CLUSTAL format seed alignment for MF_01947

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

I0GIV4_CALEA          -------------------------------MIDLKILTWEVVMDRTSLQILRAVWKKPL
F8C1V8_THEGP          ----------------------------------------MGELERIKKQILRQLVKKPS
D3RZV7_FERPA          ------------------------------------------MMERIRKQILQALAGGEI
O28662_ARCFU          ------------MIQARSRRPLSCSLRSSSQNPIATTFLTGGKMDRIVRQILVKLLGGER
F2KPH1_ARCVS          ------------------------------------------MMERIRRQIIQALDG-EI
D2RGL4_ARCPA          ------------------------------------------MMRRIKNQVLQALYRREM
A0A5A7RRH3_9EURY      -------------------------------------------MERVRQQILSLLSSGSY
B5IG62_ACIB4          ------------------------------------------------------------
D3TCM5_ACIB4          ------------------------------------------------------------
L0HI62_ACIS0          ----------------------------------------------------MRYLSRER
Q3AF56_CARHZ          ----------------------------------MSTSGSAVEVRRIDALLLRALYGGSK
L8A0N0_9BACI          ----------------------------------MSKVGIAAESRRIDTLLLRALCFGPK
B6YXN5_THEON          ----------------------------MREIVERVKEKTSIPVYDRTIENVLSAVLASS
BPSA_THEKO            ----------------------------MREIIERVKEKTTIPVYERTIENVLSAIQASG
H3ZM66_THELN          -----------------------MEGAEMKAIVERVREKTSIPVYERTIENVLSAILASS
F0LHU2_THEBM          ---------MLNTLYGLFKSLKTWEVLKVREIIAKVKEKTNIPVYERTIENVMSAVLASS
Q8U1U4_PYRFU          ----------------------------MKEIVERVKTKTKIPVYERSVENVLSAVLASD
F6BCR9_METIK          ----------------------------MKEIVAKVKERTSIPVYERSVENVISAIMTSG
BPSA_METJA            ----------------------------MERILEKVRAKSEIPVYDKSIENVLSAILTTN
D5VU30_METIM          ----------------------------MKDLLEKVREVSEIPVYEKSIENVLSSILLTG
C0QRB1_PERMH          ------------------------MAEVLKKIAERATEKTNIRLIPRNVERILAALQVTS
B2V717_SULSY          -----------------------MAREVLDLIAKRASEKTNIKLYGRSVERVLAGLLTTS
D3SLQ5_THEAH          -------------------------MNPLVKLAERAREVGQVRVYKKSVERVLSALLKSG
D3DIS8_HYDTT          -----------------------MAVSLLVELAFKAREESQVRIYQKNVERVLSALLKSG
B4U8R0_HYDS0          ----------------------MSTANKLVELAEKAKEKGGVKLYKKNIEMVLSGLLITG
O67635_AQUAE          -------------------------MNILERIAKEVQEETKVRLHARNVERVLQALLKTG
E8T4D0_THEA1          -------------------------MEILEQIAQEAEQNTQVPAYPRSVEKVIAAVMSSP
F0S1F5_DESTD          -------------------------MEILKQIAQEAEKNTQVPAYPRSVEKVIAAVISTP
G7V6G1_THELD          ----------------------MNARSKTKAYAEEVALNTKIEVRKRDVERILSAIMNNS
I4BUP9_ACEMN          --------------------------MDKDVLARDVANVTKIPWNGRNVERVLSSLLITG
D7AQQ3_THEM3          -------------------------MENLQDIAHQIYQKTGVMTSSKDVEKILSAAAATP
B0K6E3_THEPX          -------------------------MENLQDIAHQIYQKTGVMTSSKDVEKILSAAAATP
Q8R8U3_CALS4          -------------------------MKKLQEIAEEISRNTGVVTSAKDVEKILSASASTN
D9RYF7_THEOJ          --------------------------MDIKGIAEEVCKKTGVETTGRDVEKVLSGLTSSS
A4XIU9_CALS8          -------------------------MDELKGAVEFVKNKTKVNVTQRDFEKILAALNSTN
B9MM50_CALBD          -------------------------MDVLKGAVDFVQNKTKVEVNQRDIEKILSALNSTN
C9RAV3_AMMDK          ----------------------------MEAYAAELTKRTGIPITSADLKKVLGALACAK
D0MEY5_RHOM4          -------------MPHTKTFPETSAVELRDRLLETVRQQMPVPFTERDAERALAALLTTD
Q5SKV4_THET8          -----------------------MNKEALVQVAEEVRRATGLPVGWRDVERTLGALRATR
H5STM4_ACEAU          MLGRKERLFAQWCGCVEGKSILLLQVIAMQEVLQHLQRRS-SSLAAGDLRRMLQALSREQ
                                                                                  

