLMGSHLTTIDISGLIMS
Q0VM58_ALCBS          GEAILEMAGSFSNHRINLNNRLTIN--GLEHVRNAQAAGQGVLLLGMHFNSIDVGSRLLS
K0C8J3_ALCDB          GEALMEMAGSFHNRRIDLGQRLSVT--GLEHLEAARERGQGVLLLGMHFNSIDVGSRLLG
F6AIP4_PSEF1          GIAFFEMAMSWWWPRHKLARLAHIE--GIEHLQQAQAQGQGVILMAVHFTTLEIGAALLG
Q9HYZ8_PSEAE          GIAFFEMAMSWWWPKARLARLAHIE--GLEHLREAQAQGEGVILMALHFTTLEIGAALLG
W8R9K6_PSEST          GIAFFEMAMSWWWSRDRLQKLAQVK--GLEHLQQAQAEGQGVILMALHFTTLEIGAALLS
A4XRN5_PSEMY          GIAFFEMAMSWWWPKARLAKLAHVE--GLEHLQQAQAEGQGVILMAVHFTTLEIGAALLG
C1DQM3_AZOVD          GIAFFEMAISWWWPRRRLARLAHVE--GLEHLQRAQAEGRGVILMALHFTTLEIGAALLG
I7C4R3_PSEPT          GIAFFEMAMSWWWPKARLARLAHIE--GLEHLQAAQQAGQGAILMAVHFTTLEIGAALLG
Q88M40_PSEPK          GIAFFEMAMSWWWPKARLARLAHIE--GLEHLQAAQQAGQGAILMAVHFTTLEIGAALLG
C3K0D2_PSEFS          GIAFFEMAMSWWWSRQRLARLAHVE--GLEHLKQAQLDGKGVILMALHFTTLEIGAALLG
Q87YC9_PSESM          GIAFFEMAMSWWWSRSRLAKLAHVE--GLEHLQHAQQKGEGVILMALHFTTLEIGAALLG
C5BNW3_TERTT          GIGVFESGAAWFWPNFRLRRHFDVI--GLEHLKLAQSSGRGVLFMGIHFTPIEIGAACVN
Q21HE6_SACD2          GKGFFESGMAWFGPQWRLRRWYTIE--GLEHLQAAHDEGKGVLLLGIHFTTIEICAAFIN
LPXL_ECOLI            GMGLMETGMAWFWPDRRIARWTEV--IGMEHIRDVQAQKRGILLVGIHFLTLELGARQFG
Q32E85_SHIDS          GMGMMETGMAWFWPDRRIARWTEV--IGMEHIRDVQAQKRGILLVGIHFLTLELGARQFG
B7LFG5_ECO55          GMGLMETGMAWFWPDRRIARWTKV--IGMEHIRDVQAQKRGILLVGIHFLTLELGARQFG
A0A029IWM4_ECOLX      GMGLMETGMAWFWPDRRIARWTEV--IGMEHIRDVQAQKRGILLVGIHFLTLELGARQFG
D2TT60_CITRI          GMGLMETGMAWFWPDRRISRWTEV--IGMEHIRDVQAQQRGILLVGLHFLTLELGARQFG
A8AI25_CITK8          GMGVMETGMAWFWSDRRISRWTDV--SGVEHIRDVQARERGILLVGLHFLTLELGARQFG
A6T7D0_KLEP7          GMGLMETGMAWFWPVRRIARWTDT--IGFEHIRDVQAQQRGILLIGIHFLTLEMGARMFG
Q8ZQ24_SALTY          GMGVMETGMAWFWPDRRVNRWMEA--SGLEHIREVKAQGLGFILVGIHFLTLEFGARMFG
C9Y0W5_CROTZ          GMGLMETGMAWFWPDWRIARWMEA--SGLEPVKTLLAQKKGILLIGVHFLTLELGARMFG
A7ME71_CROS8          GMGLMETGMAWFWPNWRVERWTEV--SGVEPVKALLAQKQGILLIGVHFLTLELGARIFG
E3GC97_ENTLS          GMGLMETGMAWFWSNRRVARWSQT--QGIAPVKALLEQQQGILLIGVHFLTLELGARIFG
A0A6I4L5F5_9ENTR      GMGLMETGMAWFWPTHRVARWTET--SGVNEVVELLEQKQGILLIGIHFLTLEMGARMYG
I2BAG9_SHIBC          GMGVMETGMAWFWPDWRMKRWCDV--SGVNEIRALQAEKRGILLIGLHFLTLELGARIFG
A0A0H3CNJ6_ENTCC      GMGLMETGMAWFWPDKRMARWSVVAGTGMEPVHSLQANQTGVLLIGVHFLTLEIGARMFG
A4W967_ENT38          GMGLIETGMAWFWSDKRMARWFDVAGTGMEPVHQLQAQKTGVLLIGIHFLTLEIGARMFG
Q6D6A6_PECAS          GMGVVETGMAWFWPNWRLERWFTV--TGLEHILPENEREQGVLLIGLHFLTLELGARVFG
E0SHR8_DICD3          GMGVMETGMAWFWPDWRVERWFKV--TGIENIQPLREQKRGVLLIGLHFLTLELGARIFG
A0A0H3NW53_YERE1      GMGLFETGMAWFWPNWRIERWCSV--SGLEHIQKARDEGKGVLLIGLHFLTLELGARILG
A8GCZ7_SERP5          GMGLFETGMAWFWPNWRIERWFQV--SGLEHIQKARDNHQGVLLIGLHFLTLELGARIFG
H2IUW8_RAHAC          GMGLFETGMAWFWPDWRIERWFKV--SGLEHIQHARDNKQGVLLIGVHFLTLELGARIFG
D8MQP0_ERWBE          GMGLIETGMAWFWPNWRINKWFHV--SGLEHIDKAHEDGKGILLIGMHFLTLELGARIFG
B2VDK0_ERWT9          GMGLIETGMAWFWPEWRITKWFKV--SGLEHISKAAADQKGVLLIGMHFLTLELGARIFG
E6WDD9_PANSA          GMGLIETGIAWFWPDWRIRKWVNC--TGLEHIDSSLAAGRGILLIGMHFLTLELGARVFG
E1SJK3_PANVC          GMGLIETGMAWFWPDWRINKWHKP--SGLEHIQQARDSQRGVLLIGMHFLTLEIGARMFG
Q2NU53_SODGM          GMGLIETSIAWFWPDWRIKRWISV--SGLEHIAGARAENKGVLLIGMHFLTLELGARIFG
D3V2Q6_XENBS          GMGLVETGMAWFWPDWRIKRWFKI--TGEENLQKVLSSNQGFIVIGIHFLTLELGARILG
D3VC59_XENNA          GMGLFETGIAWFWPDWRIKRWFNV--TGRENIQKVQSEGKGIIVIGIHFLTLELGARIFG
Q7N5W5_PHOLL          GMGIFETGMAWFWPDWRIERWFKV--TGQENIQKIQTTGQGIIVIGIHFLTLELGARILG
B4EYY3_PROMH          GMGLFETGMAWFWPDWRVKRWFKI--SGRENIQKVQETGQGIIVVGIHFLTLELGARIFG
A0A140NRT4_PROSM      GMGVFETGMAWFWPEWRIRRWFKI--EGREHMIAAQSTGRGIIVLGIHFLTLELGARAFG
C5BHH1_EDWI9          GMALVETGMAWFWPDWRIRRWCRL--EGEENMRQAKQTGKGILLIGLHFLTLELGARIFG
A0A0H3CIG6_ENTCC      GMGVIETGIAWFWPDWRVRKCFSV--SGYEYMEEARARGNGVVLIGMHFLTLELGARIFG
Q7VR13_BLOFL          GMGIFETGMAWFWPEYRIKRWFTI--NGFKHIIQAKKQKTGILLLGMHFLTLELGARILG
LPXL_HAEIN            GMAIIETGMAWFWSDSRIKKWSKV--EGLHYLKENQKD--GIVLVGVHFLTLELGARIIG
E1W6J3_HAEP3          GMAIIETGMAWFWSDARIKKWSKI--EGLHYLKENAQD--GIIFVGVHFLTLELGARIVG
B0UT07_HISS2          GMAIIETGMAWFWSDKRIKKWSKI--EGLEYLKENQQD--GIILVGIHFLTLELGARIIG
Q9CME5_PASMU          GMAIIETGMAWFWSDARIKKWSKI--EGLEYLKEYKQD--GVILVGVHFLTLELGARIVG
A6VP05_ACTSZ          GMAIIETGMAWFWSDRRIRKWSKI--EGLEHLKNQGNN--GILFVGVHFLTLELGARIVG
B8F8K7_HAEPS          GMAIIETGMAWFWSDERILKWSKI--EGLEHLKNQPEGS-GIIFVGVHFLTLELGARIVG
A3N0R0_ACTP2          GMAIIETGMAWFWSDKRILKWSKI--EGLEHLKNQPQGA-GILLVGVHFLTLEMGARILG
Q7VM88_HAEDU          GMAIIETGMAWFWSDKRILKWSNI--EGLEHLQ-QPKGT-GILFVGVHFLTLELGARIVG
F4HAP4_GALAU          GMAIIETGMAWFWSDKRIKKWSKI--EGLDYLTNANSG---VILVGIHFLTLELGARILG
Q5DZN9_ALIF1          GLALIETGMAWFWPDWRVKRHISI--IGQEKMLEKEQEGKGVLVLCCHFLNLEMTARIFS
Q87LU9_VIBPA          GMALIETGIAWFWPDWRINRITSI--VGKDRLLTEEKNGRGVLVVCSHHLNLEITARIFS
Q5E8M9_ALIF1          GLAIFETAMAWVWPDWRVEKHFSY--ENKQHILDLAEEGRGVLVVCVHALNLELTARAFT
Q7MPT1_VIBVY          GLALFETGIAWFWPDWRIKRHVVF--GDTRELMELDANKKGVLVVCTHSLNLEITARAFS
A0A0Q2M6I7_VIBFU      GLALIETGITWFWPTWRFKRRIVE--KDLAVLREYKANGQGVLLCCVHALNLEITARAFA
Q87T91_VIBPA          GMALIETGITWFWPTWRFKTLIVE--KDIHALKEKGAEGKGVLLCCVHALNLEITARAFA
B7VHJ9_VIBA3          GMALVETGITWFWPTWRFKRILVD--KDTEVLRSHQANGKGVLLCCVHALNLEITARAMP
Q9KVD3_VIBCH          GAALIETGITWFWPTWRFKRILID--KDTQAIRQHAKTGQGVLLCCVHALNLEITARAFA
Q6LQJ6_PHOPR          GLALFESGMAWFWPDVRVNRHVDI--KGLEHMKKLEAEGKGALLVAVHSMNLELGARAFG
Q87NX3_VIBPA          GIALFETAMAWLWSDKRVSKHVTI--KGMEHLEALEKSGKGALMLAVHSMNLELGARAFG
Q6LFU9_PHOPR          GLALFETGMAWFWPDLRVQRHVEV--EGIEHIKKLQAKGKGVLLIAIHSMNLELGARAFG
A8GZ72_SHEPA          GLALFETGMAWFWSNARIAKHTSV--VGIEHIEKLKTEGRGALLIAVHSLNLELSGRAFG
A0A029HTZ1_ECOLX      GMALVETGMAWFWPDSRVRKWFDV--EGLDNLKRAQMQNRGVMVVGVHFMSLELGGRVMG
F4T1H6_ECOLX          GMALVETGMAWFWPDSRVRKWFDV--EGLDNLKRAQMQNRGVMVVGVHFMSLELGGRVMG
LPXP_ECOLI            GMALVETGMAWFWPDSRVRKWFDV--EGLDNLKRAQMQNRGVMVVGVHFMSLELGGRVMG
M7R9F1_SALDU          GMALLETGMAWFWPDNRVRKWFDV--DGLDNLTRAQAQNRGVMVVGVHFMSLELGGRVMG
Q8ZNA3_SALTY          GMALLETGMAWFWPDSRVRKWFDV--DGLDNLTRAQAQNRGVMVVGVHFMSLELGGRVMG
A9MII1_SALAR          GMALLETGMAWFWPDSRVRKWFDV--DGLDNLTRAQAQNRGVMVVGVHFMSLELGGRVMG
D2THV2_CITRI          GMALLETGMAWFWPDRRVRKWFDV--EGLDNLQRAQRQDRGVMVVGVHFMSLELGGRVMG
A8ADL6_CITK8          GMALIETGMAWFWPDKRVRKWFDV--DGLDNLTQAQAQKRGVMVVGVHFMSLELGGRVMG
A0A0H3CPL3_ENTCC      GMALLETGMAWFWPDERVRKWFDV--EGLENLKRAQMQNRGVMVVGVHFMSLELGGRVMG
A4WD01_ENT38          GMALLETGIAWFWPDERVRKWFDV--EGLENLKEVQAQNRGVMVIGVHFMSLELGGRVMG
A6T7M9_KLEP7          GMGLIETGMAWFWSDERVKKWFDV--EGFANLNHALSGGKGVMVVGVHFMSLELGGRAMG
B5XSE4_KLEP3          GMGLIETGMAWFWSDERVKKWFDV--EGFANLNHALSGGKGVMVVGVHFMSLELGGRAMG
E3G5Y9_ENTLS          GMGLIETGMAWFWSDARVKKWFDV--EGYDHLQCALAENKGVMVVGVHFMSLELGGRTMG
I2BA98_SHIBC          GMALLETGMAWFWSEKRLRRWFSV--DGLQNLADAQHNNRGVLVIGVHFMSLELGGRIMG
E6WBT8_PANSA          GMALAETGIAWFWSDRRVRQLFQV--SGMANLKSAQDHKRGVMVIGVHFMSLELGGRITG
E1SIU5_PANVC          GMALAETGIAWFWSDRAVKRLFKV--SGMDNLHAAQSEKRGVMLIGVHFMSLELGGRISG
A7MEL3_CROS8          GMALLETGMAWFWSDARIKKWFNV--EGLHHLHQASAQGRGVIVIGVHFMSLELGGRVMG
H2IUB8_RAHAC          GMGLLETGMAWFWSDARVKRWFDV--SGLHNLKKAQENKQGVLVIGVHFMSLELGGRAMG
A0A0H3FE86_RAHSY      GMGLLETGMAWFWSDARVKRWFDV--SGLHNLKKAQENKQGVLVIGVHFMSLELGGRAMG
A0A0U1QZM3_YERP3      GMGLLETGMAWFWSDTRIQRWFSV--SGLENLKRAQQGKRGVLVIGVHFMSLELGGRVMG
I3U7I4_ADVKW          GMGLMETGMAWFWSDERVKRWFDV--SGLDHLKQAQQDGRGALMIGVHLMPLELGGRAMG
A8GK79_SERP5          GMGLLETGMAWFWSDKRVKRWFNV--SGINHLKAAQQNQRGVLVIGVHFMSLELGGRAMG
D8MXQ9_ERWBE          GMGLLETGMAWFWSDRRVKRWFTV--EGLDNLKAAQVGGRGALIIGVHFMSLELGGRTMG
Q6D938_PECAS          GMALVETGMAWFWSDRRVRHWFDV--SGLEHLQHATAKGQGVMVIGIHFMSLELGGRAMG
E0SLT7_DICD3          GMALMETGMAWFWSDRRVRAWFEV--SGFENLQQAAREQRGVMVIGIHFMSLELGGRAMG
Q2NUW6_SODGM          GMGLMETGMAWFWPDARVKRWFDV--SGLQNLQQASRHDKGVMVIGIHFMSLELGGRAMG
C5B908_EDWI9          GISLFELGIAWFWSDRRIRRWFDV--SGLEHMQSARAKGKGVLAVGVHFMSLDLGGRVMG
B4ET77_PROMH          GIALFETGMAWFWSDNRLKNIYQV--DGITNFTEANRKHTGILLIGIHSMSLELGGRIMG
A0A140NJD6_PROSM      GIALFETGIAWFWSDKRIKKLFQV--KGISNYQEAIAKNKGVIIVGVHFMSLELGGRIMG
A1SRE1_PSYIN          GIAILEIGMAWFWPSWRVRGLLKV--SGLEHIEQARMHNQPIIFLGAHFLPLEMTGRATG
A4SIG5_AERS4          GCAIFEVGMAWFWPDWRMRNLMKV--EGEEHVIAAMEKGQGMLLLSCHFLTLELNARCFG
A0KPL5_AERHH          GCAIFEVGMAWFWPDWRMRNLMKV--EGEEHVIAAMEKGQGMLLLSCHFLTLELNARCFG
H2FVE0_OCESG          GCAVFETGMAWFWPHWRMSALTTM--EGTEHVDAAVAKGQGMLLLSAHFLTLELNARQFG
C4L9B3_TOLAT          GRAIFETGIAWFWPDRRIRKIMQV--VGAEHVEQAVANKQGMLLLSAHFMTLELNARMFG
D4ZFU0_SHEVD          GKAIFDTINAWWWSDAKVQSHMSI--KGQQHVENTLSDGHGVILFAVHCLPLEMGARVFG
B1KE77_SHEWM          GKAIFDTINAWWWSDDKIQRHMTI--KGQEHVEQTLKDGNGVILFAVHCLPLEMGARIFG
A3QAN2_SHELP          GKAIFDIANAWWWSDERIQRHMTI--KGREHVEQTLAAGQGVILFAVHCLPLEMGARIFG
Q8EAZ1_SHEON          GKAIFDTINAWWWSDEKIQQHMQI--TGKEYVQDTLNAGHGVILFAVHCLPLEMGARIFG
Q07Y77_SHEFN          GKAVFDTINAWWWSNERVQQHMTI--KGTEHVSQSLDNGKGVILFAVHCLPLEMGARIFG
A1S3I2_SHEAM          GKAVFDTICAWWWSDERVKQHMHI--KGTEHVEQTIAAGQGVILFAVHCLPLEMGARIFG
Q12RC8_SHEDO          GKALFDTINAWWWSDEKVQRHMQI--TGAEHITDILADGQGVILFAVHCLPLEMGGRMCG
Q5QY19_IDILO          GIAYFEVGMAWWWPSWRIKRKLHV--HGEEHLRQAQEDGSGVLLLLFHFLSLEVHARLHG
Q47WI8_COLP3          GIALFETGMGWWWPDWRVKRKFKV--KGLEHLEKARKEGNGVLLLAMHYLSVEMNARGVG
F2G7H2_ALTMD          GMALFETAMGWWWPSWRVKRAIEI--EGSEHVEAALASGKGVFGMALHNMNLEFACRGIG
F5ZC15_ALTNA          GMALFETAMGWWWPDWRVKRAIEI--EGAEHVEAAIASGKGVFGMALHNMNLEFACRGIG
Q15PT3_PSEA6          GMAILEASMGWWWPTWRIEKMSEF--VGYEHIDAILAKGKGVLAYAIHNMNLEFAVRVAG
                           :           .         .              .    *   ::       

Q8P5K2_XANCP          DHV-PLAGMYRKHRNPVFEWAVKRGRLRY--ATHMFANEDLRATIKHLKRGGFLWYAPDQ
Q5H4E2_XANOR          DHV-PLAGMYRRHRNPVFEWAVKRGRLRY--ATHMFANEDLRGTIKHLKRGGFLWYAPDQ
B2FTS8_STRMK          DYV-DLSGMYRKHKNPVYEWAVKFGRLRY--AKAMFANEDIRATVRHLKKGGFLWYAPDQ
Q87F59_XYLFT          DYV-PLAGMYRRHRNPVLEWAIKRGRLRY--ATQMFANEELRATIKHLKCGGFLWYAPDQ
D2UC29_XANAP          QHV-PLAGMYRRHRNPVFEWAVKRGRLRY--ASAMFANEDLRGSMRHLKRGGMLWYAPDQ
L0DTE2_THIND          LHR-PFAAMYRPNEQAVVDYLFKRNREHH--TLGAIERNDIKGLLRALKRNTPVWYAPDQ
B8GL59_THISH          QHH-RFAAMYRPHENPVIEKLFASNRNRH--CLQAIQRNDVKGLLRALKQNQAVWYAPDQ
B1ZVZ1_OPITP          ENF-KFGCLYRDPNNPVVAAAMRRQRERR--MTIAVHFDDLKGLIRALRAGHAIWYAPDQ
I1XGS6_METNJ          LKQ-PCYVMFRELKSPLFNAVMMHQRQRH--SEGIILQADMRGMLRALKKNNVVWYAPDQ
I1YIL6_METFJ          LKQ-PAYIMFRELKSPLFNAVMLKYRKYH--SEGTILQADMRGMLRALRKNKVVWYAPDQ
A1WZG7_HALHL          QIT-PFKALYREDRNPLVATLIRRNRRRR--IEDVISNQDMRGMIRALKDGDIIWYAPDE
A0A0E1PUK9_ACIBA      QYF-EPDVVYRPQNNPLLDMLIYRCRGTI--YKAQIDHDDMRGLIRHLKEGDAIWYSPDQ
B0V4M5_ACIBY          QYF-EPDVVYRPQNNPLLDMLIYRCRGTI--YKAQIDHDDMRGLIRHLKEGDAIWYSPDQ
Q6FEU5_ACIAD          QYF-EPDVVYRPQNNPLLDMLIYRCRATI--YKHQIDHDDMRGLIRKLKDGDAIWYSPDQ
B0VAW3_ACIBY          LFF-DMDVVYRPQNNPFMDFLIHRSRARV--YKNQIAKDNMRSLIEKLKNGHAIWYSPDQ
A0A1E3M247_ACIBA      LFF-DMDVVYRPQNNPFMDFLIHRSRARV--YKNQIAKDNMRSLIEKLKNGHAIWYSPDQ
Q15SA3_PSEA6          LVA-DMDVIYRKNNDPVFEYVITEGRKRV--FKNVFERSDMRAIIRSLREGRVVWFSPDQ
Q1QU83_CHRSD          LFF-PADVVYRAHDNPLFERFMTRARGRI--FGRAIDRHDLRDVVRRIKAGHAVWYSPDQ
E1V7Q4_HALED          LFF-PADVVYRPHDNALFERFMTRARNRI--FGTAIDRHDLRGVVRRIKTGHHVWYSPDQ
A1TYS8_MARHV          QFI-EADVMQRDHNNPLMNAVMTRARERR--YGTVLGARDLRGLFRSLKKNRAVWYATDQ
E4PMT5_MARAH          EFI-EADVMQRDHNNPLMNAVMTRARERR--YGTVLGARDLRGLFRSLKKNRAVWYATDQ
B3PC27_CELJU          YHI-KADVLYRSDPNPLMSYAIAKARSRV--NDDAIQRNDTRKLIKNLRMGHIVWYAPDQ
Q0VM58_ALCBS          CAF-DMNAVYRPNDNLVIDRLINKGRLNY--MKGIVKRTDIRHIVRLLRKGDIVWYAPDQ
K0C8J3_ALCDB          KFF-TFSAVYRPNDNPLLDHLITEGRGTW--IKHSVDRRDLRQTVRLLRQGEVVWYAPDQ
F6AIP4_PSEF1          QVH-TIDGMYREHGNPVFDFVQRRGRERHNLDATAIEREDVRAMIKVLRAGRAIWYAPDQ
Q9HYZ8_PSEAE          QVH-TIDGMYREHDNPVFDYVQRRGRERHNLDATAIEREDVRSMLKVLRGGRAIWYAPDQ
W8R9K6_PSEST          QLH-TIDGMYREHKNPVFDFVQRRGRERHNLDASAIEREDVRAMLKVLRAGRAIWYAPDQ
A4XRN5_PSEMY          QLH-TIDGMYREHKNPLFDFIQRRGRERHNLDATAIEREDIRAMLKVLRAGRAIWYAPDQ
C1DQM3_AZOVD          QRQ-TIDGMYREHDNPVFDYVQRCGRERHNADATAIEREDIRAMLKVLRAGRAIWYAPDQ
I7C4R3_PSEPT          QQH-TIDGMYREHGNALFDFIQRSGRERHNLDSLAVEREDVRGMLKLLRSGRAIWYAPDQ
Q88M40_PSEPK          QQH-TIDGMYREHGNALFDFIQRSGRERHNLDSLAVEREDVRGMLKLLRSGRAIWYAPDQ
C3K0D2_PSEFS          QKH-TIDGMYREHGNPLFDFVQRRGRERHNLDSLAVEREDVRGMLKLLRAGRAIWYAPDQ
Q87YC9_PSESM          QQH-TIDGMYREHKSPLFDFIQRRGRERHNLDSLAVERDDVRGMLKLLRAGRAIWYAPDQ
C5BNW3_TERTT          TVT-SIDGFYRPHKNAVYEYVQAVGRIWRNNKSDVIPNGDVRGIIKALRNGRAVNYAPDQ
Q21HE6_SACD2          QSY-SIDGFYRPHKNPVYEYVQRWGRVRHNPYSHTIPRSDVRGIIRNLRNKRAINYAPDQ
LPXL_ECOLI            MQE-PGIGVYRPNDNPLIDWLQTWGRLRSN--KSMLDRKDLKGMIKALKKGEVVWYAPDH
Q32E85_SHIDS          MQE-PGIGVYRPNDNPLIDWLQTWGRLRSN--KSMLDRKDLKGMIKALKKGEVVWYAPDH
B7LFG5_ECO55          MQE-PGIGVYRPNDNPLIDWLQTWGRLRSN--KSMLDRKDLKGMIKALKKGEVVWYAPDH
A0A029IWM4_ECOLX      MQE-PGIGVYRPNDNPLIDWLQTWGRLRSN--KSMLDRKDLKGMIKALKKGEVVWYAPDH
D2TT60_CITRI          LQE-PGIGVYRPNDNPLLDWLQTWGRMRSN--KSMLDRKDLKGMIKALKKGEVVWYAPDH
A8AI25_CITK8          LQQ-PGIGVYRPNDNPLLDWLQTWGRMRSN--KSMLDRKDLKGMIKALKKGEVVWYAPDH
A6T7D0_KLEP7          MNE-PGIGVYRPNDNPVIDWLQTWGRLRSN--KDMIDRKDLKGMIRALKKGEVVWYAPDH
Q8ZQ24_SALTY          MHN-PGIGVYRPNDNPLLDWLQTWGRLRSN--KSMLDRKDLKGMVKALKSGELIWYAPDH
C9Y0W5_CROTZ          MHT-PGIGVYRPNDNPLLDWLQTWGRLRSN--KTMLDRKDLKGMIKALKGGEIIWYAPDH
A7ME71_CROS8          MHT-PGIGVYRPNDNPLLDWLQTWGRLRSN--KTMLDRKDLKGMIKALKGGEIIWYAPDH
E3GC97_ENTLS          MST-PGIGVYRPNDNPLLDWLQTWGRLRSN--KTMLDRKDLKGMIRALKSGEIIWYAPDH
A0A6I4L5F5_9ENTR      MFT-PGIGVYRPNDNPLIDWLQTWGRLRSN--KTMLDRKNLKGMVRALKEGEILWYAPDH
I2BAG9_SHIBC          IHT-PGIGVYRPNDNPVIDWLQTWGRTRSN--KSMLDRKDLKGMIRALKNGEIIWYAPDH
A0A0H3CNJ6_ENTCC      MQA-PGIGVYRPNDNPVIDLIQTNGRMRSN--KSMIDRKDLKGMIRALKSGEVVWYAPDH
A4W967_ENT38          MQA-PGIGVYRPNDNPVIDLLQTWGRMRSN--KQMIDRKDLKGMIRALKNGEVLWYAPDH
Q6D6A6_PECAS          MHN-PGIGVYRPNDNKLIDWLQTWGRLRSN--KSMLDRKDLKGMIRALKQGDIIWYAPDH
E0SHR8_DICD3          LQN-AGIGVYRPNDNKLIDWLQTWGRMRSN--KSMLDRKDLKGMIRALKQGEIIWYAPDH
A0A0H3NW53_YERE1      IYN-PGIGVYRPHDNKAMDWMQTWGRMRSN--KAMLDRKDLKGMIRSLKQGEIIWYAPDH
A8GCZ7_SERP5          IHN-PGIGVYRPHDNKLMDWLQTWGRMRSN--KSMLDRKDVKGMIRALKQGDIIWYAPDH
H2IUW8_RAHAC          IHN-PGVGVYRPHDNKLMDWIQTKGRMRSN--KGMLDRKDLKGMIRSLKQGDIIWYAPDH
D8MQP0_ERWBE          IHN-PGIGVYRPNDNALLDWLQTWGRMRSN--KSMLDRKDLKGMIRALKSGDIIWYAPDH
B2VDK0_ERWT9          IHN-PGIGVYRPNDNALIDWLQTWGRMRSN--KSMLDRKDLKGMIRALKSGDIIWYAPDH
E6WDD9_PANSA          MNN-PGIGVYRPNDNKLIDWLQTWGRMRSN--KSMLDRKDLKGMIRAMKNNDIIWYAPDH
E1SJK3_PANVC          IHN-PGIGVYRPNDNKLIDWLQVKGRMRSN--KSMIDRKDLKGMIRALKNGDIIWYAPDH
Q2NU53_SODGM          MYN-PGIGVYRPNDNPLLDWLQTWGRMRSN--KSMLDRSDIKGMIRALKNGDIIWYAPDH
D3V2Q6_XENBS          LLN-PGIGVYRPNDNPVMDWLQTWGRLRSN--KYMLDRKDVKGMIRCLKNGEMVWYAPDH
D3VC59_XENNA          MLN-PGIGVYRPNDNPVVDWLQTWGRLRSN--KYMLDRKDVKEMIRCLKKGEIVWYAPDH
Q7N5W5_PHOLL          LLN-PGIGVYRPNDNPVMDWLQTWGRLRSN--KYMLDRKDVKGMIRCLKNGEIVWYAPDH
B4EYY3_PROMH          MLN-PGIGVYRPNDNPVMDWLQTWGRLRSN--KFMLDRKDVKGMIRNLKAGEILWYAPDH
A0A140NRT4_PROSM      MLN-PGIGVYRPNDNKLMDWLQTRGRLRSN--KYMLDRKDVKGMVRSLKQGEILWYAPDH
C5BHH1_EDWI9          MHN-PGVGVYRPNDNPVLDWLQTWGRLRSN--KYMLDRRDVKGMIRALKEGEIVWYAPDH
A0A0H3CIG6_ENTCC      MLN-PGVGVYRPNNNALLDWLQTRGRLRSN--KTMLDRYDLKGMIRALKQNDILWYAPDH
Q7VR13_BLOFL          ILN-PGIGVYRPNNNPLLDWIQTKGRLKSN--KKMINRTNIKSVVSALKNGEIIWYAPDH
LPXL_HAEIN            LHH-PGIGVYRPNDNPLLDWLQTQGRLRSN--KDMLDRKDLRGMIKALRHEETIWYAPDH
E1W6J3_HAEP3          LHH-PGIGVYRPNDNPVLDWLQIKGRLRSN--KDMLNRKDLRGMFKALRKGETIWYAPDH
B0UT07_HISS2          LSH-PGIGIYRPHDNPLMDWLQCRGRARSN--KGLLDRKDLRAMIKAIRHGEMIWYAPDH
Q9CME5_PASMU          LHQ-PGIGVYRPNDNPLMDWLQVQGRLRSN--KDLLDRKDLRGMIRALRQGEIIWYAPDH
A6VP05_ACTSZ          IHH-QGIGIYRPNDNPLFNWLQVRGRLRSN--KDMVDRKDLRRMVKALKHGETIWYAPDH
