CLUSTAL format seed alignment for MF_01961

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KATG_ECOLI        -------------------------MSTSDDIHNTTATGKCPFHQGGHDQS---------
KATG_SALTY        -------------------------MSTTDDTHNTLSTGKCPFHQGGHDRS---------
KATG_ENT38        -------------------------MSMSEETNNSLSSGKCPFHHGGSDQS---------
KATG_CROS8        -------------------------MSTPSDQHNTLSAGKCPFHQGNSNQT---------
KATG_ERWT9        -------------------------MSAHN--TNESAVGKCPFHEQKEEKSVLA------
KATG_KLEP7        -------------------------MSTSNDPSNNASAGKCPFHAETPKQS---------
KATG_ACIBC        ----------------------------------MSNESKCPFSGHNSKPQ---------
KATG_PSEMY        ----------------------------------MSNQGKCPFNHV--------------
KATG_METPP        ----------------------------------MATESKCPFNHA--------------
KATG_JANMA        ----------------------------------MSSEAKCPFPHA--------------
KATG_AZOC5        ---------------------------------MSPRARRCTDRCARMSERSMNATTETP
KATG_RALPJ        ---------------------------------MTTEAKCPFSGHAPAASHAFG------
KATG_ACIAC        ---------------------------------MTQDATKCPFHAAAAS-----------
KATG_PARPJ        ----------------------------------MSSEAKCPFNHAAG------------
KATG_PARXL        ----------------------------------MSSEAKCPFNHAAG------------
KATG_CUPNH        ----------------------------------MSNETKCPFSHAAG------------
KATG2_BURCJ       ----------------------------------MSNEGQCPFNHANG------------
KATG_BORA1        ----------------------------------MSNEAKCPFNHTAG------------
KATG_HERSE        ----------------------------------MSNEAKCPFNHTAG------------
KATG_XANCP        ----------------------------------MTTEAKCPFNHSVVG-----------
KATG_XANC5        ----------------------------------MTTEAKCPFNHAVVG-----------
KATG_XYLFA        MLYIYYLFKSLFFHTLFVFSIYKDCPYMRASSPETTSAVKCPFNKTAV------------
KATG1_MAGO7       -------------------------------------MGECPL-----------------
KATG_NEUCR        -------------------------------------MSECPV-----------------
C7ZHZ3_NECH7      -----------------------------------MSESKCPVAH---------------
KATG2_MAGO7       ---------------MHASLSSWLLAASLLTQPISVSGQGCPFAKRDGTVDSSLPQKRAD
C7ZIK0_NECH7      ---------------MHGISSAWLLLASGVLPL--VAGDGCPFAKRATDSGSDLFPPREI
KATG_FLAJ1        ------------------------------MENQSNDISKCPFHN---------------
KATG_METI4        ----------------------------------MTTEGSCPFHHTAAI-----------
KATG_PSEE4        ----------------------------------MANESKCPFH----------------
KATG_PSEPF        ----------------------------------MANESKCPFN----------------
KATG_PSESM        ----------------------------------MSTESKCPFN----------------
KATG2_BURCC       ----------------------------------MSNEGKCPFN----------------
KATG2_CUPPJ       ----------------------------------MSTEAKCPFN----------------
KATG_CUPMC        ----------------------------------MTTEAKCPFL----------------
KATG_PSEF5        ----------------------------------MSNESKCPFK----------------
KATG_BURL3        ----------------------------------MSNETKCPFN----------------
KATG1_BURVG       ----------------------------------MSTESKCPFN----------------
KATG_BURM1        ----------------------------------MSTEPKCPFH----------------
KATG_BURPS        ----------------------------------MSNEAKCPFH----------------
KATG_SERP5        ----------------------------------MTTESKCPFSGGGKP-----------
KATG_RALSO        ----------------------------------MTTESKCPFK----H-----------
KATG_HAHCH        -----------------------------------MSDSKCPFHHAP-------------
KATG_SHEB8        -----------------------------------MSENKCPMHHS--------------
KATG_METB6        ----------------------------------MTDDSTCPVTGGADKQVT--------
KATG_METAC        -----------------------------MGGNVMTDDKMNSVTSGANKQET--------
KATG_METHJ        ----------------------------------MADNKKSPETGGITMQIP--------
KATG_CHLCH        ----------------------------------MNEERKCPITGATHKPSA--------
KATG_SYMTH        ----------------------------------MREED--------IRSTA--------
KATG_FLAPJ        ------------------MENNTN---------PISGQGKCPFSGGAAKQS---------
KATG_GRAFK        ------------------MGNNKSGSEDNHKVWEVNESSKCPFMGGALNKT---------
KATG_ACAM1        ----------------------------------MSSASKCPFSGGALKFT---------
KATG_POLSJ        ----------------------------------MSTEPNCPFSGNARKHT---------
KATG_BRASO        ----------------------------------------MDDV----------------
KATG_RHILO        ----------------------------------MDAKTDDNSA----------------
KATG_BEII9        ----------------------------------MDAQTDDKAQ----------------
KATG_CAUVC        ----------------------------------MDAKVEDNIA----------------
KATG_PSEU5        ----------------------------------MNAESGENAG----------------
KATG_RHOP5        ----------------------------------MDAKTDDKDA----------------
KATG_RHOPT        ----------------------------------MDAKTDDKGA----------------
KATG_RHOPS        ----------------------------------MDAKTDDQ-G----------------
KATG_RHOPB        ----------------------------------MDAKTDDK-A----------------
KATG_SOLUE        ------------------------MEKQSNDAAVAGAPNDHG-A----------------
KATG_CHESB        ----------------------------------MDAKTDDS-A----------------
KATG_NITHX        ----------------------------------MDAKTNDKSA----------------
KATG_NITWN        ----------------------------------MDAKTNDGKA----------------
KATG_RHIL3        ----------------------------------MDNPTDSA------------------
KATG_SINMW        --------------------------------MTMDQKTDNA------------------
KATG_ACICJ        ----------------------------------MSTEAKCPVT----------------
KATG2_SHEFN       -----------------------------MKHPLFNQKVLAGFVSMLLI-----------
KATG_SHELP        -----------------------------MKGKTVNKQTLAALVSALLV-----------
KATG_ALTMD        -----------------------------MNMNRFRKTTLSALVALSLG-----------
KATG_COLP3        ----------------------------------MFKSTLPIAAAISVA-----------
KATG_SHEWM        ----------------------------------MFKKTILSFVISAV------------
KATG2_SHEAM       -----------------------------------MKRTLPTLSALALS-----------
KATG2_SHEON       ----------------------------------MKINTLPTLSALTLA-----------
KATG2_CELJU       ----------------------------------MFKKTKPRISILALT-----------
KATG2_IDILO       ----------------------------------MFKKTVPLLSAVAIA-----------
KATG_PSEA6        ----------------------------------MLPRVNKRSNCIAKK-----------
KATG_LEPBP        --------------------------------MRNFRRFTIALLVLFLG-----------
KATG_NOVAD        ----------------------------------MRKFSVSKVALLAAT-----------
KATG2_BURVG       ------------------------MQR-----NRIAKSVLAALAVI-AM-----------
KATG_GRABC        -------------MKGTPFRSPHLYQEGSSCMHRTIRSVAAVLTVVLSA-----------
KATG_ECOLX        ----------------------------------MIKKTLPVLILL-AL-----------
KATG_YERPE        ----------------------------------MLKKILPVLITL-AI-----------
KATG_FRATT        ----------------------------------MLKKIVTALGMS-GM-----------
KATG_SACD2        -------------------------------MEPLFPKRLLSIAVLCVA-----------
