CLUSTAL format seed alignment for MF_01960

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DAP_BRUAB       MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPI
DAP_BRUSU       MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPI
DAP_BRUA2       MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPI
DAP_BRUME       MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPI
DAP_OCHAN       MSKFDTSALEAFVRHIPQNYKGPGGVVAVVKDGEVVLQHAWGFADLRTRTPMTLDTRMPI
DAP_RHOS4       -MTLDLDALDRALDALPNLFRGPGGVAGVVKDGQVVASRAWGYADLTRRRPMETGTRLPI
DAP_GLUOX       MSDSFSARLEAAVSALPARFPGPGGAVAVLKDGEVLVRHGWGYANVERRIPFTPSTLFRM
                        *:  :  :*  : ****...*:::*:::  :.**:*::  * .:   * : :

DAP_BRUAB       CSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLC
DAP_BRUSU       CSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLC
DAP_BRUA2       CSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLC
DAP_BRUME       CSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLC
DAP_OCHAN       CSVSKQFTCAVLLDAVGEPELLDDALEAYLDKFEDERPAVRDLCNNQSGLRDYWALSVLC
DAP_RHOS4       CSISKQFTCGALLDTLGDTAAYDARVAEFLPQFEGPLPTLRQLCDNQSGLRDYWALTVLQ
DAP_GLUOX       CSITKQFTCGTLLDLYDDPSELDADVDARLPQLDEPSPGMLHLAHNQSGLRDYWAVAMLH
                **::*****..***  .:.   *  :   * :::   * : .*..**********:::* 

DAP_BRUAB       GAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLADLLAER
DAP_BRUSU       GAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLADLLAER
DAP_BRUA2       GAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLADLLAER
DAP_BRUME       GAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLADLLAER
DAP_OCHAN       GADPEGVFLPAQAQSLLRRLKTTHFEPGSHYSYCNGNFRILADLIEAHTGRTLVDILSER
DAP_RHOS4       GAEAAQTFRREDALPLIARMKTGHFPPGTAYSYCNCNFRIVSEILESETGRALRDLYAER
DAP_GLUOX       GAPIEGYFGDREARRVIDGTRTLQFQPGTSYSYVNQNFRLISDILQDRTGRSFAELLQTS
                **     *   :*  ::   :* :* **: *** * ***::::::: .***:: ::    

DAP_BRUAB       IFAPAAMKTAELIPDTAL-FNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE
DAP_BRUSU       IFAPAAMKTAELIPDTAL-FNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE
DAP_BRUA2       IFAPAAMKTAELIPDTAL-FNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE
DAP_BRUME       IFAPAAMKTAELIPDTAL-FNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE
DAP_OCHAN       IFAPAGMKRAELISDTAL-FDECTGYEGDTVRGFLPATNRIQWMGDAGICASLNDMIAWE
DAP_RHOS4       IFGPAGMRTAELTSDTRHPADEVVGYEGSDAVGFFPADNGIFWIGDAGISASLQDMLAYE
DAP_GLUOX       IFNPVGMERAILAAETRAMPDGTVGYEGSVESGFRPAINNIWWTGDAGLGASLDDMIAWE
                ** *..*. * * .:*    :  .****.   ** ** * * * ****: ***:**:*:*

DAP_BRUAB       QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRW
DAP_BRUSU       QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRW
DAP_BRUA2       QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRW
DAP_BRUME       QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRW
DAP_OCHAN       QFIDATRDDESGLYRRLSGPQTFKDGVAAPYGFGLNLHETGGKRLTGHGGALRGWRCQRW
DAP_RHOS4       SWIDATRNDENSIYRRISVPPAYVCGTPASYGFGLSHETVAGVKVTGHGGALRGFRAQRF
DAP_GLUOX       RFIDETRDAPDSLYRRLTVPVTFSDGQPAPYGFGLQRTKMFGRDVTMHGGALRGWRSHRL
                 :** **.  ..:***:: * ::  * .*.*****.     *  :* *******:*.:* 

DAP_BRUAB       HCADERISTIVMFNFEGNASDAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVL
DAP_BRUSU       HCADERISTIVMFNFEGNASDAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVL
DAP_BRUA2       HCADERISTIVMFNFEGNASDAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVL
DAP_BRUME       HCADERISTIVMFNFEGNASDAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVL
DAP_OCHAN       HCADERLSTIAMFNFEGGASEVAFKLMNIALGVSSSEVSRVEADSAWFGSWLDDETGLVL
DAP_RHOS4       HAADERLSVVVIFNHEASAHAAASSLLAAALGHEAPKGARPE---GWAGQWLDPESGLLL
DAP_GLUOX       HVASERLSVVVMFNHMSAAQVASAQILAAALGVPYEPERSTQQPTALYGTYLERETGLSA
                * *.**:*.:.:**. . *  .: .::  ***         :   .  * :*: *:**  

DAP_BRUAB       SLEDAGGGRMKARFGTGPEIMDISGENEAQSSMTTLRR----DGDMIHLARKDENLHLAM
DAP_BRUSU       SLEDAGGGRMKARFGTGPEIMDISGENEAQSSMTTLRR----DGDMIHLARKDENLHLAM
DAP_BRUA2       SLEDAGGGRMKARFGTGPEIMDISGENEAQSSMTTLRR----DGDMIHLARKDENLHLAM
DAP_BRUME       SLEDAGGGRMKARFGTGPEKMDISGENEAQSSMTTLRR----DGDMIHLARKDENLHLAM
DAP_OCHAN       SLEDAGHGRMKARFGTSPEMMDVVSANEARSAVTTIRR----DGETIELVRASENLRLSM
DAP_RHOS4       RVGEDAEG-LTLRFATGPDRLTAGEDGVPRGAGVSLAR----EGAMLVMNRTSDNLTVRA
DAP_GLUOX       RIEPAPGG-AKLRYLMVPELLEGISATRAEAGSVVVKAQETAEGAEAVMERPGENRTSIL
                 :     *  . *:   *: :       .... . :      :*    : * .:*     

DAP_BRUAB       HRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV
DAP_BRUSU       HRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV
DAP_BRUA2       HRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV
DAP_BRUME       HRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV
DAP_OCHAN       KRVKGEAKHD---IIGRYHSDEL-DADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDV
DAP_RHOS4       EPLPVVAVADAGEIAGRYHAREL-EADLVIEARDGGAYAGFEGLLGAGPMERLHPVGPDV
DAP_GLUOX       ARCDETPGEDIAELAGVYRCEELDEAEVTIELAGGVVYGGFSGILGDGRMEMLQRLAKDV
                      .  *   : * *:. ** :*:: :   .*  *..*.*:** . *  *   . **

DAP_BRUAB       WLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL--
DAP_BRUSU       WLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL--
DAP_BRUA2       WLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL--
DAP_BRUME       WLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL--
DAP_OCHAN       WLLPVQRSMDAPSPGEWKLVFRRDDKGEITGLSVGCWLARGVEYRRVQP
DAP_RHOS4       WIVTTRRSMDAPAPGDWTLQVRREG-GAVTGLRLGCWLARRIDYARV--
DAP_GLUOX       WVLPCPRALDHTAPGDWTLAFERQG-GSVTAVRVGCWLARDLMYQRV--
                *::.  *::* .:**:*.* ..*:  * :*.: :****** : * *: