CLUSTAL format seed alignment for MF_01944

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A7K3H1_VIBAE          ---------------------------MTIKRDDFDHKAYNPEFKRHFLSPKYWGTWLGV
A7MSM0_VIBCB          ---------------------------MTNQRDDFDPKAYNPEFERHFLAPKYWGTWIGV
F0LP88_VIBFN          ---------------------------------------------MNFLHPRYWGTWLAV
A0A0H3AHB3_VIBC3      ---------------------------MSDQDNGIARHLHNPQFEWRFLHPKHWGTWIGI
Q5E3V2_ALIF1          ---------------------------MTEK---IDKNVYNPTFQWAFLHPKYWPTWLGI
X2JRD1_AGGAC          ------------------------MTDSQQNVRLTARVGYEPRFSWSYLKPKYWGIWCGI
LPXM_HAEIN            ------------------------MSDNQQNLRLTARVGYEAHFSWSYLKPQYWGIWLGI
E1W6L2_HAEP3          ------------------------MTDSQKKLRITARTGYEPHFSWSYLHPKNWGIWLGI
A6VMZ0_ACTSZ          ------------------------MTE-QENMRLTARVGYEPHFSWSYLHPKYWGTWLGV
Q65U84_MANSM          ---------------MIRDGLVKRINMSEKNKRLTARVGYEPHFSWSYLLPKYWGIWLGI
Q9CNR4_PASMU          -----------------------MAMSEE-DTRLTARSGYQPQFSWSYLQPKYWLIWLGI
B0UWQ7_HISS2          -------------------------MTENNDLRLTARVGYQPHYSWSYLLPKYWGIWLGI
F4HED7_GALAU          --------------------------MSDENRRITARVGYEPQFRWSYLHPKFWGVWFGV
G1UBA3_HAEDU          ------------------------------MEQITEKTGYTHKFLWVFLHPRYWVVWLGV
A3MYP4_ACTP2          -----------------------------MTERITAREGYEHKFLKEFLYPKYWGVWLGV
B8F7A9_GLAP5          -----------------------------MSERETYRVGYQHQFQKAFLHPKYWGIWLGM
Q6D4B1_PECAS          --------------------------ME---KEKKSNAEFVPQFQRAFFHPRYWGVWLGV
E0SB84_DICD3          --------------------MMKSGCMEQEKKEKKTNAEFIPQFTPAFFHPRYWALWLVV
H2IXX2_RAHAC          --------------------------MQPE-KEKRSTVEFIPQFQKAFYHPRYWGVWLGV
A8GFI2_SERP5          --------------------------MQ---NEKKSNSEFIPQFQKAFYHPRYWGVWLGT
C5B9T7_EDWI9          --------------------------MQ---QETKSTPEFIPHFRAAFLSPRYWGVWLGI
Q2NTI5_SODGM          --------------------------ME---KTKKGHTEFIPTFKSAFYTPRYWGVWLGI
LPXM_ECOLI            --------------------------MET----KKNNSEYIPEFDKSFRHPRYWGAWLGV
Q32HA6_SHIDS          --------------------------MET----KKNNSEYIPEFDKSFRHPRHWGAWLGV
D3QVX2_ECOCB          --------------------------MET----KKNNSEYIPEFDKSFRHPRYWGAWLGV
Q1RAS9_ECOUT          --------------------------MET----KKNNSEYIPEFDKSFRHPRYWGAWLGV
A0A0H2V866_ECOL6      --------------------------MET----KKNNSEYIPEFDKSFRHPRYWGAWLGV
D2TMU4_CITRI          --------------------------MET----KKNNIEYIPEFEKSFRHPRHWGAWLGV
H9L440_SALTY          --------------------------MET----KKNNSEYIPEFEKSFRYPQYWGAWLGA
A0A0H3CKD2_ENTCC      ----MRGALPRYTIVIIFCFTRPWNQHGN----QKNNIEFIPEFEKSFRHPRNWGAWLGV
A4WBL3_ENT38          --------------------------MET----QKNNIEYIPEFEKSFRHPRHWGAWLGV
E3G3L9_ENTLS          --------------------------MET----KKNNIEFIPQFEKSFLHPRFWGSWIGV
A6TB25_KLEP7          --------------------------MET----KKNNIEFIPKFEKSFLLPRYWGAWLGV
A7MEA8_CROS8          --------------------------MDT----KKTKSEYIPEFERAFLHPRYWGAWLGI
I2BA51_SHIBC          -------------------------MAQE----KKSHSEFIPQFQRAFFHPRYWGSWLGI
D8MT77_ERWBE          --------------------------MENS---KKSNIEFIPTFQKSFLLPKYWGNWLTI
B2VJA0_ERWT9          --------------------------MENR---KKSNVEFIPLFQKSFLLPRYWGSWLGV
E6WA41_PANSA          --------------------------METR---KKNNIEFIPVFQRSFLKPKYWGNWLAI
E1SG01_PANVC          --------------------------METR---KKNNIEFIPVFERSFLKPKYWGSWLAI
D3GX08_ECO44          --------------------------------MKKYKSEFIPEFKKNYLSPVYWSTWFLL
Q326Y5_SHIDS          --------------------------------MKKYKSEFIPEFKKNYLSPVYWFTWFVL
C1J8A7_ECOLX          -----------MVPPSAVLCYHNEISRQIPVNMKNIRTEFIPRFNLTLCFPRYWMTWTGI
Q9ZGU3_ECO57          MFSSAVRWPPGMVPPSAVLCYHNEISRQIPVNMKNIRTEFIPRFNLTLCFPRYWMTWTGI
A0A2S9PHC7_YERPE      --------------------------MHKE---KNDATGFIPVFQKTFLHPRFWGVWLGA
B4EVU1_PROMH          --------------------------MNKE-KDTDSKAGYVPTFHRAYLHPRHWGTWFGA
A0A140STA5_PROSM      --------------------------MNKD-KDTDSKLGYVPTFHKSYLHPKYWGVWAGA
D3V183_XENBS          --------------------------MNKE-KDTDSKLGYVPTFHLSYLHPRYWGLWTGV
D3VEW4_XENNA          --------------------------MNKE-KNTDNKLGYIPRFHRFYLHPRYWGLWAGV
Q7MB40_PHOLL          --------------------------MHKE-TDTDSKAGYVPTFHKSYLHPRYWGLWLGI
C4K4A1_HAMD5          --------------------------MHK----KNNHAGFIPRFDKAFLHPRYWGIWFGV
A3D3R9_SHEB5          --------------------------------MSRQPKHFDRRFKLALLHPKYWATWLAI
B8E7F2_SHEB2          --------------------------------MSRQPKHFDRRFKLALLHPKYWATWLAI
A9KYZ3_SHEB9          --------------------------------MSRQPKHFDRRFKLALLHPKYWATWLAI
Q8EF97_SHEON          --------------------------------MSRQTKHFDRRFQLALLHPKYWVTWLAI
B8CR58_SHEPW          --------------------------------MSRKPKYFDRRFRLSLLHPKYWLTWFAI
A8H5F0_SHEPA          --------------------------------MSRKPKYFDRRFKLSLLHPRYWLTWVAI
A1SW77_PSYIN          --------------------------------MTQYQSRFDTSLKKQHFLPKYWGTWLLL
M4U7K0_9GAMM          ----------------------------------MTQAKFDTTFKTHYLRPKHWGSWFLL
A0A090ICU2_9GAMM      --------------------------------MSDKYKPYDLSFKKTFLLPKFWPVWFGV
A4SMY6_AERS4          --------------------------------MSSQDPVFDSSFQTRLLRPRYWPSWLAL
A0KK31_AERHH          ----------------------------MMAAMSSHDPVFDTSFHPRLLYPRWWGSWLAL
C4L8F9_TOLAT          ---------------------------------MTKDPALDHKLPLALLHPRYWMTWFSI
                                                                        *  *  *   

A7K3H1_VIBAE          LLFLPLSLMPLGLQKWLAKTIAKKLSKSHK----GPAHRARVNFELCFPEKSFQEREALI
A7MSM0_VIBCB          VLSLPLALLPLGVQKWLAKTIAKKLAKSHK----GPAHRARVNFELCFPEKSFEEREALI
F0LP88_VIBFN          IMACVLSFLPVAIKRLIARSLAKLAVNIKS----KANTRARVNLRMCFPEQSDSDREKIL
A0A0H3AHB3_VIBC3      AFAALLAFIPWRLRDRLAKPLVPLIIKKNG----RVVRRARVNLAYCFPEKSEQEREQIL
Q5E3V2_ALIF1          GFAIILAFIPFRLRDKLAAKIVKLVLKKPS----GGIKRAKLNIATCFPEKSEQEQQKLL
X2JRD1_AGGAC          LVLLLLGFIPFRLRDKLAAKLGVFIGHKAK----KQRKRAQINLQCCFPQWSEQHREKVI
LPXM_HAEIN            FFLLLLAFVPFRLRDKLTGKLGIWIGHKAK----KQRTRAQTNLQYCFPHWTEQQREQVI
E1W6L2_HAEP3          FVLLLLAFVPFRLRDKLAEKLARALTKKIG----KPRIRAEINLKLCFPDWTDEKRNKVI
A6VMZ0_ACTSZ          AVLLILAYIPFRWRDRLAAKLGVIIGRKAR----KQRRRAQINLTYCFPDWTEQQRERVI
Q65U84_MANSM          FVLLIFAFIPFRLRDNLAAKLGLVIAKYAK----KPRHKARVNLQYCFPQWSAEQREKVI
Q9CNR4_PASMU          FGLILLAFVPFRLRDKLASYIGKIVARKAK----KQRHRAKINLQYCFPHWTEAQREQTI
B0UWQ7_HISS2          FALVILAFVPFRWRDKLATKLGRIIARKAK----KQRHRADVNLRYCFPHWSEKQRNEVI
F4HED7_GALAU          FLLALLAFMPFRCRDALAAKIGLLVGKVAK----KQRKRAQVNLRYCFPHWSEQQREQVI
G1UBA3_HAEDU          LGLLILAYVPYRLRDKLATIVGRVVSNYLKKKGKKQYYRADINLCYCFPEWSADKRAQVI
A3MYP4_ACTP2          LALVVLAYVPARLRDKLAVFVGRVVKNYLKKKGKKQYHRADTNLRYCFPNWSEQQREQVI
B8F7A9_GLAP5          LGLVILAYVPFRWRDKLATWGGKIVAKKLK--GKKQYHRADSNLRYCFPDWSEEKRSDVI
Q6D4B1_PECAS          GVMALTAYIPARLRNPVLGGLGRFVGRISK----GARRRARINLLYCMPELTEAQRETII
E0SB84_DICD3          CVTALIACIPARLRDPVLGALGRLVGRFSK----GARRRARINLLLCMPQLSENEREHII
H2IXX2_RAHAC          GAMAVMAYLPAKVRDPLLGSLGRLAGKFAK----GARRRAQINLLYCLPETPEAEREHII
A8GFI2_SERP5          GLMAGISLVPARLRDPVLGAVGKLAGKVAK----GARRRARINLLYCLPEVPENEREHII
C5B9T7_EDWI9          ALMAAMAFLPLRLRDWMIGAVGRLAGRLAS----GARRRAQINLMLCFPQMAARRREAII
Q2NTI5_SODGM          GAIAASAWIPPRLRDPVLGALGRVVGRVAH----KARFRAQVNLAYCLPEIDTPQRETII
LPXM_ECOLI            AAMAGIALTPPKFRDPILARLGRFAGRLGK----SSRRRALINLSLCFPERSEAEREAIV
Q32HA6_SHIDS          AAMAGIALTPPKFRDPILARLGRFAGRLGK----SSRRRALINLSLCFPERSEAEREAIV
D3QVX2_ECOCB          AAMAGIALTPPKFRDPILARLGRIAGRLGK----SSRRRALINLSLCFPERSEAEREAIV
Q1RAS9_ECOUT          AAMAGIALTPPKFRDPILARLGRFAGRLGK----SSRRRALINLSLCFPERSEAEREAIV
A0A0H2V866_ECOL6      AAMAGIALTPPKFRDPILARLGRFAGRLGK----SSRRRALINLSLCFPERSEAEREAIV
D2TMU4_CITRI          AAMAGIALTPASFRDPLLAKLGRFAGRMGK----SSRRRALINLSLCFPERSEAEREAIV
H9L440_SALTY          AAMAGIALTPASFRDPLLATLGRFAGRLGK----SSRRRALINLSLCFPQRSEAEREAIV
A0A0H3CKD2_ENTCC      YAFAGIAMLPASVRDPVLGKIGRLAGRMGK----SARRRAQINLYYCFPEKSDAEREAII
A4WBL3_ENT38          YAFAGIALLPAAVRDPVLGKMGLLAGRFGK----SARRRAQINLYYCFPEKTDAEREAII
E3G3L9_ENTLS          FAFAGIALTPPSFRDPILGALGRLTGKFAR----SARRRAQINLLYCFPDKSEQERETMI
A6TB25_KLEP7          FAFAGIALTPPSFRDPLLGKLGRLVGRLAK----SSRRRAQINLLYCFPEKSEYEREAII
A7MEA8_CROS8          GACAALALTPPSFRDPLLGKLGRLAGKFGK----SARRRARINLFYCFPELSEAQREAII
I2BA51_SHIBC          AAFAGLALTPPGFRDPLLGRIGRIAGRLAK----SARRRAQINLLYCFADKSEAEREAII
D8MT77_ERWBE          GAFAGLAWLPVGMRDPLLGALGRLAGKMAK----SARRRAQINLLYCMPEVPEAQREAII
B2VJA0_ERWT9          GAFAALTLIPPRLRDPLLGALGRKAGKLAR----SARRRAQINLLYCLPEKSEAEREQII
E6WA41_PANSA          GALAGMAMLPAKVRDPVLGGLGKLAGKLAK----SARRRALINLYYCLPELSEAQREDIV
E1SG01_PANVC          GALAGLAYLPPKVRDPLLGRLGRFAGKLAK----GARRRALINLYYCLPEFSEEQRATLV
D3GX08_ECO44          GMIAGISMFPPSFRDPVLAKIGRWAGRLSK----KARRRATINLSLCFPEKSDTEREIIV
Q326Y5_SHIDS          GMIAGISMFPPSFRDPVLAKIGRWVGRLSR----KARRRATINLSLCFPEKSDTEREIIV
C1J8A7_ECOLX          GIICVFAMVPPALRDPLLGKLGMLVGRLGK----SARQRALINLSLCFPEYSDKEKENIV
Q9ZGU3_ECO57          GIICVFAMVPPALRDPLLGKLGMLVGRLGK----SARQRALINLSLCFPEYSDKEKENIV
A0A2S9PHC7_YERPE      GAIAALAYIPPKFRDPLLAGIGRLAGKFAK----SARRRARINLLYCMPELPESEREHII
B4EVU1_PROMH          GVLCALAYMPVKWRDPLLASIGRFVGRKAK----SARRRADINLRYCFPHWDKAQREDVL
A0A140STA5_PROSM      GVFAALAYIPVKIRDPMLAKVGKWVGKLAK----SARRRAKINLLYCFPDLTEQERDQLV
D3V183_XENBS          GILAGLAYVPVKWRDPLLAKMGIWAGKKAK----SARRRAKINLVYCFPELQEQQREALI
D3VEW4_XENNA          GILAGLAYIPVKWRDPFLAKMGVWAGRKAK----SARRRAKINLIYCFPDLTEQQREDLI
Q7MB40_PHOLL          GVLAGLAYLPVKVRDPLLAKIGWLAGKLAK----GARRRARINLCYCMPELTEQQREALI
C4K4A1_HAMD5          GLLVLLSYLPIKWRDGLMAFIGFLVGKCAK----GARRRARINLIYCMSNLTEVQREKII
A3D3R9_SHEB5          GLLVIFGLMPAWLRDPIARLLARLV--MPIAK--KPISVARANLRACFPEQSAAEIEALI
B8E7F2_SHEB2          GLLVIFGLMPAWLRDPIARLLARLV--MPIAK--KPISVARANLRACFPEQSAAEIEALI
A9KYZ3_SHEB9          GLLVIFGLMPAWLRDPIARLLAKIV--MPIAK--KPISVARANLRACFPEQSAAEIEALI
Q8EF97_SHEON          GLLVIFGIMPAWLRDPIAKVLAKLV--VPIAK--KPIGIARANLSACFPEKSAAEIETLI
B8CR58_SHEPW          LVLVLFGLMPAWFRDPIARQLSKLV--LKIAA--KPIAVARANLTTCFPEKSNADIEALI
A8H5F0_SHEPA          LVLVVFGLMPARLRDPIARTLAKLV--MKIAK--KPIKVARANLTTCFPEKSADEIEALV
A1SW77_PSYIN          GLLFLFSYLPIKWRDCFATFIANKLYDTKFLN--KRKKIAFINLGLCFPEYNEADKDALM
M4U7K0_9GAMM          FLLFIFSYIPVRLRDRFAGFIASKIYSKKFLN--KRKKIAFINIGLCFPEYTEQQKDELM
A0A090ICU2_9GAMM      FVLYLLAFVPVKPRDKFARFIATKLFDLKVMS--KRKKVAKINLSMCFPEMDEIEQERII
A4SMY6_AERS4          GALCVLAFVPPRWRDKLAEWLAPLV--VKVSK--KQIYIAKTNLDICFANKSQAERDAIL
A0KK31_AERHH          GLLCLLALVPHGLRDRLANRLAPTL--LRMSK--KQAYIAETNLKICFPELDEAGRQALL
C4L8F9_TOLAT          FLLALLAWMPVRLRDALAASFANLL--LRFSS--RQCYAARLNIGLCFPELSDEEREAML
                               *   :  .                      *  *:  *:..         :

A7K3H1_VIBAE          EKTLYTAAMFFFRFGLLSLRSPKWLQNRCQIRGLDILRQHIDNNENVILMVPHSWAIDVP
A7MSM0_VIBCB          EKTLYTAALFFFRFSLLSLRSSKWLQQRCQIRGLDILQKHIDSDEKIILMVPHSWAIDIP
F0LP88_VIBFN          VEMYITSVMFLMGFASTSLRSKAWLEANTTLRGFEHVEQVLDRGENVILLVPHTWAIDIP
A0A0H3AHB3_VIBC3      HDTFVKASQFMLGYSELLVRSTRYNNARGELIGEENLLPLLDSGERVILLVPHSWAIDYA
Q5E3V2_ALIF1          EDTYITGAQVMLGFSELLVRSRKHNEKRGIFVGGENLFPLLEQKENIIILAPHAWAIDFP
X2JRD1_AGGAC          DEMFAVLAQVMLGIGEVAVRSKKHLQKRSEFIGIEHIKQAKEQGKNVILLVPHGWAIDAS
LPXM_HAEIN            DKMFAVVAQVMFGIGEIAIRSKKHLQKRSEFIGLEHIEQAKAEGKNIILMVPHGWAIDAS
E1W6L2_HAEP3          EDMFVTVAQVMLGIGEIAIRSKKHLQKRSEFIGLEHIKQAKAEGHNIILMVPHGWAIDAS
A6VMZ0_ACTSZ          DKMFATVAQVMLGIGEIAIRSKAHLQKRSEFIGIEYIKRAKSEGKNIILMVPHGWAIDAS
Q65U84_MANSM          DDMFITVTQVMLGIGEIAVRSKAHLQRRSVFFGIEHIQKAKEQGYNIILMVPHGWAIDAS
Q9CNR4_PASMU          EEMFVIVTQVMLGIGEIAIRSKRHLQRRSCFTGLEHIHRAREQGKNIILLVPHAWAIDAS
B0UWQ7_HISS2          ENMFITVTQVMLGIGEIALRSKKHLKKRSEFKGLEHVQQAREVGKNIILMVPHGWAIDAS
F4HED7_GALAU          DKMFMTVAQTMLGIGEIALRSTKHLQKRSLFLGIEHLRQAKQQGKNIILLVPHTWAIDAS
G1UBA3_HAEDU          EQMFINVAQTMLGIGEIAVRSVAHLQKRSEFIGLNYLKQAKAKGKNIILLVPHTWSIDAS
A3MYP4_ACTP2          ERMFITVTQTMLGIGEIAIRSVKHLQRRSEFLGLAHLQQAKQDGKNIILLVPHTWAIDAS
B8F7A9_GLAP5          EKMFITVAQTMLGIGEIALRSVEHIQKRSEFSGLEIVREARANGKNVILLVPHTWSIDAS
Q6D4B1_PECAS          DDMFATAPQSMIMMVEVGIRNPKKIEKYVRWHGEDILERIKAQEKNVIFLVPHGWGVDIP
E0SB84_DICD3          DQMFATAPQAMLMMVELAILPASRAERRVRWHGMEIVDALREQQRNVIFMVPHGWAVDVP
H2IXX2_RAHAC          DEMFATAPQSMVMMAELAIRDPKKIMQRVHWHGKEIVDQMHAEGKNVIFLVPHGWAVDIP
A8GFI2_SERP5          DEMFATAPQSMILMAELACTKPEKVLKRVRWHGEEVLDKIREEGRNVIFLVPHGWAVDVP
C5B9T7_EDWI9          DTMFARAGQSMFLMAELTLRGPQRLLRHTHWHGGEIIEQAREQGDNVIFLVPHGWAVDIP
Q2NTI5_SODGM          DDMFACVTQSTILMAELACRDPKRVLARVRWHGDELIQRLQEEGRNVIFLVPHGWAVDVP
LPXM_ECOLI            DEMFATAPQAMAMMAELAIRGPEKIQPRVDWQGLEIIEEMRRNNEKVIFLVPHGWAVDIP
Q32HA6_SHIDS          DEMFATAPQAMAMMAELAIRGPEKIQPRVDWQGLEIIEEMRRNNEKVIFLVPHGWAVDIP
D3QVX2_ECOCB          DEMFATAPQAMAMMAELAIRGPEKIQPRVDWQGLEIIEEMRRNNEKVIFLVPHGWAVDIP
Q1RAS9_ECOUT          DEMFATAPQAMVMMAELAIRGPEKIQPRVDWQGLEIIEEMRRNNEKVIFLVPHGWAVDIP
A0A0H2V866_ECOL6      DEMFATAPQAMVMMAELAIRGPEKIQPRVDWQGLEIIEEIRRNNEKVIFLVPHGWAVDIP
D2TMU4_CITRI          DEMFATAPQAMAMMAELAMRGPEKIQSRVDWQGLEIVEEMRRNDEKVIFLVPHGWGVDIP
H9L440_SALTY          DEMFATAPQAMAMMAELAMRGPKKIQQRVDWEGLEIIEEMRRNDEKVIFLVPHGWGVDIP
A0A0H3CKD2_ENTCC      DDMYTTAPQAMAMMAELALKGPEKVLKRVDWKGLEIIDEMRRNDEKVIFLVPHGWGVDIP
A4WBL3_ENT38          DDMFTTAPQAMAMMGELALRGPKKVMNRVDWKGLEIIDEMRRNDEKVIFLVPHGWGVDIP
E3G3L9_ENTLS          DDMFATAPQAMVMMAELGLRDPKKILARVDWQGKEIIDDLRRNNEKVIFLVPHGWGVDIP
A6TB25_KLEP7          DAMYASAPQAMVMMAELGLRDPQKILARVDWQGKAIIDEMQRNNEKVIFLVPHAWGVDIP