I0GIV4_CALEA          DVWELVIMQDNDIKNTYETLNSLKDKGLIEYSKN-KIKITEKGIDELIKENAIPYIDTKC
F8C1V8_THEGP          TFWELINYQDSHIVTFLQAIKDLLNEKLIIYEKP-FFHINNN-------LDVPPYKNPGC
D3RZV7_FERPA          SVYKLIDLQDASLPEFFQLLQEMEEGEIIQISDG-KVGLTEKGRELAEKLGAKYF-DVSC
O28662_ARCFU          SVYELIYYQDASLREFFELLNSLRDEGLIEVESG-KVRITEKGREVAEKERLKFCGDVEC
F2KPH1_ARCVS          SVYRLIDSQDSSLPEFFKLLQDMEKEGLISVRDG-RVSLTSEGRKLREE--IARDADIVC
D2RGL4_ARCPA          SVYELIDEQDASLPEFFELIQSMEREGLIKVENG-MISLTDKGLKLCEELGVKKVEKLTC
A0A5A7RRH3_9EURY      SIWYVIDYQDASIPEFFKLIEEMESEGIIKIENG-MISLTEKGKKEAEG---MQFHDFTC
B5IG62_ACIB4          -------MVDADLNEFINSLKNLMDEGLVESRNG-KLYLTEAGRKEREK-YNLEIYDIRC
D3TCM5_ACIB4          --------MDADLNEFINSLKNLMYEGLVESRNG-KLYLTEAGRKEREK-YNLEIYDIRC
L0HI62_ACIS0          SPWELIKLVDSDLNEFVETLKILMDDGLVESRGG-ILYLTPMGIEERES-LNLKDYDTRC
Q3AF56_CARHZ          SYWELMRAGQAQTHQVLKVLQSLLESKLVTYDGE-RFVLTEAGRRQVEALGLDRVAEQRC
L8A0N0_9BACI          SYWELMREGKAQTHQVLKALQSLLEGELAAYNGD-RFVITEKGRRQAETMGLERVAEQRC
B6YXN5_THEON          DVWRIVDLSEEPLPLVVAVITALHELGYIAFEEN-GVRLTAKGKELVEKYGIGSRKDYTC
BPSA_THEKO            DVWRIVDLSEEPLPLVVAVVTALYELGYVAFENN-QVILTRKGKELVEKYGIGPRADYTC
H3ZM66_THELN          DPWRVVDLSEEPLPLVVAVVEALHDLGYVEFKD--GIILTQKGKELVEKYGIGRREDYTC
F0LHU2_THEBM          DIWRIVDLSEEPLPLVVAVLETLNELGYVEFRD--GVFLTEKGRKFAEEYGIGKREDYTC
Q8U1U4_PYRFU          DIWRIVDLSEEPLPLVVAILESLNELGYVTFED--GVKLTEKGEELVAEYGIGKRYDFTC
F6BCR9_METIK          DFWSIVDVSEEPLPLVCDIIDVLKENGYVEIKEN-EIVLTNKGEEFAKELGIGPKINATC
BPSA_METJA            DFWKIVDLSEEPLPLVADIIRILEEEGLVKISN--GIEFTEKGNEFIKSYGIGAKDNSVC
D5VU30_METIM          DFWKIVEYSEEPLPLVADIIRVLEKEGLVKIED--EIKLTEKGLSFIKEYGIGKKEINVC
C0QRB1_PERMH          DFWKVVDYSDLPVPAASEISKGLIEEGFVKVENDE-LFLTEKGLNLVKELNIPPYVDYTC
B2V717_SULSY          DFWKVVDLADQPVPATAEIVRQLVAEGIAKIENDE-ILLTEKGFNLVKELKIPPAVDYSC
D3SLQ5_THEAH          DFWEVVDMSDLPVPAASAIVKVLIEEGLAFIDDTEDIRLTQKGMDLVRELGIEPYVDYAC
D3DIS8_HYDTT          DFWEVVDMSDLPVPAASGIIKVLIREGYAFIDDEENIRLTQKGYDLIKDLGIEPYVDYVC
B4U8R0_HYDS0          NFWSIVDYADLPVPAAAGIVNTLLEEGYVFVDQNQDVRLTQKGYDLIKEYNIHPRKEHKC
O67635_AQUAE          DFWKIVDYSDLPVPAASGIIKKFLDEGIVFIDENENILFTQKGLDLVKELGIEPFEEHKC
E8T4D0_THEA1          NFWKIVDLSDEPLPLVAEILKLLNKRDLVVFEGN-QILLTEAGAELAKKLGIEPFASHRC
F0S1F5_DESTD          NFWKVVDLSDEPLPLVAEILKLLNKHGLVVFEGN-QILLTEAGNELVKKLGIETFVSHRC
G7V6G1_THELD          NFWKIVQLSEEPVPVVAELIKIMERDGFVAIEGD-QIKFTDDGKALCKDEGIEPLHIHSC
I4BUP9_ACEMN          DFWNVVSLSCEPLPAVAALLKLMAEEGMVAFSEY-GIKLTQRGRDFIEKEGVSPWHLHTC
D7AQQ3_THEM3          HFWEIITLSQKPFSVVAEIIEILRQKNLLEVDKSGDIKFNSKGLEYLDNLKIAPTRTYTC
B0K6E3_THEPX          HFWEIITLSQKPFSVVAEMIEILRQKNLLKVEKNGDIKFNSKGLEYLGSLKIAPKRTYTC
Q8R8U3_CALS4          HFWEIITLSQKPFPVVAEAVEILRKEGFVAVTEEKEIKFTEKGMEYLKEQNIFPKRTYTC
D9RYF7_THEOJ          HFWEVVCTAREPFSVVAEVVEVLKRTRLVKVDEQGDIYFTPEGMKFLKSRGITPRKDYTC
A4XIU9_CALS8          HFWEVVFLSQKPFAVVRETINYLISIDFVKSDDSGNLELTKKGKEFVEKNNIPVVKNYTC
B9MM50_CALBD          HFWEVIFLSQKPFAVVRETINYLISIDFVKTDESGNLILTEKGKEFISANNIPVVKNYTC
C9RAV3_AMMDK          EFWHITHLSGRPFNVVAESLKFFAERGWVKVENQ-HLELTPAGRKLVDEQGIKPPIESGC
D0MEY5_RHOM4          NLWEAIRLSRVPLRVLSAFWHRLIAEGLLEAHDG-ALRLTESGQALAQALGVAPVREATC
Q5SKV4_THET8          DLWEAVRLSRVPLRFLVPIWEGLARRGLLRVEEG-LDLLAE--------VPAPRPGEAAC
H5STM4_ACEAU          DIWQAAGACERPFPQFVALIETLCELGYLSKKDGRTLEVTPAGRVAFERWGVALSPPLST
                                            :               .                     