B8F8K7_HAEPS          LHH-QGIGVYRPNDNPLLDWIQFRGRVRSN--KAMLDRKDLRGMIKALRAGETIWYAPDH
A3N0R0_ACTP2          LHH-QGVGVYRPNDNPLLDWIQFRGRVRSN--KAMLDRKDLRGMIRALKAGETIWYAPDH
Q7VM88_HAEDU          LHH-QGIGVYRPNDNPLLNWIQFKGRIRSN--KAMLDRKDLRGMIRALRDGETIWYAPDH
F4HAP4_GALAU          LYH-QGIGVYRPNDNPLFDWLQTKGRVRSN--KSMLDRHNLRGMIRALRQGETIWYAPDH
Q5DZN9_ALIF1          LFA-PGYGVYRANSNPVYEFIQHRGRTRKG--HKMIDRHDVKSMIKVLKSGNRLWYLPDH
Q87LU9_VIBPA          QFA-KGYGVYRPNSNPAYEFIQHRGRTRFG--HQMIDRKDVKSMLKVLKNGHRLWYLPDH
Q5E8M9_ALIF1          SFA-PGYGVYRPHNNPAYDFIQHWGRTNNG--NQMIDRKDVKGMLRVLRKGERLWYMPDH
Q7MPT1_VIBVY          LFA-PGYGVYRPHDNPAYDFIQTWGRTRCG--NQMVDRKDVKGMLKILRGGGRLWYLPDH
A0A0Q2M6I7_VIBFU      VLGLPGYGAFRPHNNPAYNFIQYWGRTHNG--NVLIDRKDVKKMIRVMRQGELLFYLPDH
Q87T91_VIBPA          VLGVAGYGAFRPHNNPAYNFIQYWGRTHNG--NKLIDRKDVKKMIRVLRSGERLFYLPDH
B7VHJ9_VIBA3          ILGIPGLGVYRPHNNPAYEFIQYRGRTQNG--NRLVHRKDVKRMIRRLRQGETLFYLPDH
Q9KVD3_VIBCH          VLGIGGYGVYRPHSNPAYEFIQYRGRTRNG--NQLINRTDIKQMIRVLRQGERLFYLPDQ
Q6LQJ6_PHOPR          IKM-SGTGVYRPNGNPCYDFFQYRGRARSN--RTLIDRKDVKGMLRSLRRGERVWYAPDH
Q87NX3_VIBPA          IQK-SGTGVYRPNNNPCFDYFQYKGRSRSN--RTLIDRKNVKAMLEALNSGERVWYAPDH
Q6LFU9_PHOPR          LST-PGVGVYRPNNNPCFDYFQYKGRSRSN--KDMIDRKDVKGMLRALRKGELVWYAPDH
A8GZ72_SHEPA          QYA-QGMAVYRPNNNPCFDYFQLKGRSQGG--HTLIHRKNVKFMLEALNNGAFMWYAPDH
A0A029HTZ1_ECOLX      LCQ-PMMATYRPHNNQLMEWVQTRGRMRSN--KAMIGRNNLRGIVSALKKGEAVWFAPDQ
F4T1H6_ECOLX          LCQ-PMMATYRPHNNQLMEWVQTRGRMRSN--KAMIGRNNLRGIVSALKKGEAVWFAPDQ
LPXP_ECOLI            LCQ-PMMATYRPHNNQLMEWVQTRGRMRSN--KAMIGRNNLRGIVGALKKGEAVWFAPDQ
M7R9F1_SALDU          LCQ-PMMATYRPHNNPLMEWVQTRGRMRSN--KAMIGRNNLRGIVGALKKGEAVWFAPDQ
Q8ZNA3_SALTY          LCQ-PMMATYRPHNNPLMEWVQTRGRMRSN--KAMIGRNNLRGIVGALKKGEAVWFAPDQ
A9MII1_SALAR          LCQ-PMMATYRPHNNPLMEWVQTRGRMRSN--KAMIGRNNLRGIVGALKKGEAVWFAPDQ
D2THV2_CITRI          LCQ-PMMATYRPHNNPLMEWVQTRGRMRSN--KAMIGRNNLRGIVGALKKGEAVWFAPDQ
A8ADL6_CITK8          LCQ-PMMATYRPHNNSLMEWVQTRGRMRSN--KAMIGRNNLRGIVGALKKGEAVWFAPDQ
A0A0H3CPL3_ENTCC      LCQ-PMMATYRPHNSPLMEWVQTRGRMRSN--KAMISRNNLRGMVGALKKGEAVWFAPDQ
A4WD01_ENT38          LCQ-PMMATYRPHNNLLMEWVQTRGRLRSN--KAMISRNNLRGLVSALKKGEAVWFAPDQ
A6T7M9_KLEP7          LCR-PMMATYRPHNSPLMEWVQTRGRLRSN--KAMIDRNNLTGLVHALKSGEAVWFAPDQ
B5XSE4_KLEP3          LCR-PMMATYRPHNSPLMEWVQTRGRLRSN--KAMIDRNNLTGLVHALKSGEAVWFAPDQ
E3G5Y9_ENTLS          LCR-PMMATYRPHNSPLMEWVQTKGRLRSN--KAMIDRRNLRGLVHALKQGEAVWFAPDQ
I2BA98_SHIBC          ICK-PMMAVYRRHNSPLLEWAQTKGRMRSN--KGMIDRRHLKEMVNVLKQGEAVWFAPDQ
E6WBT8_PANSA          LCQ-PMMAMYRKHNNQAMEWAQTKGRMRSN--KAMIDRRDLRGMVQALKQGEAVWFAPDQ
E1SIU5_PANVC          LCQ-PMMAMYRPHNNQAMEYVQTKGRMRSN--KAMIDRRDLRGMVNALKQGESVWFAPDQ
A7MEL3_CROS8          LCK-PMMAMYRPHNNKAMEWAQTKGRMRSN--KAMIDRKDLKGMVNALKQGEAVWFAPDQ
H2IUB8_RAHAC          LCQ-PMMAMYRPHNNKAMEFVQTWGRMRSN--KAMLDRKDLRGMVHALKKGEAVWFAPDQ
A0A0H3FE86_RAHSY      LCQ-PMMAMYRPHNNKAMEFVQTWGRMRSN--KAMLDRKDLRGMVHALKKGEAVWFAPDQ
A0A0U1QZM3_YERP3      QCQ-PMMAMYRPHNNKVMELVQTWGRMRSN--KAMLDRRDLRGMVRALKQGEAVWFAPDQ
I3U7I4_ADVKW          LCQ-PMMATYRPHNNKAMEWAQTKGRMRSN--KAMLDRKDLRGLVRALKQGEAVWLAPDQ
A8GK79_SERP5          LCQ-PMMAMYRPHNNKAMEWAQTKGRMRSN--KAMLDRKDLRGMVQALKRGEAVWFAPDQ
D8MXQ9_ERWBE          LCQ-PMMAMYRPHNNKLMEWVQTKGRMRSN--KAMINRRDLRGMVNALKQGEAVWFAPDQ
Q6D938_PECAS          LCQ-PMMAMYRPHNNKAMEMVQTWGRSRSN--KAMIDRKDLRGMVQALKRGEAVWFAPDQ
E0SLT7_DICD3          LCQ-PMMAMYRRHNNKLMELVQTWGRSRSN--KAMIDRKDLRGMVQALKSGEAVWFAPDQ
Q2NUW6_SODGM          LCQ-PMMAMYRPHNNKVMEFIQTWGRMRSN--KAMLDRKDLRGMVHALKQGETVWFAPDQ
C5B908_EDWI9          LCN-PMMAVYRPHNNPVLEYLQTRGRSRGN--KQMLDRKNLKGIVGALKSGEAIWFAPDQ
B4ET77_PROMH          LCF-PVNAMYRPHNNKAMEFIQTRARCRSN--KGMIDRRNLKFMVTELKKGKAIWFAPDQ
A0A140NJD6_PROSM      LCF-PVNAMYRPHNNKAMEYIQTKGRCRSG--KGMIDRKNLRFMVQELKSGKAIWFAPDQ
A1SRE1_PSYIN          LQL-PSAAVYRKHRNPVLDSWFYWGRMREN--KAMLDRSDFKAMLRTLKGGTPLWYAPDH
A4SIG5_AERS4          LVR-PGVGVYRPNTNPVLEYAQYHGRCASN--KYLVDRMDVKGMIKALRNGDALWYAPDH
A0KPL5_AERHH          LVR-PGVGVYRPNTNPVLEYAQYHGRCASN--KYLVDRMDVKGMIKALRNGDALWYAPDH
H2FVE0_OCESG          LYR-PGVGVYRPNTNAVLEYAQVHGRCRSN--KYLVDRLDIKGMLKALRAGDALWYAPDH
C4L9B3_TOLAT          LLR-PGVGVYRPNTNPVLEYAQYHGRCKSN--KYLVNRDDVKGMIKTLRQGEALWYAPDH
D4ZFU0_SHEVD          QFQ-PGVGVYRPHNNAVMEYLQVKGRLRSN--KALVSKRDLRQMIRCLRSPDVIWYTADQ
B1KE77_SHEWM          QFQ-PGVGVYRPHNNPVMEYLQVKGRLRSN--KALVPKRDIRQMVRCLRSPDVIWYTADQ
A3QAN2_SHELP          QFQ-PGIGVYRPHNNPLMEYLQVKGRLRSN--KGLVPKRDLRQMVRSLRNPDVIWYTADQ
Q8EAZ1_SHEON          QFQ-PGVGVYRPHNNPVMEYLQVKGRLRSN--KALVPKRDLRQMVRCLRNPDVIWYTADQ
Q07Y77_SHEFN          QFA-PGIGVYRPHNNPVMEYLQVKGRLRSN--KGLVPKRDVRQMIRSLRSPDVIWYTADQ
A1S3I2_SHEAM          QFQ-PGVGVYRPHNNAVMEYLQVKGRLRSN--KGLVPKRDLRQMVRCLRNAEVIWYTADQ
Q12RC8_SHEDO          QFN-PSIGVYRPHNNPLMEYLQVKGRLRSN--KGLVSKRDLRQMVRSLRGPNAVWYTADQ
Q5QY19_IDILO          FVE-PAVGLYRPHNNAVMEFLQTRGRGRSN--KYMIQRRDVKAMMRSLTEGDIAGYLPDQ
Q47WI8_COLP3          YGH-PMVVFYRPHNNQLMEFFQFRGRGRSN--KYMLGKRDVKGLMKALRDGEACIYLPDQ
F2G7H2_ALTMD          FYH-PSIAFYRKHNNPLVDYLQYHGRNRSN--KYMIDKRNAKALLAALDDKELCLYLPDQ
F5ZC15_ALTNA          YFH-PSIAFYRKHNNPLVDYLQYHGRNRSN--KYMIDKRNAKALLMALEDKELCLYLPDQ
Q15PT3_PSEA6          LRN-PSVAFYRRHNNPLMEYMQYHGRNRSN--KYMIHKRDVRGLIQALNEGEVCFYLPDQ
                                *   .          *         .   .    .  :         .*.

Q8P5K2_XANCP          DMR-GKDTVFVPFFGHP-ASTITATHQLARLT-GCAVVPYFHRRE----GGSYVLKIAPP
Q5H4E2_XANOR          DMR-GKDTVFVPFFGHP-ASTITATHQLARLT-GCTVVPYFHRRE----GGRYILKIAPP
B2FTS8_STRMK          DMR-GKDTVFVPFFGHT-ASTITATHQLARMT-GCAVIPYFHRRE----GGKYFLKIGAP
Q87F59_XYLFT          DMR-GKETVFAPFFGMP-AATITATHQLARLT-GCAVVPYFHRRQ----GGNYVLKIAPP
D2UC29_XANAP          DMR-GKDTVFVPFFGVP-AATITATHQLARLT-GCAVVPFFHHRE----GGDYVLRIAPP
L0DTE2_THIND          SRS-GRQTELIPFFGIP-ASTQTATHRIARVS-RAPVLPFFGSRQS---DGRYRLTIHPP
B8GL59_THISH          GKG-GRNSVIAPFFGEP-ASTHTGTHRIARVS-GAPVVPFFGFREP---DGTYRLVIEPP
B1ZVZ1_OPITP          GKR-TKQTEILPFFGVP-AITNTATSKLAEMT-GAPVVPYFGRREP---DGAYTLTILPP
I1XGS6_METNJ          DFG-RRTSVFAKFFGVN-AATIPATARLAKMS-GAAVVPYVPRRLP---NGNYVIDIGPA
I1YIL6_METFJ          DFG-RRTSVFATFFGVK-AATIPATARIAKMS-GAAVVPYVPRRLA---NGRYQIDIGPA
A1WZG7_HALHL          NIAPRRGGIFVPFFGIQ-AATTPATARLAERT-GCIVLPYYPQRLA---GGRYRLVFEPP
A0A0E1PUK9_ACIBA      DFG-LKQGIMAPFFGVP-AATVTAHRRLLKIS-KAVAVPLYFYRHGDVQDPKYHILIEPA
B0V4M5_ACIBY          DFG-LKQGVMAPFFGVP-AATVTAHRRLLKIS-KAVAVPLYFYRHGDVQNPKYHILIEPA
Q6FEU5_ACIAD          DFG-LKQGVMAPFFGVP-AATVTAHRRLLKIS-KAAAVPLYFYRHGDVRDPKYHVLIEAA
B0VAW3_ACIBY          DFG-LKQGVMASFFGIQ-AATVTAHRRLMDIS-NAVAIPLYFYRSGDIRDPQYNVLVEPK
A0A1E3M247_ACIBA      DFG-LKQGVMASFFGIQ-AATVTAHRRLMDIS-NAVAIPLYFYRSGDIRDPQYNVLVEPK
Q15SA3_PSEA6          DHG-IKNSVFAPFFGIP-ATTVTSASKLMRLG-KAK--PVFVAHKRDLETNQYKITFAIP
Q1QU83_CHRSD          DFG-RDASVFAPFFGVQ-AATLKLTAKIARMT-GAPVMPLIFHRNP--GDASYTLEYLPA
E1V7Q4_HALED          DFG-REASVFAPFFGVE-AATIKLTAKIARMT-GAPVMPLIFHRNP--DDYTYRLEYLPA
A1TYS8_MARHV          DYG-RKDIVFAPFFGIP-AGTITATSRIAERS-GCKVVPFSHFRRD--GKPGYDIYFHPA
E4PMT5_MARAH          DYG-RKDIVFAPFFGIP-AGTITATSRIAERS-GCKVVPFSHFRRD--DGPGYDIYFHPV
B3PC27_CELJU          DYG-AKHSVFAPFFGIQ-AATVVATSRIAKLS-GAAVIPFFCYREA---KGRFRLVVQPP
Q0VM58_ALCBS          DYG-TAHAVFVPFFGVP-AATITATSRIARMG-KAAVIPCAHYRLP---GGRYEIEFGPA
K0C8J3_ALCDB          DYG-TEHAVFAPFFDVP-AATITATSRIARLG-KAAVIPCAHYRLP---GGRYKIEFGEP
F6AIP4_PSEF1          DYG-RKQSLFAPLFGIQ-AATVTATTKFARLG-RAIVLPFTQMRLP--DGGGYRLTIHPP
Q9HYZ8_PSEAE          DYG-AKQSLFVPLFGIP-AATVTATTKFARLG-RARVLPFTQSRLA--DGSGYRLTIHPP
W8R9K6_PSEST          DYG-RKQSLFVPWFGIS-AATVTATTKFARLG-KARVIPYTQERLA--DGSGYRLVIHPP
A4XRN5_PSEMY          DYG-RKQSIFVPLFGIP-AATVTATTKFARLG-KARVVPFTQQRLA--DGSGYRLVIHPP
C1DQM3_AZOVD          DYG-RKQSIFVPLFGIP-AATVTATTKFARLG-KALVMPFIQTRLA--DGSGYRLAVHPP
I7C4R3_PSEPT          DYG-AKQSIFVPLFGIP-AATVTATTKFARLG-KAQVIPFTQKRLE--DGSGYRLVIHPP
Q88M40_PSEPK          DYG-AKQSIFVPLFGIP-AATVTATTKFARLG-KAQVIPFTQKRLE--DGSGYRLVIHPP
C3K0D2_PSEFS          DYG-AKQSIFVPLFGIQ-AATVTATSKFARLG-KALVVPFTQERLA--DGSGYRLVIHPP
Q87YC9_PSESM          DYG-AKQSVFVPLFGIQ-AATVTATSKFARLG-RAQVVPFTQQRLA--DGSGYRLVIHPP
C5BNW3_TERTT          DYG-RRRSVFAPFFGIA-AATVKAPAQLARAG-NAEIVPWVTRRLK--N-RRYEIEIYPP
Q21HE6_SACD2          DYG-KKHSVFAPFFGIP-AATVTAPSQLIRVG-KAKAIPYVTGRHS--DDSGYYIRFYPP
LPXL_ECOLI            DYGP-RSSVFVPLFAVEQAATTTGTWMLARMS-GACLVPFVPRRKPDGK--GYQLIMLPP
Q32E85_SHIDS          DYGP-RSSVFVPLFAVEQAATTTGTWMLARMS-GACLVPFVPRRKPDGK--GYQLIMLPP
B7LFG5_ECO55          DYGP-RSSVFVPLFAVEQAATTTGTWMLARMS-GACLVPFVPRRKPDGK--GYQLIMLPP
A0A029IWM4_ECOLX      DYGP-RSSVFVPLFAVEQAATTTGTWMLARMS-GACLVPFVPRRKPDGK--GYQLIILPP
D2TT60_CITRI          DYGP-RASVFVPLFAVEQAATTSGTWMLSKMS-NACLVPFVPRRKPDGT--GYQLIMLPP
A8AI25_CITK8          DYGP-RASVFVPLFAVEQAATTSGTWMLSRMS-NACLVPFVPRRKPDGK--GYELILLPP
A6T7D0_KLEP7          DYGP-TASVFAPLFAVDQAATTSGTWMLAKMS-KACIVPFVPRRKPDGK--GYELIILPP
Q8ZQ24_SALTY          DYGP-RASVFVPLFAVDQAATTSGTWMLARMS-KACIIPFVPRRKPDGK--GYELIILPA
C9Y0W5_CROTZ          DYGP-RNSVFVPLFAVDKAATTSGTWMLEKMS-KASIVPFVPRRKADGS--GYELIVLEP
A7ME71_CROS8          DYGP-RNSVFVPFFAVDQAATTSGTWMLAKMS-KACIVPFVPRRKADGS--GYELIALEP
E3GC97_ENTLS          DYGP-RNSVFVPFFAVEQAATTSGTWMLEKMS-KAHVVPFVPRRKPDGQ--GYDLIVLPP
A0A6I4L5F5_9ENTR      DYGP-ASSVFAPLFAVEQAATTTGTWMLAKMS-GATIVPFVPRRKPNGM--GYELISLTP
I2BAG9_SHIBC          DYGP-RNSVFAPLFAVEQAATTPGTWMLAKTT-KASIVPFVPRRKPDGK--GYELIILPP
A0A0H3CNJ6_ENTCC      DYGP-QSSVFVPFFAVDEAATTTGTWMLARMS-KAAIVPFVPRRKPDGS--GYELIMLEP
A4W967_ENT38          DYGR-RSSVFVPFFAVDQAATTTGTWMLAKMS-KAAVVPFVPRRKPDGK--GYELIMLEP
Q6D6A6_PECAS          DYGP-RSSVFAPLFAVDTAATTRGSYMLIKTA-RPAIIPFVPRRLPEGK--GYELLIQPA
E0SHR8_DICD3          DYGP-RSSVFVPLFAVEKTATTVGSYMLARAA-KPAIVPFVPRRLPDAR--GYELIIQPA
A0A0H3NW53_YERE1      DYGP-RSSVFVPLFAVDQAATTTGTYLLVRMA-KPAIIPFTPRRLPDGK--GYQLLLQPA
A8GCZ7_SERP5          DYGP-RSSVFAPLFAVEKAATTTGSYVLVRMG-KPAIIPFTPRRLPDAK--GYELIMQPA
H2IUW8_RAHAC          DYGP-RASVFVPFFAVDKAATTTGTYLLARMG-KPAIIPFTPRRLPKGE--GYEMIIHPQ
D8MQP0_ERWBE          DYGP-KSSVFVPFFGVDKAASTKGSYVLIRSG-HPAVIPFVPRRLPHGK--GYEMVILPE
B2VDK0_ERWT9          DYGP-KSSVFVPFFAVDQAASTKGSYLLIRSG-KPAVIPFVPRRLPAGK--GYEMVILPE
E6WDD9_PANSA          DYGP-RSSVFAPFFAVEDAATTTGTHMLIRLG-NPSVVPFLARRLPHGR--GYELKILPD
E1SJK3_PANVC          DYGP-RSSVFVPFFAVEKAATTVGTHLLIRTG-KPAVIPFVPRRLPGGR--GYELMILPD
Q2NU53_SODGM          DYGP-KSSVFAPLFAVPQAATTAGTYLLAKTA-KPAVIPFMPRRLPQGR--GYELLILPD
D3V2Q6_XENBS          DYGP-RKSVFAPLFAVEHAATTMGTSILVRLS-DPALLPFTPRRLPDGK--GYELMIQPA
D3VC59_XENNA          DYGP-RNSVFAPLFAVEHAATTTGTSILVRLS-NPALIPFTPRRLPDGK--GYELIIQPA
Q7N5W5_PHOLL          DYGP-RKSVFAPLFAVEHAATTTGTSILVRLA-DPAMIPFTPRRLPDGK--GYELIIQPT
B4EYY3_PROMH          DYGP-RKSVFAPLFAVDKAATTTGTYILVKTS-HPALIPFTPKRLPEAK--GYELIISPA
A0A140NRT4_PROSM      DYGP-RNSSFAPLFAVKNAATTNGSAILLRLA-NPLIVPFIPRRLPAGK--GYELVIQPA
C5BHH1_EDWI9          DYGP-RSSVFVPLFAVAQAATTTGTYILARMG-KPTILPFMPLRNADGS--GYTLHIQPM
A0A0H3CIG6_ENTCC      DYGK-TNSVFVPFFAVPDAATTAGSYMLVKSA-RPAVIPFVPRRKADGS--GYELIILED
Q7VR13_BLOFL          DYGY-KNSVFVPLFNVPNAASTIGTYILTKIA-KPAVIPFIPRRLPKAL--GYELLIFPN
LPXL_HAEIN            DYGR-KNAVFVPFFAVPDTCTTTGSYYLLKSSQNSKVIPFAPLRNKDGS--GYTVSISAP
E1W6J3_HAEP3          DYGR-KNAVFVPFFAVKEAATTTGSYYLLKSAPNCKVVPFAPLRNKDGS--GYTVSISPP
B0UT07_HISS2          DYGR-KNAVFVPFFAVPEAATTTGSYYLIKSSPKSKVIPFTPLRNKDNS--GYTLNISAP
Q9CME5_PASMU          DYGR-KNAVFVPFFAVPDAATTTGSYYLLKSSPTSKVIPFAPLRNSDGS--GYTVKISPP
A6VP05_ACTSZ          DYGR-KNSVFVPFFAVQDAATTSGSYFLLHAVPNAKVVPFAPLRNADGS--GYTVSISPA
B8F8K7_HAEPS          DYGR-KNSVFVPFFAVKEACTTAGTRMLLRSAPNSIVVPFTPMRNDDFS--GYTVKIRPA
A3N0R0_ACTP2          DYGR-KNSVFVPFFAVNEACTTAGTRMLLRSAPNTVVVPFSPIRNDDFS--GYTVKVSPA
Q7VM88_HAEDU          DYGQ-QNSVFVPFFAVEQACTTAGSHMLLRSAPNSIVVPFTPIRHYDFS--GYTVKISPA
F4HAP4_GALAU          DYGR-KSAVFVPFFAVKNAATTTGTAFLKRSVPQSLVIPFAPLRNKDGS--GYTISISAP
Q5DZN9_ALIF1          DYGR-RNSVFVPFFAVQEAATTTGSSFLIDMT-KCAVMSGTSIR-TDN---HYTLEIGDD
Q87LU9_VIBPA          DYGA-SHSVFAPFFAVEQAASTVGSSVLIDAT-KCAVISGVTVS-RNH---HYTLYIGKD
Q5E8M9_ALIF1          DYNR-NKSVFVPFFAVPDACTTVGSDILISAS-KCAVVTASGFR-TYN---NYHLQIDND
Q7MPT1_VIBVY          DYGN-NHAVFVPFFAVPDACTTAGTGVLVDAS-KCAVITASSFR-KGE---TYTLEIDPD
A0A0Q2M6I7_VIBFU      DYGR-NKSVFVPFFAVQDACTTTGTSILAYTS-HCAIVMGSGFR-NDEG--KYELLADIA
Q87T91_VIBPA          DYGR-NKSVFVPFFAIDDACTTTGTSILAYTS-KCTIIPGSGFR-NDEG--KYEIIADKC
B7VHJ9_VIBA3          DYGR-NKSVFVPFFAVEDASTTTGTSILAYTS-RCAVVIGSGFR-NADG--KYEIMADES
Q9KVD3_VIBCH          DYGH-NKSVFVPFFAVEEACTTTGTSILAYTS-HCAIVIGSGFR-NAQG--RYEIMADKS