A7MEA8_CROS8          DNMFATAPQAMVFMAELALRGPEKVLNRVDWHGEAFLNELLANKENVILLVPHGWGVDIP
I2BA51_SHIBC          DQMFATAPQAMCLMAELAMRGPQRVLPRVDWHNKEIIDAMHEGGENVIFLVPHGWGVDIP
D8MT77_ERWBE          DEMFATAPQSMAMMAELALR-PDKAIGRIHWHNQEIIDDIREQGGNVIFLVPHGWAVDIP
B2VJA0_ERWT9          DDMFATAPQSMAMMAELALR-PEAAKSRIRWHGREIVDALRDSGQNVILLVPHGWAVDLP
E6WA41_PANSA          DQMFATAPQAMVMMAELGIRDPARVRQRVDWYGREIIEQLQANNENVIFLVPHGWGVDIP
E1SG01_PANVC          DEMFATAPQAMTMMTELVLRDPARIRQRVEWHGREIIDQMKAEQQNVIFLVPHGWAVDIP
D3GX08_ECO44          DKMFATALQSIVMMAELAIRGPEKFQKRVFWKGLEILEEIRHNNRNVIFLVPHGWSVDIP
Q326Y5_SHIDS          DNMFATALQSIVMMAELAIRGPEKFQKRVFWKGLEILEEIRHNNRNVIFLVPHGWSVDIP
C1J8A7_ECOLX          DAMFATASMAVVLMAELALSGPDKISHRIRWNGLEIVEKMAQNNEKVIFLVPHAWGVDIP
Q9ZGU3_ECO57          DAMFATASMAVVLMAELALSGPDKISHRIRWNGLEIVEKMAQNNEKVIFLVPHAWGVDIP
A0A2S9PHC7_YERPE      DQMFATAAQPLMMMAELCFRDPKKVLTRVHWHGQEILDELQQQERNVILLVPHAWSIDIP
B4EVU1_PROMH          DKMFETAPQSFVMLADLCLRGAKHTLQRTSWEGIEIIERLKAQGRNVIFMVPHGWAVDVP
A0A140STA5_PROSM      DRMFETAPQSFVMLAELCIRGADKTLARTHWHNQEIIDNLKQQGSNVIFMVPHGWAVDAP
D3V183_XENBS          DKMFATAPQSFVMLAELCLKGAESTLQRTRWHGEEILHSLKAQSKNVILLVPHGWAIDIP
D3VEW4_XENNA          DKMFASAPQSFVMLAELCLKGAESTLKRTQWHGEEIFHTLKAQGKNVILMVPHGWAIDIP
Q7MB40_PHOLL          DEMFSTAPQPFVMLAELCLRGTKSTLSRTQWHGEEIILQLKAQGKNVIFMVPHGWAVDIP
C4K4A1_HAMD5          DEMFCNSTQPIMLILDLCLRGPQFLASRVHWHDRFILDEIEKKKTNIILLLPHAWSIDIP
A3D3R9_SHEB5          RENVQNFVLVLLAQGELLVRSKAHLRRRVNLIGFEHVTKAQAAGQPIIFIMPHVWPIDYA
B8E7F2_SHEB2          RENVQNFVLVLLAQGELLVRSKAHLRRRVNLIGFEHVTKAQAAGQPIIFIMPHVWPIDYA
A9KYZ3_SHEB9          RENVKHFVLVLLAQGELLVRSKAHLRRRVNLIGFEHVTKAQAAGQPIIFIMPHVWPIDYA
Q8EF97_SHEON          NNNVENFVLVLLSQGELLIRSKAHLRRRVNLMGFEHVKAAQAAGQPVIFIMPHVWPIDYA
B8CR58_SHEPW          RDNVENFVMILLAQSELLVKSRQNIRNRVHLAGFEHVQQARAAGQPVIFIMPHVWGIEYA
A8H5F0_SHEPA          KDNVENFVMILLAQSELMLKSRAHMRRRVQLHGFEHVENARAAGQPVIFIMPHVWGIEYA
A1SW77_PSYIN          RENFRAVTQILLSLGELAFRSQAFLIKRINFIGEHYIKEAEAQDKAIIFLAPHCYGLDFA
M4U7K0_9GAMM          QKNIRALSQIALSLGELAFRSRRHILNRVNVMGEQHIIEAERAGQSIIFLGPHCYGLDYA
A0A090ICU2_9GAMM      MGNLVTFCQTILSYAEPSARSLAYNRNRMVVHGGENLFPLLEEGKACILLVPHSFAVDFS
A4SMY6_AERS4          MTSIRIGLKTLLGFGEFTVRSPAYLMKRINVSGWEHIEAEQAAGRPMILVVPHSWPVDAA
A0KK31_AERHH          LKSIRVGLKTFMGFAELTLRSAAHLASRVKVRGWEHIEAERAAGRPVILVVPHTWAVDMI
C4L8F9_TOLAT          YRSISVGLKGFFALGEPTFLPSSLFLRRIKPNGWEHVESALQTGKPIIFMIPHTWTIDAC
                                                      .   .          *:: ** : ::  

A7K3H1_VIBAE          AI-LLASMGMPVSAMAKKQKNDVADWLMHKQRVQY-----GGRVYERSGGIKPFLKSIR-
A7MSM0_VIBCB          AV-LLASMGMPVSAMAKKQKNEVADWLMHEQRVQY-----GGRVYERSGGVKPFLKSVR-
F0LP88_VIBFN          AI-LLASRGHPVSAMAKSQKNKVSDWLMHKQRVQY-----GGRVYDRSVGIKPFIKSVRK
A0A0H3AHB3_VIBC3      AV-MLAARGYKVANIMKPQRNPIADWLMHVQRMQY-----GGRIFTRESGIKPFLRSIQ-
Q5E3V2_ALIF1          AI-LLASRGYHVTTMMKPQKNPITDWLMHVQRMQY-----GGKIYARSAGIKPLIKAIK-
X2JRD1_AGGAC          GI-ILHTHGIPMTSMYNPHRNPLVDWLWTITRQRF-----GGKMHARQNGIKPFLNHIK-
LPXM_HAEIN            GI-ILHTQGMPMTSMYNPHRNPLVDWLWTITRQRF-----GGKMHARQNGIKPFLSHVR-
E1W6L2_HAEP3          GI-ILHTHGMPMTSMYNPHRNPLVDWLWTLARQRF-----GGKMHARQNGIKPFLAHIK-
A6VMZ0_ACTSZ          GI-ILHTHGMPMTSMFNPHRNPLIDWLWTATRERF-----GGKMHARQNGIKPFLTMIR-
Q65U84_MANSM          GI-ILHTHGMPMTSMYNPHRNPLVDWLWTITRERF-----GGKMHARQNGIKPFLNMVR-
Q9CNR4_PASMU          GI-ILHTHGMPMTSMYNPHRNPLVDWLWTFARQRF-----GGKMHARQNGIKPFLNHVK-
B0UWQ7_HISS2          GI-ILHAQGIAMTSMYNPHQNPLVDWLWTMTRQRF-----GGKMHARQNGIKPFLNHVK-
F4HED7_GALAU          GI-ILHTQGMPMTAMYNPHRNPLVDWLWNAVRERF-----GGKMHARQNGIKPFLNAVR-
G1UBA3_HAEDU          GI-ILHTYGMPMVSMYNPHRNALVDWLWNATRERF-----GGKMHTRQNGIKPFLNDIR-
A3MYP4_ACTP2          GI-ILHTHGMPMVSMYNPHRNALVDWLWNATRERF-----GGKMHTRQNGIKPFLNDVR-
B8F7A9_GLAP5          GI-IMHTYGMPMVSMYNPHHNPLVDWLWNRTRERF-----GGKMHTRQNGIKPFLNDVR-
Q6D4B1_PECAS          AM-LLTSRGQRMAAMFHNQKNALVDYWWNRLRRRF-----GGRIHARNDGIKPFISSVR-
E0SB84_DICD3          AM-LMSLRGQKMAAMIHNQKNPLQDYLWNTLRRRF-----GGRLHTRNDGIKPFIGSVR-
H2IXX2_RAHAC          AM-LMAADGHPMAAMFHNQKNPLTDYLWNTVRRRF-----GGRMHARNDGIKPFISSVR-
A8GFI2_SERP5          AM-LMAARGQPMAAMFHNQSNPLVDYLWNTVRRKF-----GGRMHARNDGIKPFISSVR-
C5B9T7_EDWI9          AM-LLAAGGQPMAAMFHNQKNPLVDYLWNRARRRF-----GGRLHARNDGIKPFISSVR-
Q2NTI5_SODGM          AM-LMAARGQKMAAMFHNQSNELVDYMWNRVRRRF-----GGRMHARNDGIKPFISSVR-
LPXM_ECOLI            AM-LMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