I0GIV4_CALEA          EYCRGKIYDP-KNFKEILDVFKEIFANRPMETTEFDQGVVSEENSVRRLEFVYERGDLEG
F8C1V8_THEGP          LMCSPFTED--IFWKNILDKFLELVKDRPLPTSDFDQGFIKPEDTLKRTAFIYKRGDLED
D3RZV7_FERPA          EHCEYTGLKIHDFFKDVLDKYLEIAKERPETVEEYDQGYISPEGVIKRVEFVYERGDLLK
O28662_ARCFU          ECCEGTGLSINPYFKEILQKYSEIAKDRPETIEVYDQGFISLEGVIRRVEFVYDRGD-LN
F2KPH1_ARCVS          SCCGGTGYVIDGFFKDVLRQYQEIAKERPEAIEVYDQGFISTDGVMRRAEFIYERGD-LA
D2RGL4_ARCPA          DCCEGTGYAIKGIFESTLKEYSEIAKDRPEAIEVYDQGFISLDGVIRRVEFLFERGDLLK
A0A5A7RRH3_9EURY      KECMGTGYEL---WEEIKKDYESIAASRPPPEAKYDQGYISIDGVIRRLSFIFERGD-IY
B5IG62_ACIB4          PDCEGRGIVEDP--FGILKEYKNIASQRPKPTADYDQGYIKEEDVMRRIAFIYERGDLED
D3TCM5_ACIB4          SDCEGRGIVEDP--FGILKEYKNIASQRPKPTADYDQGYIKEEDVMRRIAFIYERGDLED
L0HI62_ACIS0          PGCDGRGIVEDP--FGVLDEYKKITSQRPKPTADYDQGYIKEEDVMRRIAFIYERGDLEN
Q3AF56_CARHZ          ETCAGRGIVLRPPFDRVLETFQKMVTMRPKATPNFDQGYVTVETTVLRLALMAQRGDLVG
L8A0N0_9BACI          EVCAGRGIVLRPPFDSVLAAFQDIAAMRPKATPDFDQGYVTPETTVRRLALMAQQGDLMG
B6YXN5_THEON          SHCEGKTVELDAF-SDLLEQFKEIVKDRPQPLHDFDQAYVTPETTVARIALMHTRGDLEN
BPSA_THEKO            SHCQGRTVEIDAF-SELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLEN
H3ZM66_THELN          SHCQGKTVELDAF-RDLLEEFKEIVKNRPEPKHEFDQAYVTPETTVARVALMHTRGDLEN
F0LHU2_THEBM          PHCEGKTVDINAF-SDLLEQFKEIVKDRPQPKHEFDQAYVTPETTVARIILMHTRGDLEN
Q8U1U4_PYRFU          PHCQGKTVDLQAF-ADLLEQFREIVKDRPEPLHEFDQAYVTPETTVARVILMHTRGDLEN
F6BCR9_METIK          KCCEGRAVSLDDY-KDLLERFKEIVKNRPQPLHEFDQGYVTPETTVSRVILMHSRGDLLN
BPSA_METJA            ECCEGRGVSLKNY-QDLLERFKEIVKNRPMPKHEYDQGFVTPECTISRIALMNSRGDLFN
D5VU30_METIM          ECCEGRGISLKNY-KELLEKFKEITKDRPLPKHEYDQGFVTPECTVARVALMNSRGDLFN
C0QRB1_PERMH          QACEGRGIPFYAN-KEWYRTFVELAKDRPKAIQEYDQGSVTPETTVSRVLFLDSREDLRN
B2V717_SULSY          KACEGRGIPFYAN-LDWYRTFLQVTKDRPKAIQEYDQGSVTPETTVSRVLFLDSREDLRD
D3SLQ5_THEAH          GACEGRGIPFYAD-IEFYREFLQITKDRPKAIRDYDQGSVTPETTVARVLFMDSRGDLRN
D3DIS8_HYDTT          QACEGRGIPFYTD-IEFYRTFLQLTKDRPKAIRDYDQGSVTPETTISRVLFMDSRGDLRN
B4U8R0_HYDS0          QACEGRGIPFYLD-IELYRAFLQETKNRPKAIQDYDQGSVTPETTVSRVLFIDSRGDLQG
O67635_AQUAE          RACEGRGIPFYDD-KELYRTFVEIAKDRPKPVQQYDQGSVTPETTVSRVLFLDSRGDLRG
E8T4D0_THEA1          PTCNGRGVVIDDSLRPAFEKFLEIQKNRPPAIHQYDQGYVTPENTFARVALADDRGDLRG
F0S1F5_DESTD          SCCNGRGVVIEGSLKEAFEKFLKIQEKRPPAIHQYDQGFVTPENTFARVALADDRGDLRG
G7V6G1_THELD          PTCSGRTVILDESLKEPYDKFLELHVERPEAIRQYDQAYVTPETTFSRIALADSRGDIRN
I4BUP9_ACEMN          PRCEGRTVVIDDELKDAFDRFLKIQIDRPEAIRDYDQGYVTPETTFARVALADSRGDLRG
D7AQQ3_THEM3          PHCEGRGINLSKL-EDLIKKFDQVTANRPKAISDYDQGFVTTQTVMGRIALMAERGDLEG
B0K6E3_THEPX          HACEGRGINFSKL-EDLIKKFDQVTVNRPKAISDYDQGFVTTQTVVGRIALMAERGDLEG
Q8R8U3_CALS4          PHCEGRGINLSLL-SDLIKKFDEVTEDRPKAISDYDQGFVTTNTTIARIALMAERGDLEG