KATG2_LEGPA       ----------------------------------MFKRTIPLFAAFTLA-----------
KATG2_HALMA       ---------------------------------MAETPNSDMSGATGGR-----------
KATG1_HALMA       ------------------------------------MLKTVLMPSPSKC-----------
KATG_HALSA        ----------------------------------------------MEN-----------
KATG_NATPD        ------------------------------------------------------------
KATG_SALRD        -------------------------------------MHNGSNGSVEQR-----------
KATG_METRJ        ---------------------------------MSETIDKTDTTTFHME-----------
KATG_PSELT        ----------------------------------------MKSK--ERK-----------
KATG_ARCFU        ---------------------------------------MMRQGGVMVG-----------
B5Y4Y9_PHATC      ----------------------------------MGSDSKCPF--APKM-----------
B8CF21_THAPS      ----------------------------------MAAESKCPYKGGSTP-----------
KATG3_MYCS2       -----------------------MPESPDAYVNRTYDQTVAVRRSLKRR-----------
KATG_MYCGI        -----------------------MTDTSDARPPHSDAKTASNSESENPA-----------
KATG1_MYCVP       -----------------------MTDTSDARPPHSDDKTRSHSESENPA-----------
KATG_MYCSS        ----------------------MSSDTSDTRPPHSDSGTQSNSESENPI-----------
KATG1_MYCFO       -------------------MPPNTPDASDARPPQADTETHSHSESENPV-----------
KATG_MYCIT        ----------------------MSSDTSSSRPPQPDSGTASKSESENPA-----------
KATG_MYCUA        ----------------------MSSDS---RPPQPDTSTQSNSESESPA-----------
KATG2_MYCS2       ----------------------MSSDTSDSRPPNPDTKTASTSESENPA-----------
KATG_RHOJR        --------------------------MSDSCPVAHEGNTQSTSESENPV-----------
KATG_NOCSJ        -------MTDSQDNRTPESPQGVDRKAEGGCPVLHDGVTAQGSESENPA-----------
KATG_SALTO        -------MSDTQDN-APVSAQGVDQKAAAGCPVAHDSVTAHGSESESPA-----------
KATG1_CUPPJ       --------------------------------MTDKQHTRSVSESENPA-----------
KATG_FRACC        ---------------------------MSEN----HDAVVYNTNAENG------------
KATG_FRASN        ---------------------------MSEN----HETVVSELNEESG------------
KATG_STRCO        ---------------------------MSEN----HDAIVTDAKTEET------------
KATG_STRRE        ---------------------------MTEN----HDAIVTDAKSEGS------------
KATG_STRGG        ---------------------------MTEN----HESHVFDPVTPDSPETAVPEVP---
KATG_SACEN        ---------------------------MTDS----PDATT--------------------
KATG2_MYCFO       ---------------------------MAEA---ETHPPIGESQTEPAE-----------
KATG2_MYCVP       ---------------------------MPEA---TEHPPIGEAQTEPAQ-----------
KATG1_MYCS2       ---------------------------MPEDRPIEDSPPIGEAQTDAPA-----------
KATG_MYCA9        ---------------------------MSEE-----HPPIAEANSQPS------------
KATG_MYCTU        ---------------------------MPEQ-----HPPITETTTGAAS-----------
KATG_NOCFA        ---------------------------MSVE-----HPPIGEANTEPAA-----------
KATG_GLOVI        ----------------------------------MDVEAKCPMGGG--------------
KATG_KORVE        ------------------------------MENELVSKVKAPVPGNQTNTLNEA------
KATG_CAUSK        ----------------------------MDGSELVEPTTKCPLKHGVRF-----------
KATG_MARMS        ----------------------------MS-KENMSNEGKCPFNHGAAG-----------
KATG1_ALKMQ       ----------------------------------MQEKGKCPVTGMTKHK----------
KATG_DESHY        ----------------------------------MEEK-KCPVTGHTQHTP---------
KATG_PELCD        ----------------------------------MSEDSKCPVTGKTAKTAI--------
KATG_PELPD        ----------------------------------MSNDCTCPVTGRVDK-----------
KATG_GEOLS        ----------------------------------MS-DSKCPVTGKSSR-----------
KATG_GEOSL        ----------------------------------MSADNESR-TGRRAA-----------
KATG_DESOH        ----------------------------------MDKDSKRPVVGSTVR-----------
KATG_CLOBB        -----------------------------------MTENKCPVTGKMGKAT---------
KATG_PROA2        ----------------------------------MSEQSRCPVTGRTADSP---------
KATG_AZOSB        ----------------------------------MNNESKCPFAAAHGVRS---------
KATG_DECAR        ----------------------------------MSNEQKCPFSGTHGART---------
KATG_SYNSC        -----------------------------------MSDLKCPFSGHTGAVT---------
KATG_SYNPW        -----------------------------------MSDLKCPFSGHTGAVT---------
KATG_SYNR3        ---------------------------------MSMAEMRCPFSGHGAATT---------
KATG_PSYIN        -----------------------------MSKNATNTGGKCPVMHGGATE----------
KATG_SYNP2        -----------------------------MHDHITNTGGKCPVMHGALTT----------
KATG_SYNP6        ---------------------------------MTATQGKCPVMHGGATT----------
KATG1_VIBPA       -----------------------------MTQQNAHSEGKCPVMHGSMTT----------
KATG_SHEDO        -----------------------------------MSENKCPVMHGSATTT---------
KATG_SHEHH        -----------------------------------MANKKCPVMHGGAT-----------
KATG_AERS4        -----------------------------MSNNSERSQGKCPVMHGGTTS----------
KATG_ALKEH        -----------------------------MGDQ--QNAGKCPVMHGAMTS----------
KATG_HALHL        -----------------------------MADQ--QKAGGCPVMHGAMTQ----------
KATG_PECAS        -----------------------------MDENKTKPTGKCPVMHGGNTS----------
KATG_RHOS5        -----------------------------MDGNGIGSTGKCPVMHGGNTA----------
KATG1_LEGPL       -----------------------------MDGKVGNTATGCPVMHGGMTS----------
KATG_EDWTA        -----------------------------MGNNNEFSSGKCPVMHGGMTS----------
KATG_LEPCP        -------------------------------MDPKTSAGQCPVMHGANTT----------
KATG_VIBCH        -----------------------------MEHNKAGSSGQCPVMHGGLTS----------
KATG_VIBVY        -----------------------------MEHKPTHTSGQCPVMHGGATS----------
KATG_POLAQ        ----------------------------------MTSKGMCPVAHGANTE----------
KATG2_VIBPA       -----------------------------MSNTNGGSVGKCPVMHGGQTS----------
KATG1_SHEAM       ----------------------------------MSNEGKCPVMHGGATS----------
KATG_AGRFC        -----------------------------MDAT-SKPAGKCPVMHGGNTA----------
KATG_PARDP        -----------------------------MDGNDIRSTGKCPVMHGGNTA----------
KATG_CHRSD        ------------------------------------MSGKCPVMHGGNTS----------
KATG_MARHV        -------------------------------MSETNSGGKCPVMHGANST----------
KATG_HYPNA        -----------------------------MDGND-LVENKCPVMHGGITV----------
KATG_MARMM        -----------------------------MDGNNSNSQGKCPVMHGGNTA----------
KATG_PARL1        --------------------------------MNTSTSGKCPVMHGSMTT----------
KATG_DINSH        -----------------------------MDGNDLRNVTGCPVMHGGNTG----------
KATG_ROSDO        -----------------------------MDGNNVDPTGGCPVMHGGNTA----------
F2I1Y2_PELSM      ---------------------------MSNEIVKSNSAGKCPIMHGGITK----------
KATG1_SHEON       -----------------------------MDKTQ-RSQGKCPVMHGANSA----------
KATG_SHESW        -----------------------------MDKTH-SSQGKCPVMHGGNTS----------
KATG1_SHEFN       -----------------------------MDKAQ-HTQGKCPVAHGGNTT----------
KATG1_CELJU       -----------------------------MDNNPPTSTGKCPFTHGSVTA----------
KATG_SYNY3        ----MGTQPARKLRNRVFPHPHNHRKEKPMANDQ-VPASKCPVMHGANTT----------
KATG1_IDILO       -----------------------------MTKSS--GGGKCPIMHGSMTS----------