Q6LQJ6_PHOPR          DYGR-RRSTFAPLFAVDNACTTTGTSLLVDAT-DCAVVPFTMVRDSASG--KYTLTMYPP
Q87NX3_VIBPA          DYGN-RRSTFAPLFAVKNACTTTGTSLLVDNT-NCAIVPFTMVR-GEDG--HYTLTIDAP
Q6LFU9_PHOPR          DYGR-RRSTFAPLFAVENACTTTGTSLLVDAS-DCAAVPFAMIRNTDSG--KYTLKIFPP
A8GZ72_SHEPA          DYGR-RRSTFAPLFAVENACTTTGTSLLADNT-NCAIVPVVFVRDNDSG--HYTLTIKEP
A0A029HTZ1_ECOLX      DYGR-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKADY--SGYRLYITPE
F4T1H6_ECOLX          DYGR-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKADY--SGYRLYITPE
LPXP_ECOLI            DYGR-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKADY--SGYRLFITPE
M7R9F1_SALDU          DYGP-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKSDN--SGYRLYITPE
Q8ZNA3_SALTY          DYGP-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKSDN--SGYRLYITPE
A9MII1_SALAR          DYGP-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKTDN--SGYRLYITPE
D2THV2_CITRI          DYGP-KGSSFAPFFAVENVATTNGTYVLSRLS-GAAMLTVTMVRKANN--RGYRLYITPE
A8ADL6_CITK8          DYGR-KGSSFAPFFAVKDVATTNGTYVLSRLS-GAAMLTVTMIRKGDN--SGYRLYITPE
A0A0H3CPL3_ENTCC      DYGR-KGSSFAPFFAVKNVATTNGTFVISRLS-GAAMLTVTMVRKVDK--SGYRLHISPE
A4WD01_ENT38          DYGR-KGSSFAPFFAVENVATTNGTFVISRLS-GAPMLTVTMIRKADN--SGYRLFISPE
A6T7M9_KLEP7          DYGP-KGSVFAPFFSVPQAATTNGTYVLSRLS-GAKMLSISMVRKLDR--RGYSLHISEV
B5XSE4_KLEP3          DYGP-KGSVFAPFFSVPQAATTNGTYVLSRLS-GAKMLSISMVRKLDR--QGYSLHISEV
E3G5Y9_ENTLS          DYGR-KGSVFAPFFSVSSAATTDGTRILSRLS-GAKLLTVTMVRKSDR--SGYRLHISDV
I2BA98_SHIBC          DYGP-KGSCFAPFFAVPNAATTNGTYVLSRLS-HAAMLTITMVRKTGN--KGYQLVIEPE
E6WBT8_PANSA          DYGP-KGSVFAPLFAVEKAATTNGTFVLSRLA-RPAMLTIVLIRNPQK--NGYQLIIQPE
E1SIU5_PANVC          DYGP-KGSTFAPLFAVEKAATTNGTFVLSRLA-KPAMVPIMLIRNADN--EGYHLIIEPM
A7MEL3_CROS8          DYGP-RGSTFAPLFAVNDAATTRGTYVLSRLS-NAAMLTIVMIRNPDA--SGYKLIIQPE
H2IUB8_RAHAC          DYGP-RGSVFAPLFAVDQAATTSGTFMLARLA-KPALVTVVLVRKAGG--TGYELVIQPQ
A0A0H3FE86_RAHSY      DYGP-RGSVFAPLFAVDQAATTSGTFMLARLA-KPALVTVVLVRKAGG--TGYELVIQPQ
A0A0U1QZM3_YERP3      DYGP-RGSVFAPLFAVEHAATTSGTFMLARLA-KPALLPLVLLRKKEG--RGYDLLIQPA
I3U7I4_ADVKW          DYGR-SGSVFAPLFAVAQVATTSAPYMLARLA-KPALVPVVLIRRPNA--GGYDLLIQPE
A8GK79_SERP5          DYGP-RGSVFAPLFAVDQAATTSGTYMLARMA-KPALVPVVLIRREKG--RGYDLLIQPA
D8MXQ9_ERWBE          DYGP-KGSVFAPLFAVPQAATTSGTWMIARMA-KPAMLTVVLIRNDDG--SGYKLVIQPE
Q6D938_PECAS          DYGP-KGSVFAPFFAVKNAATTSGTYTISRLA-KPAMMTTVLIRKPDA--LGYQLVIQPE
E0SLT7_DICD3          DYGP-KGSVFAPFFAVEQAATTCGTSTIHRLA-KPAMITTVLIRKPNR--QGYQLVIEPE
Q2NUW6_SODGM          DYGP-RGSIFAPFFAVPQAATTRGTYTLVRLA-QPQLVPVVLIRKQDG--RGYQLLIQPP
C5B908_EDWI9          DYGP-RGSSFAPFFAVSSAATTNGTATLARLS-NAVILTTVLIRKPGA--QGYQLIIEPE
B4ET77_PROMH          DFGL-KGTTFSPFFSVKETSTSKGAVILAKLS-GAPSLTVTLVRNHGHDNKKYSLIIGKE
A0A140NJD6_PROSM      DFGR-KGTVFAPFFSVKNTSTSKGTSTLAQLS-HSPTLTVTLLRNRNG--ISYDLVLGKE
A1SRE1_PSYIN          DYGRHKSSVFAPFFTVQNTNTISGTSTLARLS-KGCVIPAFLKRLPGLQ--GYELVFYPK
A4SIG5_AERS4          DYGS-HASVFVPYFAVEQAATITGTATLARVK-NTVTLPCYNIRTKEG----YVLHIGAP
A0KPL5_AERHH          DYGS-HASVFVPYFAVEQAATITGTATLARVK-NTVTLPCYNIRTSEG----YTLHIGAP
H2FVE0_OCESG          DYGR-HASVFVPFFAVDKAATITGTATLARVK-NTVTLPCFTLREKNG----YRLVIQAP
C4L9B3_TOLAT          DYGP-HASVFVPFLGVSDAATITGTATLARVK-NTVVLPCYNIRLPQGG---YQLIIEPP
D4ZFU0_SHEVD          DFGR-SSATFIPFFAMQEAATITGATTLARLG-KAKVLPFSVVRNADDK--GYTIEIMPA
B1KE77_SHEWM          DFGR-SSATFIPFFAMPDAATITGATTLARLG-KAKVLPFSVERNTDDK--GYTIEIMAP
A3QAN2_SHELP          DFGR-SSAVFIPFFAVPEAATITGATTLAKLG-KAKVLPFIVVRNEDDK--GYTIEIQAP
Q8EAZ1_SHEON          DFGR-SSAVFIPFYAVPDAATITGATTLAKLG-KAKVLPFFVERTEGDT--GYRIEIMPP
Q07Y77_SHEFN          DFGR-SSAVFIPFFGVPDAATITGATSLARLG-KANVVPFFVERNSDDK--GYTLEIMPP
A1S3I2_SHEAM          DFGR-SSAVFIPFFAVPDAATITGATTLAKLG-KARVLPFFVERNADDK--GYSIEILPP
Q12RC8_SHEDO          DFGR-SSAVFIPFYAVPEAATITGATTLAKLG-KAKVLPFFVERNQDDT--GYRIEVMPA
Q5QY19_IDILO          DYGR-RRVEFVKFFAVPDASTTLGTMLFARNP-NCKVMVSRCVRRDDGS--GYDLFYEPP
Q47WI8_COLP3          DYGR-NRSVFVPFFGVKEAATTTGTLIFARQK-NVETMMIIPVRNDDGS--GYTLEIMPP
F2G7H2_ALTMD          DYGP-KQSIFVPFGGVKDTATTTATLMFIRRS-HSEPMIITSQYT--KR--GYKIKIYPP
F5ZC15_ALTNA          DYGP-KQSVFVPFGGVAETATTTATLMFIRRS-TSVPMMITSQYT--AK--GYKIKIYPP
Q15PT3_PSEA6          DYGR-TKCEFAPFFAVEHTATTTGSLLFAKEA-NCETVFLAPIKT--AS--GYKIKVVPG
                      .        :        . :      :                        : :     

Q8P5K2_XANCP          -LADIPSDDVIADTTQVNAAIEDMVREAPDQYLWIHRRFKRQP-GGRSDFYR--------
Q5H4E2_XANOR          -LADIPSDDVIADTTQVNAAIEDMVREAPDQYLWIHRRFKRQP-GGRSEFYR--------
B2FTS8_STRMK          -LENFPSDDVEADTTRVNQAIEEMVREAPDQYLWIHRRFKRQP-GGRSDFYK--------
Q87F59_XYLFT          -LADFPSKDLAADTARINQVIETMIDEAPDQYLWIHRRFKRQP-EGHSRFYN--------
D2UC29_XANAP          -LDNFPSTDIVADTARINAAIEAMVRAAPAQYLWIHRRFKRQP-DGRSSVYTRD------
L0DTE2_THIND          -LADFPSDDPIADTTRINQVIERAVLEAPEQYFWSHRRFKAR--KGLPDPYT--------
B8GL59_THISH          -LENFPTDDVLADTTQINRVIEAAVRKAPDQYFWAHRRFKKR--KGMPDPYLAPPSHRRK
B1ZVZ1_OPITP          -LESFPSADPAADAVRINQLIEQQIRLAPEQYLWVHKRFKARG-PGYPEVY---------
I1XGS6_METNJ          -WENYPIGDELADAQRVNDWVEAEIKKRRHSTYGYIGDLKPSQ-RAKGYSIKSSGANDRM
I1YIL6_METFJ          -LDNFPSDDELADAQRINDWVEQQVKLAPEQYLWVHRRFKTQP-EGRGQLYK--------
A1WZG7_HALHL          -LEDFPSGDIHADTARINRLIEQWIRQQPEQYFWVRKRFKSRP-EGEPPRY---------
A0A0E1PUK9_ACIBA      -VDNMPSEDEVDDATRVNKIIENQLRIAPTQYMWFHRRFKTRP-EGYEEIY---------
B0V4M5_ACIBY          -VDNMPSEDEVDDATRVNKIIENQLRIAPTQYMWFHRRFKTRP-EGYEEIY---------
Q6FEU5_ACIAD          -VENMPSEDEVDDATRVNQIIEKQLRIAPTQYMWFHRRFKTRP-EGYEEIY---------
B0VAW3_ACIBY          -LENFPSECEVNDAERVNQIIENQIRIAPTQYMWFHRRFKTRP-AGEAKFY---------
A0A1E3M247_ACIBA      -LENFPSECEVNDAERVNKIIENQIRIAPTQYMWFHRRFKTRP-AGEAKFY---------
Q15SA3_PSEA6          -EAEFPSGDDVQDATIINQMIESAIREQPDQYMWVHRRFKTRP-PGVPSVY---------
Q1QU83_CHRSD          -LENFPSGDDVADATRINGLIEDAIRRHPEQYLWLHRRFKTRP-RGEPSLYSR-------
E1V7Q4_HALED          -LEDFPSGDDVADAARINAVIEAAIRRHPEQYLWLHRRFKTRP-EGEPKLYDV-------
A1TYS8_MARHV          -LDNFPSGDDQEDATRINAIIEREIRKAPDQYLWMHRRFKTRPDRDDPGFYGRKRKD---
E4PMT5_MARAH          -LENFPSGDDLQDATLINQTIEREVRRAPDQYLWMHRRFKTRPDENDPGFYKRR------
B3PC27_CELJU          -LDNFPSGDDVADATRVNRILEDAIRVAPDQYLWVHRRFKTRP-EGEPGFYPHKKRSRRR
Q0VM58_ALCBS          -LEDFPSGDDKADTARVNSTIEHYVRKHPEQYLWVHKRFKHQK--NGQSPYK--------
K0C8J3_ALCDB          -LPDFPSGDDEADSALINRTIEHYVRKHPEQYLWVHKRFKHQP--DSISPYI--------
F6AIP4_PSEF1          -LSDFPGENEEADCLRVNQWVEQAIVTCPEQYLWAHRRFKTRP-EGEPKLY---------
Q9HYZ8_PSEAE          -LEDFPGESEEADCLRINQWVERCVRQQPEQYLWAHRRFKTRP-PGEAKLYPKRRKR---
W8R9K6_PSEST          -LADFPGESEEADCLRINEWVEDAVRQHPEQYLWAHRRFKTRP-PGEPSLYRKLPKKKAG
A4XRN5_PSEMY          -LADFPGESEEADCLRINQWIEQVVSACPEQYLWAHRRFKTRP-EGEPKLYGKRK-----
C1DQM3_AZOVD          -LEDFPGESEEADCLRINRWVEQAVRRQPEQYLWAHRRFKSRP-DGEPGLY---------
I7C4R3_PSEPT          -LTDFPGESEEADCLRINQWVERVLRECPEQYLWAHRRFKSRP-EGAPRLYDKKKR----
Q88M40_PSEPK          -LTDFPGESEEADCLRINQWVESVLRECPEQYLWAHRRFKSRP-EGSPRLYDKKKR----
C3K0D2_PSEFS          -LTDFPGESDEVDCLRINQWVEASVRECPEQYLWTHRRFKSRP-PGEAKLYEKRR-----
Q87YC9_PSESM          -LKDFPGESDEADCLRINQWVERAITECPEQYLWAHRRFKSRP-AGEPKLYKKHK-----