D9RYF7_THEOJ          PACEGRGIGLEKL-KELVQKFDEVTADRPKAIIDYDQGFVTTRTVVSRIALMADRGDLEG
A4XIU9_CALS8          QCCEGRGIVFDEI-KDAYEKFKEIVKTRPDAIVEYDQGYVTEETAFSRIALMIKKGDLVG
B9MM50_CALBD          SYCEGRGIVFSEI-KDAYEKFKEIVKTRPDAIVEYDQGYVTEETAFSRIALMIKKGDLVG
C9RAV3_AMMDK          KACNRRGISIERW-QDLLNRFKEVVAERPLPIIDYDQGFVTEETTVARIALMADRGDIQG
D0MEY5_RHOM4          VHCEGRSVDYRTLPEDVVERFAEICRHRPEAIQDYDQGFVTEATTLARIAFAWHRGDLEG
Q5SKV4_THET8          PACEGRGLVGERLPGRAAERFLAWAKERPEAIQDFDQGYVTPESTLARVALAWNWGDLEG
H5STM4_ACEAU          PCPHCAIGPAPLP--ELQKHFTQIAQHRPPVAQEFEQGFLTADSVIRRVAWLDRCGDLAQ
                                          :      **     ::*. :.    . *        *   

I0GIV4_CALEA          REIFFLG-DDDLTSIVFALSKMPKRVVVFDVDRRIIEYIKEVSKKYNL-NIEAYEYNASN
F8C1V8_THEGP          SEIFILG-DDDLISLSMALTKLPKRIVVVEIDERINKFIKEKAKEIRYENIEVYNYNVIY
D3RZV7_FERPA          SRIFVVG-DDDLFSIAAALTGMPEKIFVVDIDERLINFINKVAEEYSL-PIEAMVYDVQQ
O28662_ARCFU          GRIFVVG-DDDLFGIAASLTGMPEKVAVVDIDERLINFINRVAEEYSL-NVEAFVYDVQQ
F2KPH1_ARCVS          TNIFVVG-DDDLFSIAASLTGIPKKITVVEIDERLVDFINKKADEFGL-RVEAMVYDVQQ
D2RGL4_ARCPA          TEIFVVG-DDDLFSLASALTGLPKRVFVVDIDERLIDFINKKADEYGL-PVEAQVYDVQQ
A0A5A7RRH3_9EURY      GSIFIAG-DDDLFSIAAGLTGLPSRIVVVEIDERLVNFINKVAREYGL-EIEAIMHDLQN
B5IG62_ACIB4          AEIIVIG-DDDLISLGMALTGLPKRIVVLEIDDRLIKFINENAKKYGF-PVEARKFDVRN
D3TCM5_ACIB4          AEIIVIG-DDDLISLGMALTGLPKRIVVLEIDDRLIKFINENAKKYGL-PVEARKFDVRN
L0HI62_ACIS0          ADILVVG-DDDLISLGMALTGLPRKIVVLEIDDRLIDFINQNAREYGF-PVEVRKFDVRN
Q3AF56_CARHZ          RDLLLLG-DDDLTAIAAALSGLPRRIFVLDVDERIVGFIRDVARDRGWDNVHAEVYDVQD
L8A0N0_9BACI          RDILLLG-DDDLTSIAAALSGLPRRICVLDVDERIVRFVRDVAQDQGWDHVHAEVYDVRD
B6YXN5_THEON          KEVFVLG-DDDLTSVALMLSGLPKRIAVLDIDERLVKFIEKVADEIGFSNIEMFTFDLRE
BPSA_THEKO            KEVFVLG-DDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRK
H3ZM66_THELN          KEVFVLG-DDDLTSIALMLSGLPKRIAVLDIDERLTKFIEKTAEEIGYSNVEIFTFDLRK
F0LHU2_THEBM          KEVFVLG-DDDLTSIALMLSGLPKRIAVLDIDERLIKFIEKTADELGYTNIEIFTFDLRK
Q8U1U4_PYRFU          KDIFVLG-DDDLTSIALMLSGLPKRIAVLDIDERLTKFIEKAANEIGYEDIEIFTFDLRK
F6BCR9_METIK          KEVFVLG-DDDLTSIALMLSGLPKRIAVVDIDDRLIKFIEKTADEIGYNNLEILTLDIRK
BPSA_METJA            KDVLVLG-DDDLTSIALMLSNLPKKIVVVDIDDRLINFIKEVAEQLNYKNIEVITLDLRK
D5VU30_METIM          KDVLVLG-DDDLTSIALMLSNLPRRIVAVDIDERLMNFIKEVADELKFKNIEVITLDLRK
C0QRB1_PERMH          RDILVMGAEDDLTGLAVALTGLPRRVLILDIDERAIDFDNRIFKELGIDNAEAIRFDLRN
B2V717_SULSY          RDILVMGAEDDLTGLAVALTRLPRRVLILDIDERSIDFDNRIFKELGIDNAEAIRFDLRN
D3SLQ5_THEAH          KDIIVLGAEDDLTGLAVALSRKPRSVLVIDIDKRLIDFDNAIFRELGLDNARAMVWDLRN
D3DIS8_HYDTT          KDIIVLGAEDDLTGLAVALTRKAKSVLVIDIDKRLIDFDNSIFRELGIDNAEARVWDLRN
B4U8R0_HYDS0          KDIVVMGAEDDLTGLAIALSRKANSVTIIDIDKRSIDFDNEIFERHGIKNAKAFVWDLRK
O67635_AQUAE          KEIIVMGAEDDLTGLAIALTRKAKRVLIIDIDERLIDFDNRIIKELGIDNAEAMVWDLRN
E8T4D0_THEA1          KKVCVLG-DDDLMSIALALTGLPARVTILEIDERLVNFIKEVSDKYGLN-IDARVHDLRQ
F0S1F5_DESTD          KNVIVLG-DDDLMSIALALSGLPKKVTILEIDERLVNFIKEVSNEYNLN-IDARVHDLRQ
G7V6G1_THELD          KDVIVLG-DDDMVALALAITRLPRRIVMLEIDERIVDFQRRKAKELGLSNLEVRRHDLRK
I4BUP9_ACEMN          KNIIVLG-DDDLVGIALGLTGLARRVVVLELDERLINFEREISSKYGLS-IDVMAHDLRK
D7AQQ3_THEM3          KKLLVLG-DDDLVSIAAGLSGMPTEIIVLEIDDRLVGYINEIANKHNLP-IKAIKYDFRD
B0K6E3_THEPX          KKLLVLG-DDDLVSIAAGLSGMPTEIVVMEIDDRLVEYINEVANKYNLP-IKAMKYDFRD
Q8R8U3_CALS4          KKLFVLG-DDDLVSIAAGLSQMPKEIVVLEIDDRLVDYINRKAKELNLP-IEAMKYDFRD
D9RYF7_THEOJ          KKLLVLG-DDDLVSIAAGLSGMPAEVVVMEIDDRLVEYINDKATKLGLP-VKAIKYDFRE
A4XIU9_CALS8          KRLIVFG-DDDLVSIAASLTKLPKEVIVLEIDKRLVDFINHAAKEHNLS-LKAIEYDFRN
B9MM50_CALBD          KRLIVFG-DDDLVSIAAALTKLPKEVIVLEIDKRLVEFINQAAKEHNLN-LKAIEYDFRN
C9RAV3_AMMDK          KDLLVLG-DDDLVSLAAGLSGLPRRVVVLEVDERLVNFIRQVAEKENLP-VEAHIFDLVH
D0MEY5_RHOM4          KQLLVLG-DDDLMSIAAALTGAPAYVLAVDIDDRLIQFINDVARREGLDRLEAVRYDLRE
Q5SKV4_THET8          KEVLVLG-DDDLTGLAAALTGLPKRVVVLDADPRIVRFLERAAKAEGLP-LEAHVHDLRE
H5STM4_ACEAU          KELVLLG-DDDLLSIALALTGRPAKIVVFEIDARLVDFLNEHARRAGWP-LTAYQHDLRQ
                        : . * :**: .:   ::  .  :  .: * *   : .                :   

I0GIV4_CALEA          KLDEKFVNKFDTFLTDPVETVKGMRLFLSRCVQSLK-GKGAAGYFGLSHFESSLKKWYEI
F8C1V8_THEGP          ELPEELKGKFDIFVTDPVETEKGLKLFISRCISALK-GKGSAGYMGFTHREASLRKWYDF
D3RZV7_FERPA          AFPEELKKKFDVFVTDPVETIPGLKLFLSRGVSTLK-GPGCSGYFGITTLEASRKKWYEI
O28662_ARCFU          AFPDELKRKFDVFVTDPVETIPGLKLFLSRGVSTLK-GVGGAGYFGITTLEASRRKWYEI
F2KPH1_ARCVS          SFPEELRKKYDVFVTDPVETIPGLKLFLSRGVSTLK-GPGCAGYFGITTLEASRKKWYEI
D2RGL4_ARCPA          AFPEELKGKFDVFVTDPVETIPGLKLFLSRGVSTLK-GVGCSGYFGLTTLEASRRKWYEI
A0A5A7RRH3_9EURY      DI-GELKKKFDVFVTDPVETLPGITLFLSRCVEALK-GIGSVGYFGLTTLEASRHKWYEI
B5IG62_ACIB4          DIDEDLRRNFDVFITDPVETIEGITLFLSRAASGLK-GEGSAGYFGLTHLEASLKKWQEI
D3TCM5_ACIB4          DIDEDLRRNFDVFITDPVETIEGITLFLSRAASGLK-GEGSAGYFGLTHLEASLKKWQEI
L0HI62_ACIS0          DIDLDLRGKFDVFITDPVETIEGITLFLSRAVSGLK-GKGSAGYFGLTHLEASLKKWYEI
Q3AF56_CARHZ          PLPENLRGQFDVFFTDPVETVRGIFLFLSRCTEALR-GPGSAGYFGLSFLEASWKKWRDI
L8A0N0_9BACI          ELPSHLRGQFDVFFTDPVDTVKGLLLFLSRCTEGVR-GPGAAGYFGLSYLEASWRKWRQI
B6YXN5_THEON          PLPDYALHKFDTFITDPPETVDAIRAFVGRGIATLK-GPGCAGYFGITRRESSLDKWRDI
BPSA_THEKO            PLPDYALHKFDTFITDPPETVEAIRAFVGRGIATLK-GPGCAGYFGITRRESSLDKWREI
H3ZM66_THELN          PLPDYALRKFDTFITDPPETVDAVRAFVGRGIATLK-GPGCAGYFGITRRESSIDKWHQI
F0LHU2_THEBM          PLPDYALRKFDTFITDPPETVDAIRAFVGRGIATLK-GPGCAGYFGITRRESSLNKWRDI
Q8U1U4_PYRFU          PLPDYALHKFDTFITDPPETLEAIRAFVGRGIATLK-GPRCAGYFGITRRESSLDKWREI