KATG_VIBCB        -----------------------------MSDKN--HHSKCPVIHGANTN----------
KATG_BACHD        --------------------------------MDTNNTGKCPFHHGATTSPK--------
KATG_GEOKA        -----------------------------MKNQNQHNTSKCPYH-GSVTSYN--------
KATG_ERYLH        ---------------------------MQMDAKTGDISGGCPFHGDGGTRS---------
KATG_SPHAL        -----------------------------MNDQT-PIGSGCPVHQPGGVRS---------
KATG_PHEZH        -----------------------------MDDAS---PLSNPAKEPAALRS---------
KATG_ARCB4        ------------------------------------MAGKCPMGFGTTNPMVR-------
KATG_RUEPO        -----------------------------MDGNDAPNAGQCPVMHGHAAG----------
KATG_RUEST        -----------------------------MDGQDIGAGGGCPFSGANTNK----------
KATG_JANSC        -----------------------------MMDGAQTNSGGCPVMHGGGSRPM--------
                                                                              

KATG_ECOLI        ----------------AGAGTTTR---------------------------DWWPNQLRV
KATG_SALTY        ----------------AGAGTASR---------------------------DWWPNQLRV
KATG_ENT38        ----------------AGEGTGSR---------------------------DWWPKQLRV
KATG_CROS8        ----------------AGGGTSSR---------------------------DWWPNQLRV
KATG_ERWT9        --------------RGAGGGTSNR---------------------------DWWPEQLRV
KATG_KLEP7        ----------------AGSGTANR---------------------------DWWPNQLRV
KATG_ACIBC        --------------VTVGGGTANL---------------------------HWWPNQLRV
KATG_PSEMY        ----------------AGGGTTNK---------------------------DWWPNQLRV
KATG_METPP        ----------------AGGGTTNQ---------------------------DWWPSQLRL
KATG_JANMA        ----------------ANRSRSNQ---------------------------DWWPNQLRV
KATG_AZOC5        TGK--------CPVAHGTGGTQNR---------------------------DWWPNQLRV
KATG_RALPJ        ------------------GGTANK---------------------------DWWPNQLRV
KATG_ACIAC        ------------------GGIINK---------------------------DWWPNQLRL
KATG_PARPJ        ------------------GGTTNR---------------------------DWWPKQLRL
KATG_PARXL        ------------------GGTTNR---------------------------DWWPKQLRL
KATG_CUPNH        ------------------GGTTNR---------------------------DWWPNQLRL
KATG2_BURCJ       ------------------GGTTNR---------------------------DWWPNELRL
KATG_BORA1        ------------------SGTTNQ---------------------------DWWPKRLRL
KATG_HERSE        ------------------SGTSNR---------------------------DWWPKQLRV
KATG_XANCP        ------------------AGTTNR---------------------------DWWPKQLRV
KATG_XANC5        ------------------TGTTNR---------------------------DWWPKQLRV
KATG_XYLFA        ------------------EGTHNK---------------------------DWWPNQLRV
KATG1_MAGO7       -----------RTANVAGGGTRNR---------------------------DWWPNTLKL
KATG_NEUCR        -----------RKSNVGGGGTRNH---------------------------DWWPAQLRL
C7ZHZ3_NECH7      -----------RVINAAGHGQQNR---------------------------NWWPDSLKT
KATG2_MAGO7       APETTTFGRCAVKSNQAGGGTRSH---------------------------DWWPCQLRL
C7ZIK0_NECH7      AED---FGRCRVAGNAAGAGTRSR---------------------------DFWPCQLRL
KATG_FLAJ1        ----------GSMDNQAASGTKNN---------------------------DWWPKQLKV
KATG_METI4        -----------------GGLKTNE---------------------------EWWPNRLNL
KATG_PSEE4        --------------QTAGGGTSNR---------------------------DWWPDQLNL
KATG_PSEPF        --------------HAAGGGTTNR---------------------------DWWPNQLNL
KATG_PSESM        --------------HAAGGGTTNR---------------------------DWWPKQLNL
KATG2_BURCC       --------------HGKRNGTTNR---------------------------DWWPNQLNL
KATG2_CUPPJ       --------------HAAGSGTSNR---------------------------DWWPHQLNL
KATG_CUPMC        --------------HPAGAGRALQ---------------------------EWWPERLNL
KATG_PSEF5        --------------HTAGEGTSNR---------------------------DWWPGQLNL
KATG_BURL3        --------------HTAGGGTTNK---------------------------DWWPNQLNL
KATG1_BURVG       --------------HTAAGGTSNH---------------------------DWWPNRLNL
KATG_BURM1        --------------HTAGSGTSNK---------------------------DWWPNQINL
KATG_BURPS        --------------QAAGNGTSNR---------------------------DWWPNQLDL
KATG_SERP5        --------------NTPRRGPSNQ---------------------------DWWPNQLSL
KATG_RALSO        --------------AAAGGGVSNR---------------------------DWWPNQLNL
KATG_HAHCH        -----------------AEGTSNR---------------------------DWWPNQLRL
KATG_SHEB8        -----------------AGGTTNR---------------------------DWWPKQLRL
KATG_METB6        -----------------GRGQSYR---------------------------DWWPNQPNL
KATG_METAC        -----------------GRDMSNR---------------------------DWWPNHLKL
KATG_METHJ        -----------------GKGRTNR---------------------------DWWPDQLNL
KATG_CHLCH        -----------------EKGRSNH---------------------------DWWPNQLNL
KATG_SYMTH        -----------------GHGTSNK---------------------------DWWPNQLNL
KATG_FLAPJ        ----------------AGAGTRNS---------------------------NWWPNQLKL
KATG_GRAFK        ----------------AGKGTSNR---------------------------DWWPNQLNL
KATG_ACAM1        ----------------AGSGTANR---------------------------DWWPNQLNL
KATG_POLSJ        ----------------AAGAPSNA---------------------------DWWPNQLKL
KATG_BRASO        ----------------SKCPFSGG--------------------LKGFKNKDWWPNQLDL
KATG_RHILO        ----------------GKCPVAHG--------------------SAGRTNRDWWPNQLNV
KATG_BEII9        ----------------GKCPFVHA--------------------EHGRTNRDWWPKQPNL
KATG_CAUVC        ----------------GKCPMGHGRG---------------------PANRDWWPQSLRL
KATG_PSEU5        ----------------GGCPLGHGAGA----------------PRKRPSNRDWWPEALSL
KATG_RHOP5        ----------------GKCPFSSG--------------------SHAHRNRDWWPDQLDI
KATG_RHOPT        ----------------GKCPFSGG--------------------SHGHRNRDWWPDQLDI
KATG_RHOPS        ----------------GKCPFPHGGG------------------SRGHRNRDWWPEQLDI
KATG_RHOPB        ----------------GKCPVAHG--------------------PAPRGNRDWWPEQLNL
KATG_SOLUE        ----------------AKCPVAHT--------------------AHGRRNRDWWPDALDI
KATG_CHESB        ----------------GKCPFTGGG-------------------RRGHRNRDWWPEQLDL
KATG_NITHX        ----------------GKCPFTSG---------------------RSHRIRDWWPGQLDV
KATG_NITWN        ----------------GQCPFTSG---------------------RGHKNRDWWPEQLDV
KATG_RHIL3        ----------------GKCPVAHGNT------------------PRSRSNRDWWPDQLNV
KATG_SINMW        ----------------GKCPVAH-TA------------------PRGRSNRDWWPDQLDV
KATG_ACICJ        ----------------GGATRSSS--------------------AGIQSNADWWPNQINL
KATG2_SHEFN       ----------------SGSAFASNNEKSEMTKPKGAVGTGVALENQARTNQFWWPDQLNL
KATG_SHELP        ----------------FNPAVADEQESAQMTKPKGAAATGTAKAFQPKSKQFWWPDQLDL
KATG_ALTMD        ----------------ATGAIAND----QISKPAGAKGTGMTKAFQPKSNQFWWPDQLDL
KATG_COLP3        ----------------LTS----------MVLPAKALAAN-----EAKTNQFWWPDQLSL
KATG_SHEWM        -----------------------------MVTAASAVENE-----QPKSNQFWWPNQLDL
KATG2_SHEAM       ----------------MSLALAAG---QTQAAETTT-------------NSYWWPEQLDL
KATG2_SHEON       ----------------MSLALGAG---MATAQEQATG------------NQFWWPEKLNL
KATG2_CELJU       ----------------ISCAIYSG---AALAQDAANS------------NKFWWPEQLNL