C5BNW3_TERTT          -ITAELTGDEAQDAAVINRFIEARVREIPEQYLWVHRRFKTRP-EGEPSIYS--------
Q21HE6_SACD2          -MDELGQGDEQADAELINAFVEREVRRNPGQYLWSHRRFKTRP-DGEKDFYRVEHMPWKQ
LPXL_ECOLI            ECS-PPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPEG-VPSRY---------
Q32E85_SHIDS          ECS-PPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTHPEG-VPSRY---------
B7LFG5_ECO55          ECS-PPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPEG-VPSRY---------
A0A029IWM4_ECOLX      ECS-PPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPEG-VPSRY---------
D2TT60_CITRI          ECS-PPLENAEITAAWMNKIVEKCIMMAPEQYMWLHRRFKTRPEG-VPSRY---------
A8AI25_CITK8          ECS-PPLDDAETTAAWMNTIVEKCIMMAPEQYMWLHRRFKTRPEG-MPSRY---------
A6T7D0_KLEP7          ECS-PPLDDAETTAAWMNKIVEQCIMMAPEQYMWLHRRFKTRPEG-MPSRY---------
Q8ZQ24_SALTY          EYS-PPLESAEATAAWMNKIVEQCIMMAPEQYMWLHRRFKTRPEG-VPSRY---------
C9Y0W5_CROTZ          ECS-PPIDSAEETAAWMNKIIEKCILMAPDQYMWLHRRFKTRPEG-VPSRY---------
A7ME71_CROS8          ECA-PPLGSAEETAAWMNSIVEKCILMAPDQYMWLHRRFKTRPEG-VPSRY---------
E3GC97_ENTLS          EDN-PPLESAEATAAWMNKIVEKCILMAPEQYMWLHRRFKTCPDG-VPSRY---------
A0A6I4L5F5_9ENTR      ERT-PPLASAEVTAAWMNQIIEQCILMAPEQYMWLHRRFKTRPEG-VPPRY---------
I2BAG9_SHIBC          ENN-PPLGSPEETAAWMNKIVEKCIMMAPEQYMWLHRRFKTRPEG-APSLY---------
A0A0H3CNJ6_ENTCC      ELA-PPLDDAETTARWMNGIVEKCIMLAPEQYMWLHRRFKTRPEG-TPSRY---------
A4W967_ENT38          EYS-PPIHDAETTARWMNGVIEKCIMLAPEQYMWLHRRFKTRPEG-MPSRY---------
Q6D6A6_PECAS          EQG-APVDNEAVTAAWMNKVVENNILLAPDQYMWLHRRFKTRPEG-EPSFY---------
E0SHR8_DICD3          QLD-VPLESEEVTAAWMNKLVEENILLAPDQYMWLHRRFKTRPTG-EPSLY---------
A0A0H3NW53_YERE1      VDN-FPLDNEVEAAAFMNKVVEKEIERATDQYMWLHRRFKTRPEG-APSLYD--------
A8GCZ7_SERP5          VEN-FPLDNELDAAAFMNKVVEKEILMAPDQYMWLHRRFKTRPEG-EPSLY---------
H2IUW8_RAHAC          VAD-FPLDDEVVAAAYMNKVVENEICQAPEQYMWLHRRFKTRPQG-EPSLYKPLSD----
D8MQP0_ERWBE          EKD-MPLDDEAATAARMNQVIERGVLMAPEQYMWLHRRFKTRPAG-ESSLY---------
B2VDK0_ERWT9          EQA-IPLNDEAATAARMNNIVEQGVLMAPDQYMWLHRRFKTRPEG-QPALY---------
E6WDD9_PANSA          IRDKFSLENELDTAICMNKVVEETVLLAPEQYMWLHRRFKTRPEG-QPSRY---------
E1SJK3_PANVC          ISAEFTLESDEVTAARMNKVVEEGVLLAPEQYMWLHRRFKTRPEG-EPSRY---------
Q2NU53_SODGM          ERD-MPLDSDIAAASYMNKVVEQAILQAPDQYMWLHRRFKTRPPG-EPSLYR--------
D3V2Q6_XENBS          VEG-FPKNDEVEAAAFMNKVVEREIMQAPDQYMWLHRRFKTRPEG-MPSLYDDNKNIH--
D3VC59_XENNA          VEG-FPLKNEVEAATFMNKVIEQEIMQAPEQYMWLHRRFKTRPEG-MPSLYGDNDSIH--
Q7N5W5_PHOLL          VAG-FPKDDEVKAAAFMNRVVEQEILQAPDQYMWLHRRFKTRPKG-MPSLYGQADKIH--
B4EYY3_PROMH          VAD-FPIDSEENTAIAMNKVVEQEILRAPDQYMWLHRRFKTRPPG-EASLYNEIKKVH--
A0A140NRT4_PROSM      VDD-FPIDDEVAVATKMNQLIEQAILLAPEQYMWLHRRFKTRPKG-ETSLYGDLDKIHH-
C5BHH1_EDWI9          LQD-VPLDDQTATAAYMNRVVEREIMLAPTQYMWLHRRFKTCPPG-IASRY---------
A0A0H3CIG6_ENTCC      IGETLHGGDKASVATQMNRAIERAVLMAPEQYMWLHRRFKTRPEG-QPDRYARKKSVVTS
Q7VR13_BLOFL          KNNKISLKTRIITIQHINKLIEQIILLAPEQYMWLHRRFKTRPPG-ESSFYS--------
LPXL_HAEIN            VDFTD-LQDETAIAARMNQIVEKEIMKDITIYMWLHRRFKTRPDEKTPSLYD--------
E1W6J3_HAEP3          MDFSD-LSDEKAIAERMNKVVEKEILKGMEQYMWLHRRFKTRPSEDEPSLYS--------
B0UT07_HISS2          IDFSDILHDETAIATRMNKIVEKEILQDVTQYMWLHRRFKTRPNEHQQSLYE--------
Q9CME5_PASMU          VDFSD-ITDETRIATRMNQVVETEIMKGVEQYMWLHRRFKTRPDENQPSLYDEE------
A6VP05_ACTSZ          VDFSD-LTEPYAVAVRMNQVVEKEIMKGVEQYMWLHRRFKTRPDETAPSYYD--------
B8F8K7_HAEPS          VDFSQ-CKNDVDTATLMNKVVESEIMQAQSQYMWLHRRFKTRPNESDPSLY---------
A3N0R0_ACTP2          VDFSE-CSDELDTATKMNKVVETEILKEVSQYMWLHRRFKTRPQESDKSLYD--------
Q7VM88_HAEDU          VDFND-CQNKIETARLMNKVVETEILKAQTQYMWLHRRFKTRPNQSAENLYR--------
F4HAP4_GALAU          IDLSD-CEDDVAIATRVNQAIEREINKDPSLYMWLHRRFKTRPEG-EKSFY---------
Q5DZN9_ALIF1          ISDDIPRRDAVTAANVLNREIERLIEKEPSQWMWLHKRFKTLPEDSEEMNRYA-------
Q87LU9_VIBPA          LSEYFEKRNAMKAASILNQELEKMIRRDIPAWMWLHKRFKTRPEGFDCVYT---------
Q5E8M9_ALIF1          ISDQFPKKDPVGVATVMNKAVERVILRCIPQWMWLHKRFKTMEDPNVKKGIRYD------
Q7MPT1_VIBVY          ISDQFPRKDAVGAATVMNQAIEKVILRGLDQWMWLHKRFKSMADPSQPRGIRYK------
A0A0Q2M6I7_VIBFU      VGDNYPQKDEVAAAAYMNKYVEMVIMRAPTQWMWLHKRFKTMQDPNVPKGIRYQ------
Q87T91_VIBPA          IEADYPQKDEVAAAAYMNKYVEEVILRAPEQWMWLHKRYKTMQDENEPKGIRYK------
B7VHJ9_VIBA3          IEDNYPQKDEKAAAAYMNRYLEKIILRAPEQWMWLHKRFKTMEDPEEEKGIRYK------
Q9KVD3_VIBCH          IEADYPQKDETAAAAYMNKFVEEIILRAPEQWMWLHKRFKSLPD-YELTNSRYQ------
Q6LQJ6_PHOPR          -VEGFPNKNPEEGAAFINKIVENSIMQAPEQYMWLHRRFKTRPEGEACLYTK--------
Q87NX3_VIBPA          -VDGFPKDDPDSAAAFVNKIVETSIMASPSQYMWLHRRFKTRPEGEDCLYKPRLVPAMDI
Q6LFU9_PHOPR          -LDAFPHKDHDAAAAYINKAVERSIMEAPEQYLWLHRRFKTRPEGEPSLYK---------
A8GZ72_SHEPA          MIDKFPKGDEHAGACFINKIVEEAIMAKPSQYMWLHRRFKNRPDGESSLY----------
A0A029HTZ1_ECOLX      -MEGYP-TDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG-ESSLYI--------
F4T1H6_ECOLX          -MEGYP-TDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG-ESSLYI--------
LPXP_ECOLI            -MEGYP-TDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG-ESSLYI--------
M7R9F1_SALDU          -MEGYP-ADENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPLG-EASLYI--------
Q8ZNA3_SALTY          -MEGYP-ADENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPLG-EASLYI--------
A9MII1_SALAR          -MEGYP-ADENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPLG-EASLYI--------
D2THV2_CITRI          -MEGYP-ADENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPLG-EASLYI--------
A8ADL6_CITK8          -MEGYP-EEENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPLG-EASLYV--------
A0A0H3CPL3_ENTCC      -MANYP-ENECEAAAFINKVIETEIMRAPEQYLWMHRRFKTRPHG-EASLYI--------
A4WD01_ENT38          -LKNYP-QDETEAAAYINKVIEKEIMRAPEQYLWVHRRFKTRPVG-ESSLYK--------
A6T7M9_KLEP7          -MNDYPGEDKQIAAGYINKVIEREILRAPEQYLWVHRRFKTRPLG-EPSVY---------
B5XSE4_KLEP3          -MNDYPGEDKQIAAGYINKVIEREILRAPEQYLWVHRRFKTRPLG-EPSVY---------
E3G5Y9_ENTLS          -MKDYPAEDEFLAACYMNKVIEKEILRAPEQYLWVHRRFKTRPLG-ESSLY---------
I2BA98_SHIBC          -LLDYPASDEVAAATWMNKIIEREIMRAPEQYLWVHRRFKTRPGG-SASLYI--------
E6WBT8_PANSA          -LENYPHDDESAAAAYMNKVIEREILRAPEQYLWLHRRFKTRPPG-EASLYV--------
E1SIU5_PANVC          -LENYPHTDEAAAAAYMNKVIENQILRAPEQYLWLHRRFKTRPPG-EQSLYV--------
A7MEL3_CROS8          -LQGYPREDEAAAACYMNKVIEREILRAPEQYLWIHRRFKTRPAG-EASLYT--------
H2IUB8_RAHAC          -LQDYPIDDEMAAAAYMNRVIEKEIMRAPDQYLWLHRRFKTRPAG-APSLYR--------
A0A0H3FE86_RAHSY      -LQDYPIDDEMAAAAYMNRVIEKEIMRAPDQYLWLHRRFKTRPAG-APSLYR--------
A0A0U1QZM3_YERP3      -LEDYPIDDEIAAASYMNKVIEKEIMRAPEQYLWLHRRFKTRPIG-EPSLY---------
I3U7I4_ADVKW          -LKNYPMDDEIAAAAYINKVVEKEIMRAPDQYMWLHRRFKTRPVG-APSLY---------
A8GK79_SERP5          -LENYPISDEIAAAAYMNKVVEKEIMRAPEQYMWLHRRFKTRPAG-TPSLY---------
D8MXQ9_ERWBE          -LKDYPVADEQQAAAYMNQVIEHEIMRAPYQYLWLHRRFKTRPEG-ASSLY---------
Q6D938_PECAS          -LQDYPYHDEQAAACYMNKVIETEIMRAPEQYLWLHRRFKTRPAG-EVSLYA--------
E0SLT7_DICD3          -LEDYPSQDQQQAAHYMNRVIEREILRAPEQYLWLHRRFKTRPYG-EASLYR--------
Q2NUW6_SODGM          -LSDYPQDDEMVATCYMNRIVEQEILRAPEQYLWLHRRFKTRPRG-ELSLYV--------
C5B908_EDWI9          -LEGYPAHDLVQAATFMNRIIEREILRAPEQYLWLHRRFKTRPEG-MPSLYTR-------