F6BCR9_METIK          PLPDYLVGKFDTFITDPPETLNAVRTFIGRGIATLK-GPRCAGYFGITRRESSIDKWRNL
BPSA_METJA            PLPEKYSRAFDTFITDPPETVYAVKTFIGRGISALK-GERRAGYFGITRRESSLDKWREI
D5VU30_METIM          PLPEGYKRSFDTFITDPPETVFAIKTFIGRGISALK-GERRAGYFGITRRESSLDKWREI
C0QRB1_PERMH          PFPEEWIGAFDVFITDPPETVKAFKAFIARGIASLK-GEGSAGYFGLTLRDSSLNRWQKF
B2V717_SULSY          PFPEEWLKSFDVFITDPPETLKAFKAFIARGIAALR-QEGSVGYFGLTLRDSSITRWHQF
D3SLQ5_THEAH          PFPPEMLGKFDVFVSDPPETLPAFRAFIGRGIATLR-EEGGVGYFGLTLRDSSVFRWREF
D3DIS8_HYDTT          PFPSEILGCYDVFVSDPPETLPAFRAFIGRGIATLK-EEGGVGYFGLTLRDSSVFRWRDF
B4U8R0_HYDS0          PLPEEMLGKFDVFITDPPETIAAFSAFIKRGISLLK-DEGAVGYFGLTLRDSSIYRWREF
O67635_AQUAE          PYTEDFLGKFDVFITDPPETFAAFRAFIGRGIATLK-DAGCAGYFGLTLRDSSIFRWKEF
E8T4D0_THEA1          PLPEDVVGAYDTFFTDPPETVEAIKAFVGRGVATLK-GPRCAGYFGVTRRESSLDKWARI
F0S1F5_DESTD          PLPEDVVGAYDTFFTDPPETVEAIKAFVGRGVATLK-SERCAGYFGVTRRESSLDKWRRI
G7V6G1_THELD          PLPEDLLGQFDVFFCDPPETVAALAAFVGRGVATLR-GMGGAGYFGLTSSESSFAKWRRL
I4BUP9_ACEMN          PLPQEMLGNFDVFFCDPPETVEAFDAFVGRGIIALK-GEGGSGYFGITHAESSFHKWRAL
D7AQQ3_THEM3          KLPEEYVGYFDTFITDPPETVEALEICIGRGISALS-REGCGGYFGLTLIEASLEKWNVF
B0K6E3_THEPX          KLPEEYVGYFDTFITDPPETIEALEICIGRGISALS-KEGCAGYFGLTLIEASLEKWNVF
Q8R8U3_CALS4          KLPEKYIGYFDTFITDPPETVDALELTIGRGISTLK-GEGCAGYFGVTLIEASLEKWNIF
D9RYF7_THEOJ          KLPDEYVGYFDTFTTDPPETLEALEVCMGRGLTGLS-GEGCAGYFGLTRTEASLKKWNLF
A4XIU9_CALS8          KLPDELVKSFDTFTIDPPETIEALDLCFTRTTSSLK-GAGCAGYFGLTNIEASLSKWHEF
B9MM50_CALBD          KLPDDFVKSFDTFTIDPPETIEALDLCFTRTISSLK-GAGCAGYFGLTNIEASLSKWHEF
C9RAV3_AMMDK          PLPAELRRQFDTFLTDPPETLEALAIFIGRGLSGLK-GAGCAGYFGLTRAESSLTKWRAF
D0MEY5_RHOM4          PLPTSWLRKFDTFMTDPTESFLGFKTTIERGLLALR-GPGCAGYFGLTHVESSYEKWAQI
Q5SKV4_THET8          PLPEAWVHAFHTFFTDPVEGPLGLQAFVGRGLLALE-GEGCAGYVGLTHVEASLAKWADF
H5STM4_ACEAU          PLPHEFLERFDVFVTDPLETVEGFLLFVEQGLSALKPGAGQAGYFGLTKIEAAPEKWRLF
                               :. *  ** :   ..   . :    :       **.*.:  :::  :*  :

I0GIV4_CALEA          ERDLL-EMNLVITDMLRDFNEYLLVGERILH--EGYYVVEK--SPVEVLPPTISWYRSTF
F8C1V8_THEGP          EKFLL-DSGFVITDILRDFTTYP--EKENQW--EDFYRTYRIMKEFDLDLPNVDWYKSCF
D3RZV7_FERPA          QKMIH-DMGFVITDMRRKFSVYPQDEKNFFRFQEKLPIVEKL-----GAKIDYDWYKSTL
O28662_ARCFU          QRMIH-DMGFIITDLRRRFNVYPEDEKNFFRFQEKLPIVRHL-----QAKVDFNWYNSTL
F2KPH1_ARCVS          QKMIY-DMGFIITDLRRKFSVYPSEDKNFFRFQEKLPIVSKL-----GAPVDWNWYRSTL
D2RGL4_ARCPA          QKMIH-DMGFVITDIRRKFNVYPQDEKNFFRFQEKLPIVKKL-----GAKVDYNWYKSSL
A0A5A7RRH3_9EURY      QRILH-DMGFVITDIRRNFNVYPDDGKNFFTFQQRLPVFKKI-----KAKNDYNWYKSSL
B5IG62_ACIB4          ERRLL-SMNFVITDMLRDFNVYPMSN-NLELAAEDYIVYREIAKITNNTKIDADFYRSTL
D3TCM5_ACIB4          ERRLL-SMNFVITDMLRDFNVYPMSN-NLELAAEDYIVYREIAKITNNTRIDADFYRSTL