KATG2_IDILO       ----------------ISFSAGTG---VANAQENASYEVNSPE---PKSNDFWWPNKLNL
KATG_PSEA6        ----------------TSNRLISA---VSLAIASLCISQSALADGMPKTNTFWWPEQLNL
KATG_LEPBP        ----------------PIGAADTK---ETPGMDRQNT-----------SNQFWWPERLDL
KATG_NOVAD        ----------------MAPALLPA---AARAEGTAAPAATAPAT--PMSNRDWWPNRLDL
KATG2_BURVG       ----------------SAGSISAR------ADGAPRA------------NGFWWPETLDL
KATG_GRABC        ----------------TIPMVPAW------SDGEPRS------------IQFWWPDHLDL
KATG_ECOLX        ----------------SGSFSTAV------AADKKET------------QNFYYPETLDL
KATG_YERPE        ----------------VHNTPTAW------AAEAPKT------------DSFYLPKSLDL
KATG_FRATT        ----------------LLASSNAI------AEDTTTK------------NDNLSPQSVDL
KATG_SACD2        ----------------SATAQ---------ADTGMNP-----------DNDYWWPNRLSL
KATG2_LEGPA       ----------------ISPSVFPN---YAYAQEDKPK-----------TNQYWWPKMLDL
KATG2_HALMA       ----------------SKRPKSN---------------------------QDWWPSKLNL
KATG1_HALMA       ----------------SLMAKRD---------------------------QDWSPNQLRL
KATG_HALSA        ----------------EDHNFGT---------------------------SDWWPNQLDL
KATG_NATPD        ------------------MSIDY---------------------------KKLWPEALDF
KATG_SALRD        ----------------DSMPETS---------------------------REWWPGSLDV
KATG_METRJ        ----------------GKCPFGGD--------------RIGGALGNRPTLENWYPHRLRV
KATG_PSELT        ----------------SRKRWIT----------------------------DWWPNRLNL
KATG_ARCFU        ----------------ARKRWIT----------------------------DWWPNRLNL
B5Y4Y9_PHATC      ----------------NKAASAN---------------------------SYWWPDNINL
B8CF21_THAPS      ----------------TTKPQTI---------------------------RDWWPDSLDL
KATG3_MYCS2       ----------------NSPAASED--------------------------GLGWPRRLNL
KATG_MYCGI        ----------------IDSPEPK--------SHAPLT------------NRDWWPEQVDV
KATG1_MYCVP       ----------------IDSPEPK--------VHAPLT------------NKDWWPEQVDV
KATG_MYCSS        ----------------IDSPEPK--------AHAPLT------------NKDWWPEQVDV
KATG1_MYCFO       ----------------IESPKPK--------AHAPLT------------NQDWWPDQVDV
KATG_MYCIT        ----------------IPSPKPK--------AHAPLT------------NRDWWPDQVDV
KATG_MYCUA        ----------------ISSPTPQ--------DHAPMT------------NRDWWPNQIDV
KATG2_MYCS2       ----------------IPSPKPK--------SGAPLR------------NQDWWPNQIDV
KATG_RHOJR        ----------------IPSPTPA--------ANRPRN------------NRDWWPNQPEL
KATG_NOCSJ        ----------------IDSPTPRT-------GGRPNS------------LKDWWPNHLDL
KATG_SALTO        ----------------IDSPSAVG-------GGRPRT------------NRDWWPNQLDL
KATG1_CUPPJ       ----------------IPSPTPK--------VSRPRR------------NKDWWPNQLDL
KATG_FRACC        ----------------GGCPVAHR------RAPHPTQGG---------GNRGWWPNRLNL
KATG_FRASN        ----------------GGCPVAHE------RAPHPTQGG---------GNRGWWPNRLNL
KATG_STRCO        ----------------DGCPVAHG------RAPHPTQGG---------GNRQWWPERLNL
KATG_STRRE        ----------------GGCPVAHD------RALHPTQGG---------GNRQWWPERLNL
KATG_STRGG        ------------GAQAAGCPVAHG------RAPHPTQGG---------GNRQWWPDRLNL
KATG_SACEN        ----------------GGCPVAHGD-----RLPHPTQGG---------ANTHWWPNRLNL
KATG2_MYCFO       ----------------SGCPM---------RIKPPVEGG---------SNRDWWPNAVNL
KATG2_MYCVP       ----------------SGCPM---------VIKPPVEGG---------SNRDWWPNAVNL
KATG1_MYCS2       ----------------GGCPAGFG------RIKPPVAGG---------SNRDWWPNQLNL
KATG_MYCA9        ----------------NGCPVAGG------RLNYPVEGGN--------ANREWWPTQLNL
KATG_MYCTU        ----------------NGCPVV-G------HMKYPVEGG---------GNQDWWPNRLNL
KATG_NOCFA        ----------------GGCPVT-G------RLRHPLQGG---------GNHEWWPNQLNL
KATG_GLOVI        --------------KVEGRAVLFE-----------------------MTNRLWWPNHLDL
KATG_KORVE        ------------KCPVGAHTLAGA-----------------------RSNANWWPNQLNI
KATG_CAUSK        -----------------HTSFGGR------------------------SNRDWWPNQLNL
KATG_MARMS        -----------------TNQSSGRGT----------------------SNKDWWPNQLNL
KATG1_ALKMQ       ----------------TSGGTTNQ---------------------------DWWPNQLNL
KATG_DESHY        ----------------TGGGTKNK---------------------------DWWPNQLNL
KATG_PELCD        --------------PMTGRGTTNQ---------------------------DWWPNQLKL
KATG_PELPD        --------------PIASSGRANR---------------------------DWWPHQLNL
KATG_GEOLS        --------------QVAGGGTSNR---------------------------DWWPNQLNL
KATG_GEOSL        -----------------GGGTSNR---------------------------QWWPNQLNL
KATG_DESOH        ------------------GGMSNR---------------------------DWWPNQLNL
KATG_CLOBB        ----------------AGSGTTNK---------------------------DWWPNQLNL
KATG_PROA2        ---------------ATGSGLSNR---------------------------DWWPNQLHL
KATG_AZOSB        ----------------PATARANR---------------------------DWWPNQLNL
KATG_DECAR        ----------------TVGTQSNR---------------------------DWWPKVLNL
KATG_SYNSC        ----------------ASAHTGNR---------------------------QWWPIQIDL
KATG_SYNPW        ----------------PAGNTNNG---------------------------DWWPNQINL
KATG_SYNR3        ----------------PASATTNQ---------------------------HWWPEQINL
KATG_PSYIN        -----------------VSI-SNM---------------------------EWWPKALNL
KATG_SYNP2        -----------------SSMATNM---------------------------EWWPKALNL
KATG_SYNP6        -----------------VNI-STA---------------------------EWWPKALNL
KATG1_VIBPA       -----------------NNR-TEK---------------------------NWWPKSLNL
KATG_SHEDO        -----------------ENSMANM---------------------------NWWPKSLSL
KATG_SHEHH        -----------------EISMSNM---------------------------EWWPKALNL
KATG_AERS4        ------------------GEQANM---------------------------AWWPKSLNL
KATG_ALKEH        ------------------AGKSNM---------------------------DWWPNNLNL
KATG_HALHL        ------------------VGESNL---------------------------DMWPNALNL
KATG_PECAS        ------------------TGSSNT---------------------------DWWPNALNL
KATG_RHOS5        ------------------MGTSNT---------------------------DWWPNALNL
KATG1_LEGPL       ------------------AETSNT---------------------------AWWPNALNL
KATG_EDWTA        ------------------AGMASK---------------------------DWWPNALNL
KATG_LEPCP        ------------------AAQSNT---------------------------AWWPNALNL
KATG_VIBCH        ------------------ASMSNM---------------------------DWWPKALNL
KATG_VIBVY        ------------------SNSSNV---------------------------AWWPKALNL
KATG_POLAQ        ------------------ASETPM---------------------------AWWPKALNL
KATG2_VIBPA       ------------------TDKSVM---------------------------DWWPNALNL
KATG1_SHEAM       ------------------ATQADN---------------------------HWWPKALNL
KATG_AGRFC        ------------------SGKSVT---------------------------EWWPNALNL
KATG_PARDP        ------------------MGSSVT---------------------------AWWPNALNL
KATG_CHRSD        ------------------TGTSNK---------------------------DWWPEGINL
KATG_MARHV        ------------------ENRDVM---------------------------NWWPEALNL
KATG_HYPNA        ------------------AGHSNT---------------------------AWWPETLNL
KATG_MARMM        ------------------SEGDVM---------------------------AWWPRALNL
KATG_PARL1        ------------------AERSVT---------------------------EWWPNALNL
KATG_DINSH        ------------------MNTSPV---------------------------RWWPNALNL
KATG_ROSDO        ------------------MDKPVT---------------------------KWWPNALNL
F2I1Y2_PELSM      -----------------AGESNTS---------------------------RLWPNSINL
KATG1_SHEON       ------------------VASNNM---------------------------DWWPKALNL
KATG_SHESW        ------------------VTTNNM---------------------------DWWPKALNL
KATG1_SHEFN       ------------------VASDVM---------------------------EWWPNALNL
KATG1_CELJU       ------------------SGKSNT---------------------------DWWPNALNL
KATG_SYNY3        ------------------GQNGNL---------------------------NWWPNALNL
KATG1_IDILO       ------------------EKKTNT---------------------------HWWPNSLKL
KATG_VIBCB        ------------------QQASEF---------------------------NWWPKSLNL
KATG_BACHD        -----------------SSGTTNN---------------------------DWWPNALNL
KATG_GEOKA        -----------------SNRTTNK---------------------------DWWPNQLNL
KATG_ERYLH        -----------------LLGRTNR---------------------------DWWPDQLQL
KATG_SPHAL        -----------------LLGRTNK---------------------------DWWPDMLAT
KATG_PHEZH        -----------------LLGRTNR---------------------------DWWPNQLSL
KATG_ARCB4        -----------------NGGTSNK---------------------------DWWPNQLNL
KATG_RUEPO        ------------------TGMRNH---------------------------HWWPNQINL
KATG_RUEST        ------------------GRRSNR---------------------------DWWPNQLNL
KATG_JANSC        ------------------GATANQ---------------------------HWWPNQLNL
                                                                        *     

KATG_ECOLI        DLLNQHSNRSNPLGEDFDYRKEFSKLDYYGLKKDLKALLTESQPWWPADWGSYAGLFIRM
KATG_SALTY        DLLNQHSNRSNPLGEDFDYRKEFSKLDYSALKGDLKALLTDSQPWWPADWGSYVGLFIRM
KATG_ENT38        ELLNQHSNRSNPLGEDFDYRKEFSKLDYSALKGDIKALLTDSQSWWPADWGSYVGLFIRM
KATG_CROS8        ELLAQHSNRTNPLGDDFNYRKAFSELDYAALKADLKALLTDSQPWWPADWGSYTGLFIRM
KATG_ERWT9        DLLNQHSRRSNPLNEHFNYREEFAKLDYPQLKADLKSLLNDSQEWWPADWGSYIGLFIRM
KATG_KLEP7        DLLNQHSNRSNPLGENFNYREEFKKLDYSALKADLRALLTDSQEWWPADWGSYIGLFIRM
KATG_ACIBC        DLLNQHSERSNPLGKDFNYRQEFKKLDYYALKADIKNVLTDSQDWWPADWGNYTGLFIRL
KATG_PSEMY        DLLNQHSDRSNPLGEKFNYAEAFKKLDYKALKADLVRLMTDSQDWWPADFGHYGPQFIRM
KATG_METPP        ELLNQHSSKSDPLGAGFDYAEEFKKLDYFALKKDLLALMTDSQDWWPADFGHYGPQFVRM
KATG_JANMA        DVLNQHSNKSNPLGEKFNYAEEFKKLDYKALKADLVKLMTDSQDWWPADFGHYGPQFVRM
KATG_AZOC5        DLLNLHSPKSDPLGAAFDYRAEFKKLDYEALKNDLRKLMTDSQDWWPADFGNYGPQFVRM
KATG_RALPJ        DLLNQHSEKSDPLGSNFNYRKSFNAIDYDALKADLRRLMTDSQDWWPADFGHYGPQFIRM
KATG_ACIAC        DLLNQHSSKSDPLGAGFDYAEEFKKLDYEGLKRDLRALMTDSQDWWPADFGHYGPQFVRM
KATG_PARPJ        DLLSQHSSKSDPLDGSFNYAEAFKTLDLAAVKKDLAALMTDSQDWWPADFGHYGPLFIRM
KATG_PARXL        DLLSQHSGKSNPLDGGFNYAEAFRSLDLAAVKKDLAALMTDSQDWWPADFGHYGPLFIRM
KATG_CUPNH        DLLSQHSSKSNPLGGDFNYAKAFKSLDFAAVKKDLAALMTDSQDWWPADFGHYGPLFIRM
KATG2_BURCJ       DLLSQHSSKTDPLDPGFNYAEAFNSLDLDALRKDLAALMTDSQDWWPADFGHYGPLFVRM
KATG_BORA1        ELLSQHSAKTNPLDPDFDYAKAFNSLDLAAVKQDLAKLMTDSQDWWPADFGHYGPLFIRM
KATG_HERSE        DLLAQHSSKSNPMGEDFDYAEAFKSLDLAAVKADLAKVMTDSQDWWPADFGHYGPLFVRM
KATG_XANCP        DLLNQHSARSNPLAASFNYAEAFKRLDLQTLKQELRALMTDSQDWWPADFGHYGPLFVRM
KATG_XANC5        DLLSQHSSKSNPLGQSFNYADAFKRLDLQALKRDLHALMTDSQDWWPADFGHYGPLFVRM
KATG_XYLFA        DLLHQHSNKSNPLGETFDYAKEFQKLDYAALKRDLHALMTDSQDWWPADFGHYGGLFIRM
KATG1_MAGO7       NILRQHTEATNPYDPNFDYAEAFKSLDYEGLKKDLRALMTDSQEYWPADFGHYGGLFVRM
KATG_NEUCR        NILRQHTPVSNPLDKDFDYAAAFKSLDYEGLKKDLTKLMTDSQDWWPADFGHYGGLFIRM
C7ZHZ3_NECH7      NILRQHTNVTNPRGENFDYAAAFKTLDYESLKKDLRELMTDSQEYWPADFGHYGGLFIRM
KATG2_MAGO7       DVLRQFQPSQNPLGGDFDYAEAFQSLDYEAVKKDIAALMTESQDWWPADFGNYGGLFVRM
C7ZIK0_NECH7      DVLRQFSPQINPLGEEFDYVEAFKTLDYEALKKDLHSLITDSQDWWPADFGHYGGLFIRM
KATG_FLAJ1        NILRQNSSLSNPLSKDFDYAEAFKTLDLEAVKKDLHVLMTDSQDWWPADFGHYGGLFIRM
KATG_METI4        KILRQNSPLSNPMGAGFNYAKEFCSLDLSALKEDLRRLMTDSQQWWPADFGHYGPLFIRM
KATG_PSEE4        KILHQHSRKSDPMDPDFDYAKAFKSLDFQALKKDLTALMTDSQDWWPADFGHYGPLFIRM
KATG_PSEPF        KILSQHSPASDPMGKDFDYAKAFKSLDFQALKRDLTALMTDSQEWWPADFGHYGPLFIRM
KATG_PSESM        KILHQHSSLSDPMGEDFDYAKEFKSLDFEAVKQDLRDVMTRSQDWWPADFGHYGPLFIRM
KATG2_BURCC       KILHQHSSEADPMDPGFDYAEAFNSLDLAAVKADLRALMTASQDWWPADFGHYGPFFVRM
KATG2_CUPPJ       GILRQHSSLADPMDKGFNYAEEFKSLDLAAVKHDLAALMTVSQDWWPADFGHYGGLFIRM
KATG_CUPMC        HILRQNAPLSDPMGEAFDYAKAFNSLDLAAVKKDLEALMTDSQSWWPADFGHYGPLFVRM
KATG_PSEF5        KILHQHSRLSDPMAEGFDYAAEFKTLDLAAVKRDLQALMTDSQPWWPADFGHYGPLFIRM
KATG_BURL3        NILHRHSALSDPMDKDFDYAEAFKKLDLAAVKKDLHALMTASQDWWPADFGHYGGLFVRM
KATG1_BURVG       EVLHRHSALSDPMDAEFDYAQAFKQLDLAAVKRDLHALMTMSQDWWPADFGHYGGLFVRM
KATG_BURM1        NILHRHSSLSDPMDKDFNYAEAFKQLDLAAVKRDLHALMTTSQDWWPADFGHYGGLFIRM
KATG_BURPS        SILHRHSSLSDPMGKDFNYAQAFEKLDLAAVKRDLHALMTTSQDWWPADFGHYGGLFIRM
KATG_SERP5        KPLHQHSSLSDPMDPDFDYAKAFNSLDLAAVKQDLHALMTDSQEWWPADFGHYGGLFIRM
KATG_RALSO        KVLHQHSSKSDPMDTDFDYAQAFKRLDLAAVKQDLLALMTTSQDWWPADFGHYGPLFIRM
KATG_HAHCH        EILHQRSALSNPLGEEFNYAEAFKSLDLAAIKQDLTALMTDSQDWWPADFGHYGPLFIRM
KATG_SHEB8        DILHQHSSLSNPMGDDFNYAEAFKSLDLAAVKQDLLALMTDSQDWWPADFGHYGPLFIRM
KATG_METB6        RVLSQHSPRSNPMGGEFNYAEEFKKLDFAAVKADLRALMTSSQEWWPADFGHYGPLFIRM
KATG_METAC        EILHQHSSKSNPMGEDFNYAKEFKSLDLAAVKKDLAALMTDSQDWWPADFGHYGPLFIRM
KATG_METHJ        KILSQNSPLSNPLGQKFNYRVEFSKLDLAAVKQDLRDLMTSSQDWWPADFGHYGPLFIRM
KATG_CHLCH        KILHQHSALSNPMDKDFNYAEEFKKLDLAAIKQDLYALMTDSQEWWPADYGHYGPLFIRM
KATG_SYMTH        RILHQHSEKANPMGPDFNYREEFKKLDYWALKEDLRKLMTESQDWWPADFGHYGPLIIRM
KATG_FLAPJ        NILRQYSSLSNPMGEEFNYAAAFKSLDLITLKKDISDLMTNSQDWWPADYGHYGPFFIRM
KATG_GRAFK        NILRQNSSLINPMDDGFNYAEAFKSLDLNAVKQDIYDLMTNSQDWWPADYGHYGPFFIRM
KATG_ACAM1        QILRQHSPKSNPMDKAFNYAEAFKSLDLADVKQDIFDLMKSSQDWWPADYGHYGPLFIRM
KATG_POLSJ        NILHQHSAMSDPMGEAFNYAQEFKSLDLEAVKKDLLALMTNSQDWWPADFGHYGPLFIRM
KATG_BRASO        SVLHQHSNLSDPLGEAFDYAKEFKSLDLDALVKDLHALMTDSQEWWPADFGHYGPLFIRM
KATG_RHILO        QILHQQSSLSDPMGEAFDYAEEFKSLDLDAVIKDLHALMTDSQEWWPADFGHYGPLFIRM
KATG_BEII9        QILHQNSSLSNPMGEAFDYAKEFKSLDLNAVIADLKALMTDSQDWWPADFGHYGGLFIRM
KATG_CAUVC        EGLNQHAPRSNPMGEAFDYAEAFKSLDLDAVVSDLHALMTDSQEWWPADFGHYGGLFIRL
KATG_PSEU5        TSLNQHSPRSNPYGGDFDYAAEFNSLDLDAVIADLHKVMTDSQDWWPADFGHYGGLFIRM
KATG_RHOP5        QVLHHNSKKSDPLGEAFNYAEEFKKLDLAALKQDLTALMTDSQDWWPADFGHYGGLFIRL
KATG_RHOPT        SVLHNNSKKSDPMGAAFNYAEEFKKLDLEAVKKDLHALMTDSQEWWPADFGHYGGLFVRM
KATG_RHOPS        NMLHRNSTLSDPLGKAFDYAKEFESLDLDAVIKDLHALMTDSQDWWPADFGHYGGLMIRM
KATG_RHOPB        SMLHQRSPSADPLGKDFHYAEQFKTLDLKALKQDLTALMTESQDWWPADFGHYGGLFIRM
KATG_SOLUE        STLHRNSSLSDPMGSGFDYAMEFESLDLQAVIKDLHALMTDSQDWWPADFGHYGGLMIRM
KATG_CHESB        DVLHRNSTLSDPMGEDFDYAEEFKSLDLNAVIQDLHALMTDSQDWWPADFGHYGGLMIRM
KATG_NITHX        QVLHHNSNLSDPMDEDFDYAREFESLDLNAVIKDLTALMTDSQDWWPADFGHYGGLMIRL
KATG_NITWN        QVLHQKSNLSNPMGRDFDYASAFASLDLNAVIADLKALMTDSQDWWPADFGHYGGLMVRM
KATG_RHIL3        QILHQNSGRADPLGQAFDYAEEFKKLDLDGLKKDLHALMTDSQDWWPADFGHYGGLFIRM
KATG_SINMW        QVLHRHSDLSDPMGKSFNYAEEFRKLDLDALKRDLHALMTDSQDWWPADFGHYGGLFIRM
KATG_ACICJ        GMLHQHSALSNPMDPDFDYAAEFKTLDLDAVIADLKALMTDSQDWWPADFGHYGPLFVRM
KATG2_SHEFN       SALRDHDKRSNPYGENFDYAKAFNSLDLDKVKLDINALLTTSQDWWPSDYSNYGPFFIRM
KATG_SHELP        SPLRDHDSRSNPYGESFDYAKAFNSLDLDQVKADIDQLLTQSQDWWPADYGNYGPFFIRM
KATG_ALTMD        SPLRDHDNRSNPLGEDFDYAKAFSKLDLDQVKSDINELLTTSQDWWPADFGNYGPFFIRL
KATG_COLP3        SPLRQHGAESNPYGEQFNYAKEFASLDLAMLKKDIQTTLTDSKSWWPADWGHYGPLMIRM
KATG_SHEWM        TPLRNHSDESNPQNSNFDYAEAFEKLDLEAVKKDIDKVLTNSQDWWPADYGHYGPFFIRM
KATG2_SHEAM       SPLRQHGSESNPYGADYDYAKAFGSLDLVAVKADIKTVLTTSQDWWPADYGHYGPFFIRM
KATG2_SHEON       SPLRQNAIESNPYGSDYRYAEAFNTLDLDAVKKDIKALMTESQDWWPADYGHYGPFFIRM
KATG2_CELJU       SPLRQHGVESNPMGSTFNYAQAFKKLDLNAVKADIKALMTQSQDWWPADYGHYGPFFIRM
KATG2_IDILO       EPLRQHSPESDPYGDDFDYAEAFSQLDLEQVKKDIEELMTSDQDWWPADYGHYGPFFIRM
KATG_PSEA6        QPLRQNDAKSNPLGGDFNYADAFKTLNLANVKSDIKALLTSSQDWWPADYGHYGPFFVRM
KATG_LEPBP        APLRQHGSESNPLGRQFHYAKEFKELDIQTLKEEIKTVMKTSQDWWPADYGHYGPFFIRM
KATG_NOVAD        SPLRQHGVESNPMGGKFNYAEEFKTLDLAAVKKDIEALMTTSQDWWPADYGHYGPFFIRM
KATG2_BURVG       SPLRQHDVESNPYGKDFDYAQAFQKLDIEAVKKDIRTTLTTSQDWWPADYGNYGPFFIRM
KATG_GRABC        SPLRQHAAESDPLGANFNYIKAFQTLDLGAVKKDIAVLLKTPQDWWPADYGNYGPFFIRM
KATG_ECOLX        TPLRLHSPESNPWGADFDYATRFQQLDMEALKKDIKDLLTTSQDWWPADYGHYGPFFIRM
KATG_YERPE        SPLRLHNIESNPYGKDFNYAQQFKTLDLEAVKKDIKTVLTTSQDWWPADYGNYGPFFIRM
KATG_FRATT        SPLRNLNKLDSPMDKDYNYHQAFKKLDTEQLKKDMQDLLTQSQDWWPADFGNYGPFFIRL
KATG_SACD2        EPLRDSSLSADPRGANFDYNEALKDLDVEALKKDLKQVMTASQDWWPADYGHYGPFFIRL
KATG2_LEGPA       SPLRQPNATSNPMGEQFNYAEEFNSLDLNAVIEDLKKLMTTSQDWWPADYGNYGPLFIRM
KATG2_HALMA       EILDQNARDVGPVEDDFDYAEEFQKLDLEAVKSDLEELMTSSQDWWPADYGHYGPLFIRM
KATG1_HALMA       DILDQNARDADPRGTGFDYAEEFQELDLDAVKADLEELMTSSQDWWPADYGHYGPLFIRM
KATG_HALSA        EILDQNSQQVDPYGEDFDYAEAFEDLDLAAVKDDLEEMMTDSKDWWPADYGHYGPLFIRM
KATG_NATPD        ESLDQNAQHVDPKDEDFDYAEAFQELDLEEVKQDIESVMTDSQEWWPADYGHYGPLFIRM
KATG_SALRD        EILDQNAQDVGPWNGDFDYAEAFQELDYEALKEDIEEVMTTSKDWWPADYGHYGPLFIRM
KATG_METRJ        EVLHQNGLAADPLGPDFDYAAEFAKIDFEALKRDIKQFLTSSVDWWPSDYGNYGPQMIRM
KATG_PSELT        KILRQNCSDSNPYGSDYDYLKEVKTLDVDAVIEDLKKLMKTSQDWWPADFGHYGPLFIRL
KATG_ARCFU        KILRQNLQ--NPYGEDYDYVEEVENLDIDAVIRDLKELMRSSQDWWPADFGHYGPLFIRL
B5Y4Y9_PHATC      KILNQQGANNPDPS--FNYKEAFRELDVEMVKRDVNKMLTTSQDWWPADWGHYGPFMIRM
B8CF21_THAPS      RILHQDPIT----------AHSFAQLDLHQLRNDIYKALTTSNPNWPADYGHYGPLMIRL
KATG3_MYCS2       RILAQPCRTSSPLGEDFDYAKEFLSLDLDELARDIDEVLTTSQDWWPADFGHYGPLVLRM
KATG_MYCGI        SVLHKQNEKGNPFGEDFDYAAEFAKLDVDAFKADVIDLIRTSQDWWPADYGNYAGLFVRM
KATG1_MYCVP       SVLHKQNEKGNPLGEDFDYATEFAKLDVEAFKRDVIDLINTSQDWWPADYGSYAGLFIRM
KATG_MYCSS        SVLHKQNDKGNPLGEDFNYAEAFAQLDLEAFKRDVIEVIQTSQDWWPADYGNYAGLFIRM
KATG1_MYCFO       SRLHKQPIEGNPLGAGFNYAEEFQKLDVEALRADMLELMTSSQDWWPRDYGTYAGLFIRM
KATG_MYCIT        SSLHPHSPLSNPLGDDFDYAAEFAKLDVEALKADMISLMTTSQDWWPADYGHYGGLFIRM
KATG_MYCUA        SMLHPHPSQASPLGADFDYPKEFAKLDVDALKADVMSVMTTSQDWWPADYGHYGGLFIRM
KATG2_MYCS2       SRLHPHPPQGNPLGEDFDYAEEFAKLDVNALKADLTALMTQSQDWWPADYGHYGGLFIRM
KATG_RHOJR        SVLHAHTSKSNPMGEDFDYAEEFAKLDVEALKRDVIDLMTTSQDWWPADYGHYGGLFIRM
KATG_NOCSJ        SVLHAHSSKSSPLDPGFRYSEEFEKLDIEALRRDIVEVLHTSQDWWPADFGHYGGLFVRM
KATG_SALTO        SVLSTNSAKVNPLGEDFSYAKEFAKLDVEALKRDITEVLTTSQDWWPADFGHYGGLMIRL
KATG1_CUPPJ       SVLHTHSHLSCPLEEEFDYADQFKGLDVDALKQDLIQLMTTSQDWWPADYGHYGPLFIRM
KATG_FRACC        KILAKNPAVANPLGGEFTYAEAFRTLDLAAVKQDIAAVLTTSQAWWPADYGHYGPFIIRM
KATG_FRASN        KILAKNPAVANPLGEEFDYAAAFRTLDLPAVKRDIAQVLTTSQDWWPADYGHYGPFMIRM
KATG_STRCO        KILAKNPAVANPLGEEFDYAEAFEALDLAAVKRDIAEVLTTSQDWWPADFGNYGPLMIRM
KATG_STRRE        KILAKNPAVANPLDEDFDYAEAFKALDLAAVKRDIAEVLTTSQDWWPADFGNYGPLMIRM
KATG_STRGG        KILAKNPAVANPLGGDFDYAAAFRGLDLPAVKRDIAEVLTTSQDWWPADFGNYGPLMIRM
KATG_SACEN        KLLAKNPAVADPMGEEFDYAAEFKTLDLPAVKADIQEVLTTSQDWWPADFGHYGPLMIRM
KATG2_MYCFO       KILQKNPPAIDPSDEGYD-SEAVKSLDVEAFQRDFDELLTNSQDWWPADFGHYGPLFVRM
KATG2_MYCVP       KMLQKDPEVIDPMDEGYDYREAVQTLDVDQLARDFDELCTNSQDWWPADFGHYGPLFIRM
KATG1_MYCS2       KILQKNPDVINPLDEDFDYRSAVQNLDVDALRADIVEVMHTSQDWWPADFGHYGPLFIRM
KATG_MYCA9        QILKKNPPAANPLGEDFDYAKAVQTIDVDQLKADVAKVLTDSQDWWPADFGNYGPMFIRM
KATG_MYCTU        KVLHQNPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRM
KATG_NOCFA        KVLAKNPAEGNPLG-DFDYKAAFNSLDLAAVKADIAEVLTTSQDWWPADFGNYGPLMIRM
KATG_GLOVI        SVLHQNPPAGNPMGEGFNYAAEFESLDLAAVKQDIFALMTESQDWWPADYGHYGPLFIRM
KATG_KORVE        NILHQHSPLSDPMPEGFNYAEEFKTLDLDAVVKDLRHLMTDSQPWWPADYGHYGPFFIRM
KATG_CAUSK        KILHQHAPASNPMPAGFSYAEQVETLDVEALKRDLAALMTDSQDWWPADYGHYGPLFVRM
KATG_MARMS        NILHQHSPKSNPMGEDFDYAKEFNSLDLEAIRQDLFALMTDSQDWWPADYGHYGPFFIRM
KATG1_ALKMQ       KMLHQNPTMRNPMGERFNYAEEFKKLDFEALKNDLYALMTDSQEWWPADYGHYGPLFIRM
KATG_DESHY        NILHQNSALGNPMDPDFNYAEEFKKLDLAAVKKDLYALMTDSQDWWPADYGHYGPLFIRM
KATG_PELCD        NILHQHSSKSNPMGGDFNYAEEFKKLDLAAVKQDLYAMMTDSREWWPADWGHYGGLLIRM
KATG_PELPD        KILHQNPPLGNPMGEEFSYAEEFKKLDLEALKKDLYALMTDSQEWWPADYGHYGGLFIRM
KATG_GEOLS        QILHQQSTKSNPMGEGFNYRQEFTMLDLAAVKKDLVALMTDSQDWWPADWGHYGGLMIRM
KATG_GEOSL        HILHQHSALSNPMGGDFNYADEFRKLDLAAVKKDLHALMTDSQEWWPADWGHYGGLFIRM
KATG_DESOH        SILHQQSNKSNPMGEDFDYAKEFKKLNLAAVKKDLYALMTDSQEWWPADYGHYGGLFIRM
KATG_CLOBB        NILHQNSQLSNPMSKDFNYAEEFKKLDFQALKVDLYMLMTDSQIWWPADYGNYGPLFIRM
KATG_PROA2        DMLHQHSSLVNPMGEGFRYKEEFGKLDLKEVKKDLYALMTDSQEWWPADYGHYGGLFIRM
KATG_AZOSB        NILHQHAPASNPLGEDFDYAAEFNTLDLAALKQDLYALMTMSQDWWPADWGHYGGLFIRM
KATG_DECAR        NILHQHAPAANPMDADFDYSETFKTLDFGALKQDLYALMTTSQDWWPADWGHYGGLFIRM
KATG_SYNSC        GLLHQHHPASNPLGDTFDYPAAFAGLDLEALKADLAALMTDSQDWWPADWGHYGGLFIRM
KATG_SYNPW        GILHQHHPASNPLGDAFDYPTAFASLDYSALKADLQTLMTDSQDWWPADWGHYGALFIRL
KATG_SYNR3        GLLHQHNPAANPLGSNFDYRQAFNSLDLNAVKADLMALMTDSQSWWPADWGHYGGLFIRM
KATG_PSYIN        DILHQHDSKTNPMGPDFNYREMVKKLDVAALKKDMHALMTESQDWWLADWGHYGGLMIRL
KATG_SYNP2        DILHQHDHKTNPMGANFNYQDAVKTLDVDALKRDLHALMTDSQDWWPADWGHYGGLMIRM
KATG_SYNP6        DILSQHDRKTNPMGPDFNYQEEVKKLDVAALKQDLQALMTDSQDWWPADWGHYGGLMIRL
KATG1_VIBPA       DILHQHDAKTNPMPSDFDYQEEVKKLDFSALKQDLIALMTDSQEWWPADWGHYGGLMIRM
KATG_SHEDO        DILHQHDHKTNPMAADFNYQDEVKKLDFVALKNDLHALMTDSQAWWPADWGHYGGLMIRL
KATG_SHEHH        DILHQHDSKTNPMGAGFNYREQVKLLDVEALKKDLHALMTDSQPWWPADWGHYGGLMIRL
KATG_AERS4        DM--------------------------AALKQDVTALMTDSQDWWPADWGHYGALMIRM
KATG_ALKEH        DILHQHDRKTNPMGEDFDYREEVQKLDFDAVKKDLTELMTNSQDWWPADWGHYGGLMIRM
KATG_HALHL        DILHQHDRKPDPMGEGFNYREEVKKLDLDAVKQDLHQLMTDSQAWWPADWGHYGGLMIRM
KATG_PECAS        DILHQHDTKTNPLGSDFSYREALKTLDVDALKKDLHALMTDSQEWWPADWGHYGGLMIRM
KATG_RHOS5        DILHQHDSKTNPMGPGFDYRRALQGLDVTALKRDLHALMTDSQDWWPADWGHYGGLMIRM
KATG1_LEGPL       DILHQHDTKTNPMGKNFNYREEVKKLDFEALKKDLHALMTDSQPWWPADWGHYGGLMIRM
KATG_EDWTA        DILHQHDTKTNPMGQQFNYREALKQLDVQALKDDLRALMTDSQPWWPADWGHYGGLMVRM
KATG_LEPCP        DILHQHDTKTNPLGEGYRYREAVKQLDVAALKADLTALMTRSQPWWPADWGHYGGLMIRM
KATG_VIBCH        DILHQHDSKTNPLGADFNYREELKKLDVEALKRDLKALMTNSQEWWPADWGHYGGLMIRM
KATG_VIBVY        DILHQHDRKSNPMGADFSYREELKKLDVEALKRDLKALMTDSQDWWPADWGHYGGLMIRM
KATG_POLAQ        DILHQQDTKTNPMGSSFSYRDELKKLDVGALKKDMKDLLTNSQDWWPADWGHYGGLMIRM
KATG2_VIBPA       DILHQHDSKTNPFGPDFNYKEELKKLDVDALKQDLKDLMTNSQVWWPADWGHYGGLMIRM
KATG1_SHEAM       DILHQHDSKTNPMAPGFNYREALKGLDVEALKQDLKALMTDSQAWWPADWGHYGGLMIRM
KATG_AGRFC        DILHQHDTKTNPLGTSFNYREALKTLDVEALKADLRALMTDSQEWWPADWGSYVGMMARV
KATG_PARDP        DILHQHDSKTNPLGQDFNYSEELKKLDVEALKADLRALMTDSQDWWPADWGSYVGMFART
KATG_CHRSD        DILHQHDRKTNPMDPDFNYREEVKKLDVQALKNDLRQLMVDSQAWWPADWGSYVGMFARV
KATG_MARHV        DILHQHDHKTNPMGEDFDYREEVKKLDFEAVKKDLHALMTDSQDWWPADWGHYGGLMIRM
KATG_HYPNA        EILHQHDTKVSPLGKDFNYRDAVKSLDFEALKKDMHDLMTNSQDWWPADYGHYGGLMIRL
KATG_MARMM        EILHQKDTKPNPMGDGPSYHEALKSLDFDALKTDMHALLTDSQDWWPADYGHYGGLMIRL
KATG_PARL1        DILHQHDTKPNPMGKDFDYREELKKLDVAALKKDLQALMTDSQDWWPADWGHYGGLMIRM
KATG_DINSH        DILHQHGARVSPMDPDYDHREAVKALDFQGVWDDVDKLLTDSQDWWPADWGHYGGLFIRL
KATG_ROSDO        DILHQHGARTNPMDPDYDHRAAVKALDFEAVKADVKALMTQDQDWWPADWGHYGGLMIRL
F2I1Y2_PELSM      DILHQHDTKTNPL-PELNYRKEVKKLNFKTLKKDLLKLMTDSQEWWPADLGNYNGLMVRL
KATG1_SHEON       DILHQHDQKTDPMDPNFSYRDAFNSLDLAAVKQDLHSLMTDSQDWWPADWGHYGGLMIRM
KATG_SHESW        DILHQHDKKTDPMDPTFNYSEAFKTLDLAAVKQDLYALMTDSQDWWPADWGHYGGLMIRM
KATG1_SHEFN       DILHQHDNKTNPMDPNFDYREAFKSLDLSAVKQDLRALMTDSKDWWPADWGHYGGLMIRM
KATG1_CELJU       DILHQHDRKTNPLGDDFSYAAAFKTLDLQAVKNDLKALMTDSQDWWPADWGHYGGLFIRM
KATG_SYNY3        DILHQHDRKTNPMDDGFNYAEAFQQLDLAAVKQDLHHLMTDSQSWWPADWGHYGGLMIRM
KATG1_IDILO       EILRQHDTKANPLDEDFNYAEEFKKINLEELKQDLKNFMTDSQEWWPADWGHYGGLMIRM
KATG_VIBCB        EILHQHDHKTDPMGADFNYADAFNSLDFEEVKKDLKDLMTDSQDWWPADWGHYGGLMIRM
KATG_BACHD        NILRQHDKKSNPMGEEFDYAEEFSKLDYDALKQDVRDLMRDSQDWWPADFGHYGPFFIRM
KATG_GEOKA        SILHQHDRKTNPHDEEFNYAEEFQKLDYWALKEDLRKLMTESQDWWPADYGHYGPLFIRM
KATG_ERYLH        EILKEGGRNPDPMGEDFDYVEAFNAIDYTALKQDLTDLMTDSQEWWPADYGHYGPFFIRM
KATG_SPHAL        EILTPNGPS-NPMGEDFDYAKAFKSLDYYALKDDLKALMTDSQPWWPADYGHYGPFFIRM
KATG_PHEZH        DILHQHGRHGNPMGDDFDYAEAFKTLDYFAVKRDLHALMTDSQPWWPADYGHYGPFFIRM
KATG_ARCB4        KILSQHSNKVNPLGSDFDYAKEFSKLDYDALKADLTALMTDSQDWWPADYGHYGPLFIRM
KATG_RUEPO        KVLHQHSSKSDPMGAQFNYAEAFKSLDLDALKADLTALMTDSQDWWPADYGHYGPLFIRM
KATG_RUEST        SILHQHQARQNPLGETFNYAEAFKSLDLDAVKKDLIALMTDSQDWWPADYGHYGGLMIRM
KATG_JANSC        KPLSANSEKLDPMGEGFDYAEEFQKLDMAAVKADIANCLKDSQDWWPADYGHYGPLMIRL
                                                .  :.          *  * . *   . * 

KATG_ECOLI        AWHGAGTYRSIDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_SALTY        AWHGAGTYRSIDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_ENT38        AWHGAGTYRSVDGRGGAGRGQQRFAPLNAWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_CROS8        AWHSAGTYRSADGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPVKQKYGQKISWAD
KATG_ERWT9        AWHSAGTYRTVDGRGGSGRGQQRFAPLNAWP-DNVSLDKARR-LLWPVKQKYGQKISWAD
KATG_KLEP7        AWHGAGTYRTVDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPVKQKYGQKISWAD
KATG_ACIBC        AWHAAGTYRMGDGRGGAGRGQQRFAPLNSWP-DNASLDKARR-LLWPVKQKYGQKISWAD
KATG_PSEMY        AWHSAGTYRTTDGRGGGGRGQQRFAPLNSWP-DNVNIDKSRR-LLWPIKQKYGQSISWAD
KATG_METPP        AWHAAGTYRTADGRGGGGRGQQRFAPLNSWP-DNVNIDKSRR-LLWPIKQKYGQRISWAD
KATG_JANMA        AWHATGTYRTMDGRGGGGRGQQRFAPLNSWP-DNVNIDKSRR-LLWPIKQKYGQRISWAD
KATG_AZOC5        AWHSAGTYRLADGRGGGGRGQQRFAPLNSWP-DNVNIDKSRR-LLWPIKQKYGQKISWAD
KATG_RALPJ        AWHAAGTYRTGDGRGGAGRGQQRFAPLNSWP-DNVNIDKSRR-LLWPIKQKYGQAISWAD
KATG_ACIAC        TWHAAGTYRTGDGRGGAGRGQQRFAPLNSWP-DNVNIDKSRR-LLWPIKQKYGQKISWAD
KATG_PARPJ        AWHSAGTYRIGDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_PARXL        AWHSAGTYRIGDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_CUPNH        AWHSAGTYRIGDGRGGAGRGQQRFAPLNSWP-DNASLDKARR-LLWPIKQKYGQKISWAD
KATG2_BURCJ       AWHSAGTYRMGDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_BORA1        AWHSAGTYRVGDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKKKYGNKISWAD
KATG_HERSE        AWHSAGTYRIGDGRGGAGRGQQRFAPLNSWP-DNVNLDKARR-LLWPVKQKYGNKISWAD
KATG_XANCP        AWHSAGTYRTGDGRGGGGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQAISWAD
KATG_XANC5        AWHSAGTYRIGDGRGGGGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQAISWAD
KATG_XYLFA        AWHSAGTYRIGDGRGGAGRGQQRFAPLNSWP-DNVSLDKARR-LLWPIKKKYGQQISWAD
KATG1_MAGO7       AWHSAGTYRVMDGRGGGGQGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGNKISWAD
KATG_NEUCR        AWHSAGTYRVTDGRGGGGEGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGNKISWSD
C7ZHZ3_NECH7      SWHS---------------GQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGNKISWAD
KATG2_MAGO7       AWHSAGTYRAMDGRGGGGMGQQRFAPLNSWP-DNQNLDKARR-LIWPIKQKYGNKISWAD
C7ZIK0_NECH7      AWHSAGTYRAIDGRGGGGMGQQRFAPLNSWP-DNQNLDKARR-LLWPIKQKYGNKISWAD
KATG_FLAJ1        AWHSAGTYRVHDGRGGAGAGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGQKISWAD
KATG_METI4        AWHSAGTYRVHDGRGGAGSGQQRFAPLNSWP-DNVLLDKARR-LLWPIKQKYGRKISWAD
KATG_PSEE4        AWHSAGTYRIGDGRGGAGSGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGNKISWAD
KATG_PSEPF        AWHSAGTYRTADGRGGAGSGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGRNISWAD
KATG_PSESM        AWHSAGTYRTGDGRGGAGAGQQRFAPLNSWP-DNVSLDKARR-LIWPVKQKYGRKISWAD
KATG2_BURCC       AWHSAGTYRTGDGRGGAGRGQQRFAPLNSWP-DNVGLDKARR-LIWPVKQKYGRKISWAD
KATG2_CUPPJ       AWHAAGTYRTGDGRGGAGSGQQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGKKISWAD
KATG_CUPMC        AWHAAGTYRIGDGRGGAGAGQQRFAPTNSWP-DNVSLDKARR-LIWPIKQKYGRKISWAD
KATG_PSEF5        AWHSAGTYRIADGRGGAGGGQQRFAPLNSWP-DNVSLDKARR-LIWPIKQKYGRKISWAD
KATG_BURL3        AWHSAGTYRTADGRGGAGGGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGRNISWAD
KATG1_BURVG       AWHGAGTYRIADGRGGAGGGQQRFAPLNSWP-DNGNLDKARR-LLWPIKQKYGRNISWAD
KATG_BURM1        AWHSAGTYRIADGRGGAGGGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGRNISWAD
KATG_BURPS        AWHSAGTYRTADGRGGAGEGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGRAISWAD
KATG_SERP5        AWHSAGTYRIGDGRGGAGEGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGRKISWAD
KATG_RALSO        AWHSAGTYRTGDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGRNISWAD
KATG_HAHCH        AWHSAGTYRTGDGRGGGGTGNQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGQKISWAD
KATG_SHEB8        AWHSAGTYRTGDGRGGAGSGNQRFAPLNSWP-DNVSLDKARR-LIWPIKQKYGNKISWAD
KATG_METB6        AWHSAGTYRTLDGRGGAGSGQQRFPPLNSWP-DNVNLDKARR-LLWPIKKKYGRKISWAD
KATG_METAC        AWHSAGTYRAGDGRGGGGRGQQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG_METHJ        AWHSAGTYRTFDGRGGASGGEQRFPPLNSWP-DNVNLDKARR-LLWPIKQKYGQKISWAD
KATG_CHLCH        AWHSAGTYRTSDGRGGAGTGSQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGRQISWAD
KATG_SYMTH        AWHSAGTYRIQDGRGGAESGAQRFAPLNSWP-DNINLDKARR-LLWPIKQKYGRRISWAD
KATG_FLAPJ        AWHSAGTYRVADGRGGAGFGMQRFAPLNSWP-DNVNLDKARL-LLWPIKQKYGKKISWAD
KATG_GRAFK        AWHSAGTYRIGDGRGGAGSGQQRFAPLNSWP-DNANLDKARL-LLWPVKKKYGKNLSWAD