B4ET77_PROMH          -LHNYPTENIQNDTDRMNHLIEIEIMRAPEQYLWAHRRFKTRPKG-EASFY---------
A0A140NJD6_PROSM      -IVNYPTSDTLHDAATINSVLEKEIMKAPEQYLWAHRRFKTRPDG-EPSLYI--------
A1SRE1_PSYIN          -IENFPSKDLVADAQKTNQQIENMILECDEQYMWVHRRFKTRPEG-EDSFY---------
A4SIG5_AERS4          -LADYPSGDDVVDATRANKEIEAAVRKAPEQYMWLHRRFKTRPSSDDISYY---------
A0KPL5_AERHH          -LADYPSGDDLVDAARANREIEAAVRKAPEQYMWLHRRFKTRPNPDDAGYY---------
H2FVE0_OCESG          -LENFPVGDDEADAITGNAVIEAAIRRAPEQYMWLHRRFKTTPEGVPYRY----------
C4L9B3_TOLAT          -LQNYPTGDDIADATRSNQVLEAAVRKAPAQYMWLHRRFKSRPDGTKFRYNPGEQR----
D4ZFU0_SHEVD          -LDNFPGENEVIDAKRGNKIIEGIINRSPSQYMWLHRRFKTRPNQDDPSLYK--------
B1KE77_SHEWM          -LDSFPTKDEVEDAKRGNGIIEQIINKNRAQYMWLHRRFKTRPNESDPSVY---------
A3QAN2_SHELP          -LEDFPGENELEDAKRGNRIIEEIIERSPAQYMWLHRRFKTRPNKDDPSLYR--------
Q8EAZ1_SHEON          -LDNFPGEDEVADAIRGNKIIEEIINRNRAQYMWLHRRFKTRPDPTDKSLYK--------
Q07Y77_SHEFN          -LENFPGDNETDDAIRGNQIVEQLINRNKAQYMWLHRRFKTRPTEDTPSLYD--------
A1S3I2_SHEAM          -LEDFPGEDETADAIRGNQVVESLISRNLPQYMWLHRRFKTRPEQDAPSLYK--------
Q12RC8_SHEDO          -LENFPGVDEVSDALRGNQIIEQLIDKNRSQYMWLHRRFKTRPNENDPSLY---------
Q5QY19_IDILO          -LENFPTGDKKADAERVNGLVEDAILKAPAQYLWVHRRFKTRPDPDMPSYYQSSSSK---
Q47WI8_COLP3          -LENFPTQDNIADVTRINQELEKAISRKPEQYMWLHRRFKTRPNPDDASLYK--------
F2G7H2_ALTMD          -LSELGEMEDTEALTLLNKHVDAAVKEQPESYLWMHKRFKTRPADNPESLYKSL------
F5ZC15_ALTNA          -LTHLGEMDDIAALTELNTHIDKAIKEQPESYLWMHKRFKTRPSKDTPSLY---------
Q15PT3_PSEA6          -LENFPSGDDKEDVARMNKMVETLVLEAPEQYLWMHKRFKTRPNKSDPSLYD--------
                                       *  ::  :              *                    

Q8P5K2_XANCP          -----------------
Q5H4E2_XANOR          -----------------
B2FTS8_STRMK          -----------------
Q87F59_XYLFT          -----------------
D2UC29_XANAP          -----------------
L0DTE2_THIND          -----------------
B8GL59_THISH          TETSEK-----------
B1ZVZ1_OPITP          -----------------
I1XGS6_METNJ          VKNCS------------
I1YIL6_METFJ          -----------------
A1WZG7_HALHL          -----------------
A0A0E1PUK9_ACIBA      -----------------
B0V4M5_ACIBY          -----------------
Q6FEU5_ACIAD          -----------------
B0VAW3_ACIBY          -----------------
A0A1E3M247_ACIBA      -----------------
Q15SA3_PSEA6          -----------------
Q1QU83_CHRSD          -----------------
E1V7Q4_HALED          -----------------
A1TYS8_MARHV          -----------------
E4PMT5_MARAH          -----------------
B3PC27_CELJU          AVSG-------------
Q0VM58_ALCBS          -----------------
K0C8J3_ALCDB          -----------------
F6AIP4_PSEF1          -----------------
Q9HYZ8_PSEAE          -----------------
W8R9K6_PSEST          -----------------
A4XRN5_PSEMY          -----------------
C1DQM3_AZOVD          -----------------
I7C4R3_PSEPT          -----------------
Q88M40_PSEPK          -----------------
C3K0D2_PSEFS          -----------------
Q87YC9_PSESM          -----------------
C5BNW3_TERTT          -----------------
Q21HE6_SACD2          RRLKQEQQRKRK-----
LPXL_ECOLI            -----------------
Q32E85_SHIDS          -----------------
B7LFG5_ECO55          -----------------
A0A029IWM4_ECOLX      -----------------
D2TT60_CITRI          -----------------
A8AI25_CITK8          -----------------
A6T7D0_KLEP7          -----------------
Q8ZQ24_SALTY          -----------------
C9Y0W5_CROTZ          -----------------
A7ME71_CROS8          -----------------
E3GC97_ENTLS          -----------------
A0A6I4L5F5_9ENTR      -----------------
I2BAG9_SHIBC          -----------------
A0A0H3CNJ6_ENTCC      -----------------
A4W967_ENT38          -----------------
Q6D6A6_PECAS          -----------------
E0SHR8_DICD3          -----------------
A0A0H3NW53_YERE1      -----------------
A8GCZ7_SERP5          -----------------
H2IUW8_RAHAC          -----------------
D8MQP0_ERWBE          -----------------
B2VDK0_ERWT9          -----------------
E6WDD9_PANSA          -----------------
E1SJK3_PANVC          -----------------
Q2NU53_SODGM          -----------------
D3V2Q6_XENBS          -----------------
D3VC59_XENNA          -----------------
Q7N5W5_PHOLL          -----------------
B4EYY3_PROMH          -----------------
A0A140NRT4_PROSM      -----------------
C5BHH1_EDWI9          -----------------
A0A0H3CIG6_ENTCC      NSTVSTGDMPEQSGIQH
Q7VR13_BLOFL          -----------------
LPXL_HAEIN            -----------------
E1W6J3_HAEP3          -----------------
B0UT07_HISS2          -----------------
Q9CME5_PASMU          -----------------
A6VP05_ACTSZ          -----------------
B8F8K7_HAEPS          -----------------
A3N0R0_ACTP2          -----------------
Q7VM88_HAEDU          -----------------
F4HAP4_GALAU          -----------------
Q5DZN9_ALIF1          -----------------
Q87LU9_VIBPA          -----------------
Q5E8M9_ALIF1          -----------------
Q7MPT1_VIBVY          -----------------
A0A0Q2M6I7_VIBFU      -----------------
Q87T91_VIBPA          -----------------
B7VHJ9_VIBA3          -----------------
Q9KVD3_VIBCH          -----------------
Q6LQJ6_PHOPR          -----------------
Q87NX3_VIBPA          SI---------------
Q6LFU9_PHOPR          -----------------
A8GZ72_SHEPA          -----------------
A0A029HTZ1_ECOLX      -----------------
F4T1H6_ECOLX          -----------------
LPXP_ECOLI            -----------------
M7R9F1_SALDU          -----------------
Q8ZNA3_SALTY          -----------------
A9MII1_SALAR          -----------------
D2THV2_CITRI          -----------------
A8ADL6_CITK8          -----------------
A0A0H3CPL3_ENTCC      -----------------
A4WD01_ENT38          -----------------
A6T7M9_KLEP7          -----------------
B5XSE4_KLEP3          -----------------
E3G5Y9_ENTLS          -----------------
I2BA98_SHIBC          -----------------
E6WBT8_PANSA          -----------------
E1SIU5_PANVC          -----------------
A7MEL3_CROS8          -----------------
H2IUB8_RAHAC          -----------------
A0A0H3FE86_RAHSY      -----------------
A0A0U1QZM3_YERP3      -----------------
I3U7I4_ADVKW          -----------------
A8GK79_SERP5          -----------------
D8MXQ9_ERWBE          -----------------
Q6D938_PECAS          -----------------
E0SLT7_DICD3          -----------------
Q2NUW6_SODGM          -----------------
C5B908_EDWI9          -----------------
B4ET77_PROMH          -----------------
A0A140NJD6_PROSM      -----------------
A1SRE1_PSYIN          -----------------
A4SIG5_AERS4          -----------------
A0KPL5_AERHH          -----------------
H2FVE0_OCESG          -----------------
C4L9B3_TOLAT          -----------------
D4ZFU0_SHEVD          -----------------
B1KE77_SHEWM          -----------------
A3QAN2_SHELP          -----------------
Q8EAZ1_SHEON          -----------------
Q07Y77_SHEFN          -----------------
A1S3I2_SHEAM          -----------------
Q12RC8_SHEDO          -----------------
Q5QY19_IDILO          -----------------
Q47WI8_COLP3          -----------------
F2G7H2_ALTMD          -----------------
F5ZC15_ALTNA          -----------------
Q15PT3_PSEA6          -----------------