L0HI62_ACIS0          EKRLL-SMNFVLTDMLRDFNVYPLRG-NLELAAEDYIIYRRIEELTGNRSIDADFYRSTL
Q3AF56_CARHZ          QRGIL-DMGFAITDMLGAFQEYQLENIVAQGYPVARMAPVAVK------EPDVSFYVSTV
L8A0N0_9BACI          QQGIL-DMGFAITDMLSAFQDYLLEDIVFLDW--AHMAPAPVK------EPDIPFYVSTV
B6YXN5_THEON          QRVLLNEFNVVITDIIRNFNEYVNWGYEEETRAWKLLPIKVK--------PSYNWYKSYM
BPSA_THEKO            QRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVK--------PSYNWYKSYM
H3ZM66_THELN          EKLLITEFNVVITDIIRNFNEYVNWGYVEETRAWKLLPIKIM--------PTYNWYKSYM
F0LHU2_THEBM          QKLLLNEFNVVITDIIRNFNEYVNWGYEEETRAWKLLPMKVK--------PRYNWYKSYM
Q8U1U4_PYRFU          QKLLLNEFNVVITDIIRNFNEYVNWGYAEETRAWKLIPIKKL--------PEYNWYKSYM
F6BCR9_METIK          QKILINEFNVVITDIIRNFNHYINWGYEKETKAWRLAPVKVL--------PKDIWYRSYM
BPSA_METJA            QRTLINDFNVVITDIIRNFNHYVNWGYEEETRAWKLAPVKKK--------PEDIWYKSYM
D5VU30_METIM          QRILINDFNVVITDIIKDFNHYINWGYEEETRAWKLAPIKKK--------PKDIWYKSYM
C0QRB1_PERMH          QKALINDYGMVITDIVQDFNAYMNWEYHSETRAQKVAPVNKG--------PSDIWYRSAW
B2V717_SULSY          QKALINDYGMVITDIVQDFNAYMNWDYHAETKAQEVAPVNKV--------PTDIWYRSAW
D3SLQ5_THEAH          QASLTTEFGVAITDIVQDFNDYITWDYHPETRAAEIAPVKRN--------PKGIWYRSAW
D3DIS8_HYDTT          QIALTSEFGVAITDIVQDFNAYITWDYHRETKAAQVAPVKRD--------PKGIWYRSSW
B4U8R0_HYDS0          QKILTGEIGVAITDIIQDFNNYITWDYHKDTKAYELAPVKKD--------PEGIWYRSAW
O67635_AQUAE          QEILINEYGVVITDIIQDFNDYMNWEYHPETRAAQIAPVKKN--------PTDIWYRSAW
E8T4D0_THEA1          QKVLL-DMGLVITDLLHNFNEYVNWDYYQEMRGWQLTPVKEP--------PKEIWYKSTQ
F0S1F5_DESTD          QKVLL-EMGLVITDLLHNFNEYVNWDYYEDMRGWQLTPVKEP--------PKDIWYKSTQ
G7V6G1_THELD          EQVLL-DKGLVITDIIRNFNEYVNWGYAEEMLAWKLAPVKVK--------PTENWYYSSI
I4BUP9_ACEMN          EMKLL-QRGLVITDIIHDFNVYMNWEYVQEMLAWDLAPVKQA--------PIQNWYKSAM
D7AQQ3_THEM3          QQILASKFKVVVTDIIHDFNHYVNWDYLLNTVGKQYEFVQVE--------PRLNWYRSSM
B0K6E3_THEPX          QQILASKFKVVVTDIIHNFNHYVNWDYLLNTVGKQYEFVQVE--------PKLNWYRSSM
Q8R8U3_CALS4          QQILTSKFKVAITDIIYDFSHYVNWDYLLTTVGKPYDFVQVE--------PKLNWYRSSM
D9RYF7_THEOJ          QQMLVDKFKVAITDIIDDFNHYVNWDYLLGSIRDDYSFVQVK--------PRLNWYRSSM
A4XIU9_CALS8          QKLLLNKFNAVITDIIENFNHYVNWNYLLPSLDSKLNFVNVQ--------PKLNWYTSSM
B9MM50_CALBD          QKLLLNKFNAVITDIIENFNHYVNWNYLLPSLESSLTFVNVQ--------PKLNWYTSSM
C9RAV3_AMMDK          QAQLTGQFNVVITDIIHDFNEYVNWDYLLESVRNDLSFVQTW--------PRYNWYRSAM
D0MEY5_RHOM4          QRFLL-DSGVVLTDLIDDFSAYVNWGYIESMRSWEWLPTHRL--------PERPWYYSAL
Q5SKV4_THET8          QRFLL-ENGAVITELRDGFHVYENWGYIEQMRAWPWLPVKRR--------PEKPWYTSAL
H5STM4_ACEAU          EQKLLGQNALFISDVVRDFGFYENWAYLVETTSQQSVVFSQA--------PDRPWYRSTF
                      :  :  .    ::::   *  *                                :* *  

I0GIV4_CALEA          IRVELID--TAKPKIVESVSWDRSLYFDDETYVVRP---------