Q32HA6_SHIDS          AM-LMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
D3QVX2_ECOCB          AM-LMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
Q1RAS9_ECOUT          AM-LMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
A0A0H2V866_ECOL6      AM-LMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
D2TMU4_CITRI          AM-LMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
H9L440_SALTY          AM-LMASQGQKMAAMFHNQGNPVFDYIWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
A0A0H3CKD2_ENTCC      AM-LMASQGQKMAAMFHNQGNKVFDFVWNTVRRRF-----GGRLHARNDGIKPFIQSVR-
A4WBL3_ENT38          AM-LMASQGQKIAAMFHNQGNKIFDYVWNTVRRRF-----GGRLHARNDGIKPFIKSIR-
E3G3L9_ENTLS          AM-LMASEGQMMAAMFHNQGNPVFDYVWNTVRRRF-----GGRMHARNDGIKPFIQSVR-
A6TB25_KLEP7          AM-LMASGGQKMAAMFHNQGNPVFDYVWNTVRRRF-----GGRMHARNDGIKPFIQSVR-
A7MEA8_CROS8          AM-LLASRGVRMAAMFHHQGNRLLDYVWNTVRRRF-----GGRLHPRQDGIKPFIKSVR-
I2BA51_SHIBC          AM-LMAAGGQKMSAMFHNQSNPVLDYVWNTVRRRF-----GGQLHARNDGIKPFISSVR-
D8MT77_ERWBE          AM-VLAYQGQKMAAMFHNQRNPLMDYVWNAIRRRF-----GGRMHARNDGIKPFISSIR-
B2VJA0_ERWT9          AM-ALASEGQRMAAMFHNQSNEVIDYVWNLVRRRF-----GGRMHARNDGIKPFISSIR-
E6WA41_PANSA          AM-LLASEGQMMAAMFHNQSDPLLDYVWNTVRRRY-----GGRMHARNDGIKPFISSVR-
E1SG01_PANVC          AM-LLASEGQKMAAMFHNQSDPLLDYAWNTARRRY-----GGRMHARNDGIKPFISSVR-
D3GX08_ECO44          AM-LLAAQGKKMAAMFHQQRNSVIDYVWNSVRRKF-----GGRLHAREDGIKPFIQSVR-
Q326Y5_SHIDS          AM-LLAAQGEKMAAMFHQQRNPVIDYVWNSVRRKF-----GGRLHSREDGIKPFIQSVR-
C1J8A7_ECOLX          AM-LIAASGRKMAAMFHNQRNPVVDYVWNSVRRRF-----GGKLHARNDGIASFVRSVR-
Q9ZGU3_ECO57          AM-LMAASGRKMAAMFHNQRNPVVDYVWNSVRRRF-----GGKLHARNDGIASFVRSVR-
A0A2S9PHC7_YERPE      AM-LLAEQGKPVAGMFHHQRNPLVDYLWNSARLHF-----GGRIHARESGIKPFISSVR-
B4EVU1_PROMH          AM-LLAAKGQKMAAMFHHQKDPVTDYLWNKARYHF-----GGRLHSREAGIKPFISTVR-
A0A140STA5_PROSM      AM-LLAAKGYKMAAMFHHQKNPVADYLWNKARYHF-----GGRLHSREAGIKPFIASVR-
D3V183_XENBS          AM-LLAARDQKVAGMFHHQSNPVADYLWNKVRTHF-----GGRLHSREAGIKPFIASIR-
D3VEW4_XENNA          AM-LLAARGYKISGMFNHQSNPVADYLWNKARQHF-----GGQLHSRDAGIKPFIASVR-
Q7MB40_PHOLL          AI-LLSVGGQKISAMFHHQKNPVADYLWNKVRHHF-----GGRLHSRDAGIKPFVAAVR-
C4K4A1_HAMD5          GM-LLTSEGKPITAMFHQQRNPLFDYLWNSARMRF-----GAYMHARKDTIKPFIHAIQ-
A3D3R9_SHEB5          GL--RLNLELPMVTMAKAHKNGLFNWFSNRVRSSC-----GGHVYMREAGIRALLAELK-
B8E7F2_SHEB2          GL--RLNLELPMVTMAKAHKNGLFNWFSNRVRSSC-----GGHVYMREAGIRALLAELK-
A9KYZ3_SHEB9          GL--RLNLELPMVTMAKAHKNGLFNWFSNRVRSSC-----GGHVYMREAGIRALLAELK-
Q8EF97_SHEON          GL--RLNLELPMVTMAKAHKNGLFNWFNNRVRSSC-----GGHVYMREAGIRALLAELK-
B8CR58_SHEPW          GL--RLNLDLPMVSMAKAHKNDLFNWFNNRMRSSQ-----GGNIYMREAGIRALLAELK-
A8H5F0_SHEPA          GL--RLNIDLPMVSMAKAHKNDLFNWFNNRMRSSQ-----GGNIYMREAGIRALLTELK-
A1SW77_PSYIN          GAAAISARGYPLSSMFKDYNNPIFDWFVTGYRTRFTKLAGKGTLYHRSEGLKPAIKSLR-
M4U7K0_9GAMM          GIGAINAAGYSLSSMFKDYNDPIFDWFVTRYRTRFIGLTGRGTLYHRSAGFKPVLKDLR-
A0A090ICU2_9GAMM      GL-HVASYGAPFCTMFNDSGNELFDWLMTRQRAKF-----GNTIYHRKAGLSALVHSLK-
A4SMY6_AERS4          GY-YFTQRGVPMCAMMKSARNPVFDWHINRERAKNGC-----RVYERSAGIKSVIRTVK-
A0KK31_AERHH          GR-YFAIRGLTMCTMMKSPKDQVFDWYINRERAKGG------KVYERSVGIKPAIKAIR-
C4L8F9_TOLAT          GL-YFSGMGLQMCTMMHNARNPVYDWFLNHQRVRFGG-----KVYERSAGLKPIIKDMR-
                      .          .  : :   : : ::     *           :. *.  . . :  :: 

A7K3H1_VIBAE          DGYVGYYLPDQDHGPEHSVFVDFFATRKATLPGLGKIAKLSRSKVLPLFASMNTEDGTFD
A7MSM0_VIBCB          DGYIGYYLPDQDHGPEHSVFVDFFATRKATLPGLGKIAKLSRAKVLPMFASMNTEDGTFD
F0LP88_VIBFN          DGYLGYYLPDEDLGREHSVFVDFFATQKATIAGLGRLSTLSKSKIVPLFAMFNSQTGQYE
A0A0H3AHB3_VIBC3      SGYVGYWVPDEDHGPQNSVFVPFFATEKATLKGFGKMAKLCKAHVVPLMSCYNSDSGRYE
Q5E3V2_ALIF1          EGYLAYYLPDEDHGPQNSVFVPFFATQKATLKGFGKLARLSKAKVVPMLPSYNSETGQFE
X2JRD1_AGGAC          QGQMGYYLPDEDFGEEQSVYVDFFATYKATLPGINKMAKLAKAVVIPMFPRYNAEAGKYQ
LPXM_HAEIN            KGEMGYYLPDEDFGAEQSVFVDFFGTYKATLPGLNKMAKLSKAVVIPMFPRYNAETGKYE
E1W6L2_HAEP3          QGQMGYYLPDEDFGAEQSVFVDFFATYKATLPGLNKMAKLAKAVVIPMFPRYNAKSGKYE
A6VMZ0_ACTSZ          NGDMGYYLPDEDFGAEASEFVDFFGTYKATLPGLNKMAKLAKAVVIPMFPRYNAERGKYE
Q65U84_MANSM          KGDMGYYLPDEDYGAQASEFVDFFATYKATLPGLNKMAKLAKAVVIPMFPRYNAKAGRYE
Q9CNR4_PASMU          QGDMGYYLPDEDYGAELSVFVDFFATYKATLPGINKIARLAKAAVIPMFPRYNALSGKYE
B0UWQ7_HISS2          KGEMGYYLPDEDYGEELSVYADFFATYKATLPGLNKMARLAKAVVIPMFPRYNAQRGKYE
F4HED7_GALAU          KGEMGYYLPDEDYGEELSVYADFFATYKATLPGLNKMCKIAKAVVIPMFARYNAQQGRYE
G1UBA3_HAEDU          KGNMGYFLPDEDFGEELSVYADFFATEKATLPGLNKMARVANAEVIPMFPIYNAEKGVYQ
A3MYP4_ACTP2          KGNMGYFLPDEDFGEELSVYADFFATEKATLPGLNKMARVANAEVIPMFPIYNAEKSLYQ
B8F7A9_GLAP5          KGCLGYFLPDEDFGEALSVYVPFFATEKATLPGLAKMARVANAVVIPMFPIYNAEKGVYQ
Q6D4B1_PECAS          SGCWGYYLPDQDHGPEHSEFVDFFATYKATLPAVGRLMKVCRADIVPLFPVYNAKDGCLD
E0SB84_DICD3          EGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAVGRLMKVCRAEIVPLFPVYDGKTSQLD
H2IXX2_RAHAC          QGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAVGRLMKVCRASIIPLFPVYNGREQRLD
A8GFI2_SERP5          QGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAVGRLMKVCRAAIVPLFPVYDGKTSMLD
C5B9T7_EDWI9          KGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAIGRLMKLCRARIIPLFPVYDGDKGRLD
Q2NTI5_SODGM          QGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAIGRLMKVCRATVVPLFPVYDGNTSLLH
LPXM_ECOLI            QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPIYDGKTHRLT
Q32HA6_SHIDS          QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPIYDGKTHRLT
D3QVX2_ECOCB          QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPIYDGKTHRLT
Q1RAS9_ECOUT          QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPIYDGKTHRLT
A0A0H2V866_ECOL6      QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPIYDGKTHRLT
D2TMU4_CITRI          QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVIPLFPVYNGKTHRLT
H9L440_SALTY          QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVIPLFPVYNGKTHRLT
A0A0H3CKD2_ENTCC      QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCRARVIPLFPVYDGNTHRLS
A4WBL3_ENT38          QGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVCGARVVPLFPIYNGKTHRLT
E3G3L9_ENTLS          QGYWGYYLPDQDHGEEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPVYNGKTHRLT
A6TB25_KLEP7          QGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAIGRLMKVCRARVVPLFPVYDSKTHRLT
A7MEA8_CROS8          EGYWGYYLPDEDHGPEQSEFVDFFATYKATLPAVGRLMKVCNARVIPLFPVYNAKTHRLD
I2BA51_SHIBC          KGYWGYYLPDQDHGAEHSEFVAFFDTYKATLPAIGRLMKVCRARVVPLFPVYNGDTHRLD
D8MT77_ERWBE          QGYWGYYLPDQDHGPEQSEFVDFFATYKATLPAVGRLMKVCRARVIPLFPVYNSKTHQMD
B2VJA0_ERWT9          QGYWGYYLPDQDHGADHSEFVDFFATYKATLPAVGRMMKVCRAKVVPLFPVYDSKTHSLD
E6WA41_PANSA          QGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAVGRLMKVCRARVVPLFPVYNSKTHRLE
E1SG01_PANVC          QGYWGYYLPDQDHGAEHSEFVDFFATYKATLPAVGRLMKVCHARVVPLFPVYNSETHKLE
D3GX08_ECO44          QGYWGYYLPDQDHGPEYSEFADFFATYKATLPIIGRLMNISQAMIIPLFPVYDEKKHLLT
Q326Y5_SHIDS          QGYWGYYLPDQDHGPEYSEFADFFATYKATLPIIGRLMNISQAMIIPLFPVYDEKKHFLT
C1J8A7_ECOLX          QGYWGYYLPDQDHGPEFSEFADFFATYKATLPVIGRLSRISGARIIPLFPVYDGKTHHLT
Q9ZGU3_ECO57          QGYWGYYLPDQDHGPEFSEFADFFATYKATLPVIGRLSRISGARIIPLFPVYDGKTHHLT
A0A2S9PHC7_YERPE      QGFWGYYLPDEDYGPEQSEFVDFFATYKATLPAIGRLMKVCRAAIVPMFPVYNYREHRLD
B4EVU1_PROMH          QGFWGYYLPDQDHGAEHSQFVDFFGTYKATLPAIGRLMKVCRAAIVPLFPVYCHKTHQLK
A0A140STA5_PROSM      QGYWGFYLPDQDHGEEHSEFVDFFATYKATLPAVGRLMKVCKAKIVPLFPVYDHRTHQLH
D3V183_XENBS          QGHLGYYLPDQDHGEEHSEFVDFFATYKATLPAIGRLMKVSRAAVVPLFPVYNCQTHQLD
D3VEW4_XENNA          DGFWGYYLPDQDHGEEYSEFVDFFSTYKATLPAIGRLMKVCRASIVPLFPVYNCETHQLD
Q7MB40_PHOLL          QGFWGYYLPDQDHGEEHSEFVDFFATYKATLPAIGRLMKVCRAAIVPLFPVYNYRTHQLD
C4K4A1_HAMD5          QGFWGHYAPDEDYGPEKSIFVDFFDTYKATLPTLGRLMKICNAVVIPIFPVYNYRTHRMD
A3D3R9_SHEB5          CGNSFFYLPDEDLGPEQSVFAPFLGTVKATLPVVGRLAQAGNAQVLPVKIGYNQTSRQFD
B8E7F2_SHEB2          RGNSFFYLPDEDLGPEQSVFAPFLGTVKATLPVVGRLAQAGNAQVLPVKIGYNQTSRQFD
A9KYZ3_SHEB9          RGNSFFYLPDEDLGPEQSVFAPFLGTVKATLPVVGRLAQAGNAQVLPVKIGYNQATRQFD
Q8EF97_SHEON          RNNSFFYLPDEDLGPDQSVFTPFLGTVKATLPVVGRLAQAGNAQVLPVKIGYNQVTRQFD
B8CR58_SHEPW          QDNSFFYLPDEDLGPDKSVFAPFLGTTKATLPVVGRLAQAGNAQVMPVKIGYDQVKRQYQ
A8H5F0_SHEPA          QDNSFFYLPDEDLGRDKSIFAPFLGTTKATLPVVGRLAQAGNAQVMPVKIGYDQVKRHFD
A1SW77_PSYIN          DKAHFYYLPDEDHGRENSIFTDFYATKKATLPVIGRLAKLGRAVVIPVYTSYNANTSKID
M4U7K0_9GAMM          NKIHFYYLPDEDHGRENSLFTSFYATQKATLPVLGRLTKLGRAVVIPFYTSYNEKTAQYD
A0A090ICU2_9GAMM      KGESCYYLPDEDHGPKRSVFAPLFSTQKATLPVLGKLAQKTGATVVPMYAAYNETRGKFE
A4SMY6_AERS4          RGHSFFYLPDQDHGREASIFAPFFGYPKATLPALPRLVQVSGAKAVPMLACYDEAKYCYR
A0KK31_AERHH          SGASFFYLPDQDHGREASIFVPFFGYPKATLPALPKLVKLTGARAVPILACYDEEEGCYR
C4L8F9_TOLAT          NGYHFFYLPDQDHGHEASVFVSLFGVPKATLPALPKLAKLSGAIVLPVLATYNETSRKYE
                           .: **:* *   * :. :    ***:  . ::     :  :*.            