F8C1V8_THEGP          IRFEVVE--GPKILNIPMPKDLEELYFDEEAWATPLPSFLEKKEG
D3RZV7_FERPA          YRIEAVK--DPKPLVEGEMIIDEAVYRDSESWATPYGAD------
O28662_ARCFU          FRIEAVK--EPKPIVEGEMIIDEKVYKDDESWATPY---------
F2KPH1_ARCVS          YRIEAVR--EPKPLVEGEMIIDEKVYKDDESWATPY---------
D2RGL4_ARCPA          YRIEAVK--EPKPLVEGEMRIDEKVYKDEESWATPY---------
A0A5A7RRH3_9EURY      YRIEAIK--EPKPIITGWHKLGKALYHDNESWVTPE---------
B5IG62_ACIB4          IRIEAVG--DIKPLVSGSVELKEEIYVDSESLVTAMATRRRK---
D3TCM5_ACIB4          IRIEAVG--DIKPLVSGSVELKEEIYVDNESLVTAMATRRRK---
L0HI62_ACIS0          IRVEAID--DVKPLVRGYVELKDEVYVDEESLVTAMATRRKG---
Q3AF56_CARHZ          YRLELTE--EPRPLFTGRVELGRDLYYDDEACVTLPR--------
L8A0N0_9BACI          YRLEMVE--EPRPLFFGWVEFEQDFYYDEEFCGKE----------
B6YXN5_THEON          FRIQTLE-GSKGYEEKIE---NWDIYNDEEASTT-----------
BPSA_THEKO            FRIQTLE-GSKGFEDEITV--GQELYDDEESSTT-----------
H3ZM66_THELN          FRIQTIE-GSRGYEEEITV--GQELYDDEESSTT-----------
F0LHU2_THEBM          FRIQTLE-GSKGYEEEIK---DEDIYNDEEASTT-----------
Q8U1U4_PYRFU          FRIETLE-GSRGYEDEIP---EEDIYNDEESSTT-----------
F6BCR9_METIK          YRIETLE-GSKGLMEEMNV--GQELYDDEESSTT-----------
BPSA_METJA            FRIETLK-DSRGFEEEVDV--GDELYNDAESSTT-----------
D5VU30_METIM          FRIETLK-GSKGFEEEVEV--GSELYNDAESSTT-----------
C0QRB1_PERMH          YRIEAMP-GFKGENIQIKDEVFRELYLDEEGSTT-----------
B2V717_SULSY          VRMEALP-GFKGENVQITDEVFRELYLDEEGSTT-----------
D3SLQ5_THEAH          YRIEALP-GFKRWNEAISDDV---FYLDEEGSTT-----------
D3DIS8_HYDTT          YRIEALP-GFKRWNDAISDDV---FYLDEEGSTT-----------
B4U8R0_HYDS0          YRIEALP-GFSRWNGVISDED---LYLDEEGSTT-----------
O67635_AQUAE          YRIETLP-GFKRWNEPISDEV---FYLDEEGSTT-----------
E8T4D0_THEA1          FRVETIR-GFKGFNEPIVG----DIYNDAESSTT-----------
F0S1F5_DESTD          FRVETVR-GFKGFNDPIVG----DIYNDAESSTT-----------
G7V6G1_THELD          FRVEVVN-EIPVSNEDLTDS---DIYNDAESSTV-----------
I4BUP9_ACEMN          VRVEMVE-RLEMPNEDLTDR---DIYNDAESSTI-----------
D7AQQ3_THEM3          YRIETLK-DSKGIENEDKP---CELYVDEEALIYKGDKA------
B0K6E3_THEPX          YRIETLK-DSKGIENEYKP---CELYVDEEALIYKGDKA------
Q8R8U3_CALS4          YRIETLK-DSKGIENVYKP---VEIYVDEEAIIYKGEKK------
D9RYF7_THEOJ          YRIETLS-GFKGMENKSMP---CELYIDQEALIYRPGQM------
A4XIU9_CALS8          YRIELVK-DIE-IVNEYIN---CELYIDNEAILYKE---------
B9MM50_CALBD          YRIELVK-DVD-IKNEFIN---CELYIDNEAILYKEN--------
C9RAV3_AMMDK          FRIETVDDNFFRHEEEMKG---APLYEDQEALIFTRRFRKEQ---
D0MEY5_RHOM4          HRIELLR--TPALENAAVE---GDIFTDEEAATT-----------
Q5SKV4_THET8          IRLELLR--RADLENARVE---GDLQ-DEEATTY-----------
H5STM4_ACEAU          FRIETLRDFQPPRCRSLGEE--VDIYYDHDSIIKPRR--------
                       *.:                    .  * :