A7K3H1_VIBAE          IEILPAFE--LDKGEE-QDARTCNEAIEYFVGDKPEQYMWVLQLLHSQEDGNNYYNIFKP
A7MSM0_VIBCB          IEILPAFE--LDKGEE-QDARTCNQAIEYFVANKPEQYMWVLQLLHSQEDGNNYYNLFKP
F0LP88_VIBFN          LDFYPELP--FPTGDEHQDARMMNECIENYVSQRPEQYMWILRLLKTRPDSN--------
A0A0H3AHB3_VIBC3      VHILPALQN-FPTGDEEADALAMNRAIEALVTPQPEQYMWNLSLLKTQRDGRE-------
Q5E3V2_ALIF1          IITLPAIAD-FPSGDEETDARAMNIAIEQLVTERPEQYMWVLNLLRSRPGGSR-------
X2JRD1_AGGAC          MEIHLAMA---LSDDPEQCARAMNAEIESFVTETPAQYVWILQLLRTRKNGE-------D
LPXM_HAEIN            MEIHPAMN---LSDDPEQSARAMNEEIESFVTPAPEQYVWILQLLRTRKDGE-------D
E1W6L2_HAEP3          MEIRPPMQ---LSEDPEQSARAMNEEIEYFVTPTPEQYVWILQLLRTRKDGE-------D
A6VMZ0_ACTSZ          MEIHPPME---LSDDPLQSARAMNEEIERFVIPQPEQYVWILQLLRTRKNGE-------D
Q65U84_MANSM          MEIHPAME---LSEEPKQSARSMNAEIESFVSPAPEQYVWILRLLKTRKDGK-------D
Q9CNR4_PASMU          IEIHPAMT---LSDDPEQAARAMNQEIESFVTATPAQYVWILRLLKTRKDGT-------D
B0UWQ7_HISS2          IEICAPLE---LTEDPEQSARMMNQAIEYFVTPTPEQYVWILRLLKTRKDNE-------D
F4HED7_GALAU          IEIDAPLA---LTDDEQQSARLMNEVIEKFVTVTPEQYVWILRLLKTRKDGV-------D
G1UBA3_HAEDU          MEILPAIE---FSGSSAQSAREMNKVIEYFVHKNPAQYVWILRLLKTQRNGQ-------D
A3MYP4_ACTP2          MEILPALE---FSGDPVQSAREMNKVIEYFVTKNPEQYVWILRLLKTRRNGE-------D
B8F7A9_GLAP5          IEILPPLE---FAGDEQQSARQMNEVIEYFVPKNPEQYVWILRILKTRRDGE-------D
Q6D4B1_PECAS          VFIRPPMD-DLAEADDAYIARRMNEEVEILVRPNPEQYTWILKLLKTRKPGEI------E
E0SB84_DICD3          VYIRPPMS-DINGADDHTIARRMNEEVELLVTPNPEQYTWILKLLKTRKPGET------E
H2IXX2_RAHAC          IYVRPPMD-DLATADDNRIARRMNEEVEVLVGPNPEQYTWILKLLKTRKPGEP------E
A8GFI2_SERP5          VYIRPPMD-DLATADDHTIARRMNEEVENLVGPNPEQYTWILKLLKTRKEGEI------E
C5B9T7_EDWI9          IYLRPSMD-DIAGQDDDYIARRMNQEVELLMGEHPEQYTWILKLLKTRRPGEI------E
Q2NTI5_SODGM          IHLLPPIA-DLTDSDEATVARRMNEAVETLVRPNPEQYTWVLKLLKTRKPGDP------N
LPXM_ECOLI            IQVRPPMD-DLLEADDHTIARRMNEEVEIFVGPRPEQYTWILKLLKTRKPGEI------Q
Q32HA6_SHIDS          IQVRPPMD-DLLEADDHTIARRMNEEVEIFVGPRPEQYTWILKLLKTRKPGEI------Q
D3QVX2_ECOCB          IQVRPPMD-DLLEADDHTIARRMNEEVEIFVGPRPEQYTWILKLLKTRKPGEI------Q
Q1RAS9_ECOUT          IQVRPPMD-DLLEADDHTIARRMNEEVEIFVGPRPEQYTWILKLLKTRKPGEI------Q
A0A0H2V866_ECOL6      IQVRPPMD-DLLEADDHTIARRMNEEVEIFVGPRPEQYTWILKLLKTRKPGEI------Q
D2TMU4_CITRI          ILVRPPMD-DLLTADDNTIARRMNEEVEIFVGPQPEQYTWILKLLKTRKPGEI------Q
H9L440_SALTY          IQIRPPMD-DLLTADDHTIARRMNEEVEIFVGPHPEQYTWILKLLKTRKPGEI------Q
A0A0H3CKD2_ENTCC      IEVRPPMD-DLLTADDNTIARRMNEEVEVLVGPHLEQYTWILKLLKTRKPGEK------E
A4WBL3_ENT38          IEVRPPMD-DLLTADDHTIARRMNEEVEILVGPHLEQYTWILKLLKTRKPGEK------E
E3G3L9_ENTLS          VEVRPPMD-DLLTADDNTIARRMNEEVEIFVGPHPEQYTWILKLLKTRKPGET------E
A6TB25_KLEP7          VLVRPPMD-DLLDADDTTIARRMNEEVEVFVKPHTEQYTWILKLLKTRKPGEI------E
A7MEA8_CROS8          VLIRPPMD-DLANADDVTLARRMNEEVEHFVGPHPEQYTWILKLLKTRKAGET------E
I2BA51_SHIBC          IYIRPPMD-DLLDADDNTIARRMNEEVEIFVRPHPEQYTWILKLIKTRKPGEI------Q
D8MT77_ERWBE          IYLREPMD-DLVNVDDHTLARRMNEEVEMLVRPNPEQYTWILKLLKTRKEGDI------E
B2VJA0_ERWT9          IYLHAPMD-DLPDTDDVTQARRLNEEVEAFVRPHPEQYTWILKLLKTRKPGET------E
E6WA41_PANSA          VYVRPPMD-DLLDADDKTLARRMNEEVEIFVRPHPEQYTWILKLLKTRKEGDI------E
E1SG01_PANVC          IYVRPPMD-DLLEADDHQLARRMNEEVEVFVRPHPEQYTWILKLLKTRKEGDI------E
D3GX08_ECO44          IEIRPPMDACIASADNKMIARQMNKTVEILVGPHPEQYVWVLKLLKTRKSNEA------D
Q326Y5_SHIDS          IEVRPPMDACIASADNKMIARQMNKTVEILVGSHPEQYIWVLKLLKTRKSNEA------D
C1J8A7_ECOLX          IHVSPPL--AIRQKSDAHIARQINEVVENFVRPHPEQYTWILKLLKTRKEGEE------D
Q9ZGU3_ECO57          IHVSPPL--AIRQKSDAHIARQINEVVENFVRPHPEQYTWILKLLKTRKEGEE------D
A0A2S9PHC7_YERPE      IYIRPPMD-DLADADDAYIARRMNEEVELLVKPNPEQYTWILKLLKTRKEGET------E
B4EVU1_PROMH          IIIREPMD-DIEGQDDRYIARRMNEELEALVSPTPEQYTWILKLLKTRKEGEI------E
A0A140STA5_PROSM      IYIREPMD-DIDGQDDEYIARRMNEELEYLVGPNPEQYTWILKLLKTRKGDEI------E
D3V183_XENBS          IYIRPPMD-DIEGQDDTYIARRMNQELEELVRPNPEQYTWILKLLKTRKAGDI------E
D3VEW4_XENNA          IYIRPPMD-DIAGQDDAYIARRMNQELEELVTPNPEQYTWILKLLKTRKAEDI------E
Q7MB40_PHOLL          IYIRPPMD-DIDGKDDAFIARRMNEELEQLVRPNPEQYTWILKLLKTRKAGDI------G
C4K4A1_HAMD5          IFIRPPMN-QLLAAEDAEVARHINKELEIFLIRYPSQYIWSLKLLKTRRKGEI------E
A3D3R9_SHEB5          LTVMTAVA-PEDMVGKENEALALNKVVEQVILAYPEQYMWFLRVLKTRPEGEASIYGQ--
B8E7F2_SHEB2          LTVMTAVA-PEDMVGKENEALALNKVVEQVILAYPEQYMWFLRVLKTRPEGEASIYGL--
A9KYZ3_SHEB9          LTVMTAVA-PEDMVGKENEALALNKVVEQVILAYPEQYMWFLRVLKTRPEGEASIYS---
Q8EF97_SHEON          LTVMSAIA-TEDMVGKENEALALNKAVEQVILAYPEQYMWFLRLLKTRPEGQASIYQ---
B8CR58_SHEPW          LSVMPAIA-PEDMQGKENEAIALNKAVEQVILAYPEQYMWFLRVLKTRPEGEESIYN---
A8H5F0_SHEPA          LTVMPAIS-PETMQGKENEAIALNKAVEQVILAYPEQYMWFLKVLKTRPEGEESIYK---
A1SW77_PSYIN          VICHAPLQ-NFPQGDELQQTELMNRAIEKVIDENRAQYMWTLKLLKTRPEEGVDIYK---
M4U7K0_9GAMM          VFFHAPLE-GLASGDELQDTQIMSAAIERLIDEDRSQYMWSLKLLKTRPEEGLDIYK---
A0A090ICU2_9GAMM      TFILPAMQ-NFPSESPEQDAIMMNKEIEALIECGIDQYMWTLRLLRTRPD-GKKIY----
A4SMY6_AERS4          LEIEAPFA-DYPSADLMADTCRMNNMIEQQLTRDPGQYMWFLKIFDTREEQEGSDGLYEE
A0KK31_AERHH          LEIEPPFD-PYPGADLVADVCAMNGMVEQQLRQHPEQYMWFLKIFETMEHQQGSDGFYEE
C4L8F9_TOLAT          LQIRPAMA-PYPTSDLMADVQYMNTEIEFLLKNQPEQYMWFLKYFRSLP---------DG
                            .            .   .  :*  :     ** * *  : :             

A7K3H1_VIBAE          RYDTDWQVNK---
A7MSM0_VIBCB          RYNTDWQISK---
F0LP88_VIBFN          -VNPYTQNKK---
A0A0H3AHB3_VIBC3      IYDNSHHGDQS--
Q5E3V2_ALIF1          LY-----------
X2JRD1_AGGAC          LYD----------
LPXM_HAEIN            LYD----------
E1W6L2_HAEP3          IYPD---------
A6VMZ0_ACTSZ          IYH----------
Q65U84_MANSM          IYQ----------
Q9CNR4_PASMU          IYA----------
B0UWQ7_HISS2          IYR----------
F4HED7_GALAU          IYQ----------
G1UBA3_HAEDU          IYKRS--------
A3MYP4_ACTP2          IYKR---------
B8F7A9_GLAP5          IYKR---------
Q6D4B1_PECAS          PYCRDELYRNKK-
E0SB84_DICD3          PYLRKDLYPRKK-
H2IXX2_RAHAC          PYSRKELYPKK--
A8GFI2_SERP5          PYSRDDLYR----
C5B9T7_EDWI9          PYCRQDL------
Q2NTI5_SODGM          PYKRPSR------
LPXM_ECOLI            PYKRKDLYPIK--
Q32HA6_SHIDS          PYKRKNLYPIK--
D3QVX2_ECOCB          PYKRKDLYPIK--
Q1RAS9_ECOUT          PYKRKDLYPIK--
A0A0H2V866_ECOL6      PYKRKDLYPIK--
D2TMU4_CITRI          PYKRKDLYPIK--
H9L440_SALTY          PYKRKDLYPIK--
A0A0H3CKD2_ENTCC      PYQRKELYPKK--
A4WBL3_ENT38          PYRRKELYPKK--
E3G3L9_ENTLS          PYRRKDLFPKK--
A6TB25_KLEP7          PYKRKELFPKKK-
A7MEA8_CROS8          PYRRKDLYPK---
I2BA51_SHIBC          PYKRKDLYR----
D8MT77_ERWBE          PYKRKDLYGKK--
B2VJA0_ERWT9          PYDRKELYPKK--
E6WA41_PANSA          PYVRKDLYPRK--
E1SG01_PANVC          PYSRKELYPRK--
D3GX08_ECO44          PYP----------
Q326Y5_SHIDS          PYP----------
C1J8A7_ECOLX          PY-----------
Q9ZGU3_ECO57          PY-----------
A0A2S9PHC7_YERPE      PYVRKDL------
B4EVU1_PROMH          PYARENILD----
A0A140STA5_PROSM      PYQRDDLYR----
D3V183_XENBS          PYKRKDL------
D3VEW4_XENNA          PYKREDL------
Q7MB40_PHOLL          PYGREDL------
C4K4A1_HAMD5          PYLREDI------
A3D3R9_SHEB5          -------------
B8E7F2_SHEB2          -------------
A9KYZ3_SHEB9          -------------
Q8EF97_SHEON          -------------
B8CR58_SHEPW          -------------
A8H5F0_SHEPA          -------------
A1SW77_PSYIN          -------------
M4U7K0_9GAMM          -------------
A0A090ICU2_9GAMM      -------------
A4SMY6_AERS4          GIKRIRGDLPPGA
A0KK31_AERHH          GIKRIRGDLPPGE
C4L8F9_TOLAT          GKRSYRPE-----