KATG_ACAM1        AWHSAGTYRIGDGRGGAGTGNQRFAPINSWP-DNANLDKARM-LLWPIKQKYGAKISWAD
KATG_POLSJ        AWHSAGTYRVSDGRGGAGSGNQRFAPLNSWP-DNVNLDKARR-LLWPVKQKYGRKLSWAD
KATG_BRASO        AWHAAGTYRIGDGRGGAGTGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGQKISWAD
KATG_RHILO        AWHSAGTYRIADGRGGAGAGQQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG_BEII9        AWHSAGTYRIGDGRGGAGGGQQRFAPLNSWP-DNVSLDKARR-LLWPIKQKYGRKISWAD
KATG_CAUVC        AWHAAGTYRITDGRGGAGGGQQRFAPLNSWP-DNTNLDKARR-LLWPIKQKYGAKLSWAD
KATG_PSEU5        AWHSAGTYRITDGRGGAGGGQQRFAPLNSWP-DNASLDKARR-LLWPIKQKYGRKLSWAD
KATG_RHOP5        AWHSAGTYRISDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG_RHOPT        AWHSAGTYRITDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGSKISWAD
KATG_RHOPS        AWHSAGTYRTTDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG_RHOPB        AWHSAGTYRTTDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGQKISWAD
KATG_SOLUE        AWHSAGTYRITDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPVKQKYGDKISWAD
KATG_CHESB        AWHSAGTYRITDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-MLWPIKQKYGRKISWAD
KATG_NITHX        AWHSAGTYRITDGRGGAGAGQQRFAPLNSWP-DNVLLDRGRR-LLWPIKQKYGRKISWAD
KATG_NITWN        AWHSAGTYRITDGRGGAGGGQQRFAPLNSWP-DNVLLDRARR-LLWPIKQKYGRKISWAD
KATG_RHIL3        AWHSAGTYRITDGRGGAGAGQQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGNRISWAD
KATG_SINMW        AWHSAGTYRITDGRGGAGQGQQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNRISWAD
KATG_ACICJ        AWHAAGTYRIGDGRGGAGAGQQRFAPLNSWP-DNANLDKARR-LLWPVKQKYGRKISWAD
KATG2_SHEFN       TWHSAGTYRTLDGRGGAGGGQQRFEPLNSWP-DNASLDKARR-LLWPIKMKYGEAISWSD
KATG_SHELP        TWHSAGTYRTLDGRGGAGGGQQRFEPLNSWP-DNASLDKARR-LLWPVKQKYGEALSWSD
KATG_ALTMD        SWHSAGTYRTLDGRGGGDGGQMRFDPLNSWP-DNGNLDKARR-LLWPIKQKYGESLSWGD
KATG_COLP3        AWHSAGVYRVHDGRGGASGGQQRFAPLNSWP-DNVNLDKARR-LLWPVKQKYGRKISWAD
KATG_SHEWM        AWHAAGTYRTHDGRGGAGGGQQRFDPLNSWP-DNVNLDKARR-LLWPIKQKYGQSISWAD
KATG2_SHEAM       AWHSAGVYRIFDGRGGASGGQQRFEPLNSWP-DNVNLDKARR-LLWPIKQKYGSKISWAD
KATG2_SHEON       AWHSAGVYRIFDGRGGAAGGQQRFEPLNSWPADNVSLDKARR-LLWPIKQKYGSKLSWGD
KATG2_CELJU       AWHSAGTYRIYDGRGGAGGGQQRFEPLNSWP-DNVNLDRARR-LLWPIKQKYGSSISWAD
KATG2_IDILO       AWHGAGTYRVQDGRGGAAGAQQRFEPLNSWP-DNVSLDKARR-LLWPVKQKYGRDISWAD
KATG_PSEA6        AWHSTGTYRMSDGRGGGAGGQQRFEPLNSWP-DNVSLDKARR-LLWPIKQKYGRSLSWAD
KATG_LEPBP        AWHSAGTYRISDGRGGAGGGQQRFEPLNSWP-DNANLDKARR-LLWPIKKKYGKKISWAD
KATG_NOVAD        AWHSAGTYRTADGRGGAGGGQQRFEPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG2_BURVG       AWHGAGTYRTYDGRGGAGGAQQRFEPLNSWP-DNANLDKARR-LLWPIKKKYGQNISWGD
KATG_GRABC        AWHGAGTYRTYDGRGGASGAQQRFEPLNSWP-DNANLDKARR-LLWPIKKKYGEKLSWGD
KATG_ECOLX        AWHGAGTYRTYDGRGGASGGQQRFEPLNSWP-DNVNLDKARR-LLWPVKKKYGSSISWGD
KATG_YERPE        AWHGAGTYRIYDGRGGADGGQQRFEPLNSWP-DNANLDKARR-LLWPIKKKYGAKISWGD
KATG_FRATT        SWHDAGTYRIYDGRGGANRGQQRFSPLNSWP-DNVNLDKARQ-LLWPIKQKYGDAVSWSD
KATG_SACD2        SWHAAGTYRMIDGRGGADGGMQRFAPLNSWP-DNASLDKARR-LLQPIKQKYGNNLSWSD
KATG2_LEGPA       SWHAAGTYRIYDGRGGANGGFQRFAPQNSWP-DNANLDKARR-LLWPIKQKYGRKISWAD
KATG2_HALMA       AWHSAGTYRTADGRGGAAGGRQRFAPINSWP-DNANLDKARR-LLLPIKQKYGQKISWAD
KATG1_HALMA       AWHSAGTYRTTDGRGGASGGRQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGRKLSWAD
KATG_HALSA        AWHSAGTYRTFDGRGGAAGGRQRLPPVDSWP-DNVNLDKARR-LLWPIKQKYGRKLSWGD
KATG_NATPD        AWHSAGTYRTTDGRGGASGGYQRLPPVDSWP-DNANLDKARR-VLWPVKQKYGQNLSWAD
KATG_SALRD        SWHAAGTYRTTDGRGGSSGGRQRLAPLNSWP-DNANLDKARR-LLWPVKQKYGRKISWAD
KATG_METRJ        AWHSAGTYRIADGRGGAGTGLQRFAPISSWW-DNGNTDKSRR-LLQPIKHKYGNALSWAD
KATG_PSELT        SWHSAGSYRIHDGRGGAKNGSIRFPARINWP-DNINLDKAIR-LLWPIKKKYGKKLSWAD
KATG_ARCFU        AWHSAGSYRIFDGRGGARDGSIRFPPRINWP-DNINLDKAIR-LLWPIKKKYGRKLSWAD
B5Y4Y9_PHATC      AWHAAGTYRISDGRGGANTANQRFAPLNSWP-DNANLDKARR-LMWPVKQKYGRKLSWGD
B8CF21_THAPS      AWHSAGTYRVFDGRGGGNSGNIRLAPLNSWP-DNANLDKARRYILWPIKQKYGQQISWSD
KATG3_MYCS2       AWHFAGTYRIGDGRGGAGAGMLRFAPLNSFP-DNRNLDKARR-LLWPVKKKYGRKISWSD
KATG_MYCGI        SWHAAGTYRIFDGRGGAGQGSQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG1_MYCVP       SWHAAGTYRIFDGRGGAGQGSQRFAPLNSWP-DNANLDKARR-LLWPIKRKYGNKISWAD
KATG_MYCSS        SWHAAGTYRIFDGRGGAGQGSQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG1_MYCFO       SWHAAGTYRIFDGRGGAGQGAQRFAPINSWP-DNVSLDKARR-LLWPIKQKYGNKISWAD
KATG_MYCIT        SWHAAGTYRIHDGRGGAGQGMQRFAPLNSWP-DNASLDKARR-LLWPIKKKYGNKISWAD
KATG_MYCUA        SWHAAGTYRIQDGRGGGGQGMQRFAPLNSWP-DNVSLDKARR-LLWPVKQKYGSEISWAD
KATG2_MYCS2       SWHSAGTYRIHDGRGGGGQGAQRFAPINSWP-DNVSLDKARR-LLWPIKQKYGNKISWAD
KATG_RHOJR        SWHAAGTYRIADGRGGGGQGAQRFAPLNSWP-DNANLDKARR-LLWPVKQKYGKQISWAD
KATG_NOCSJ        AWHAAGTYRIHDGRGGAGQGAQRFAPLNSWP-DNANLDKARR-LLWPVKQKHGQKISWAD
KATG_SALTO        SWHAAGTYRIHDGRGGAGDGGQRFAPLNSWP-DNVNLDKARR-LLWPVKQKYGQKISWAD
KATG1_CUPPJ       SWHAAGTYRIADGRGGGGEGQQRFAPLNSWP-DNANLDKARR-LLWPLKKKYGQKVSWAD
KATG_FRACC        AWHSAGTYRISDGRGGAGAGQLRFAPLNSWP-DNANLDKARR-LLWPVKKKYGQKISWAD
KATG_FRASN        AWHSAGTYRISDGRGGGGAGQQRFAPLNSWP-DNGNLDKARR-LLWPVKKKYGQALSWAD
KATG_STRCO        AWHSAGTYRISDGRGGAGAGQQRFAPLNSWP-DNGNLDKARR-LLWPVKKKYGQNLSWAD
KATG_STRRE        AWHSAGTYRISDGRGGAGAGQQRFAPLNSWP-DNGNLDKARR-LLWPVKKKYGQSISWAD
KATG_STRGG        AWHSAGTYRISDGRGGAGAGQQRFAPLNSWP-DNGNLDKARR-LLWPVKKKYGQALSWAD
KATG_SACEN        AWHSAGTYRVSDGRGGAGTGQQRFAPLNSWP-DNVSLDKARR-LLWPVKQKYGRKLSWAD
KATG2_MYCFO       SWHAAGTYRVEDGRGGGGRGMQPFAPLNSWP-DNVSLDKARR-LLWPLKKKYGKQISWSD
KATG2_MYCVP       SWHAAGTYRVQDGRGGAGKGMQRFAPLNSWP-DNVSLDKARR-LLWPLKKKYGKKLSWSD
KATG1_MYCS2       AWHAAGTYRVSDGRGGAGAGMQRFAPLNSWP-DNASLDKARR-LLWPVKKKYGKNLSWAD
KATG_MYCA9        AWHAAGTYRVGDGRGGAGAGMQRFAPLNSWP-DNVLLDRARR-LLWPVKKKYGNKLSWAD
KATG_MYCTU        AWHAAGTYRIHDGRGGAGGGMQRFAPLNSWP-DNASLDKARR-LLWPVKKKYGKKLSWAD
KATG_NOCFA        AWHSAGTYRSSDGRGGANTGQQRFAPLNSWP-DNGNLDKARR-LLWPVKKKYGQNISWAD
KATG_GLOVI        AWHAAGTYRIGDGRGGAGAGTQRFAPLNSWP-DNANLDKARL-LLWPIKEKYGRKLSWGD
KATG_KORVE        AWHSAGTYRIGDGRGGAGSGEQRFAPLNSWP-DNGNLDKARR-LLWPIKQKYGRKLSWAD
KATG_CAUSK        AWHSAGTYRTGDGRGGAGGGQQRFAPLNSWP-DNGNLDKARR-LIWPIKQKYGARISWAD
KATG_MARMS        AWHSAGTYRTADGRGGATSGTQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG1_ALKMQ       AWHSAGTYRMGDGRGGAGTGNQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGKKISWAD
KATG_DESHY        AWHSAGTYRLNDGRGGAGDGTQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGKKISWAD
KATG_PELCD        AWHSAGTYRMGDGRGGAGSGSQRLAPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG_PELPD        AWHSAGTYRTGDGRGGGGSGSQRFAPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG_GEOLS        AWHSAGTYRMGDGRGGAGSGSQRLAPLNSWP-DNVNLDKARR-LLWPVKQKYGRKISWAD
KATG_GEOSL        AWHSAGTYRMGDGRGGAGSGSQRLAPLNSWP-DNVNLDKARR-LLWPIKQKYGRKISWAD
KATG_DESOH        AWHSAGTYRMGDGRGGAGSGSQRLAPLNSWP-DNANLDKARR-LLWPIKKKYGKRISWAD
KATG_CLOBB        AWHSAGTYRVGDGRGGGSLGLQRFAPLNSWP-DNINLDKARR-LLWPIKKKYGNKISWAD
KATG_PROA2        AWHSAGTYRTSDGRGGGGTGNQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGKKISWAD
KATG_AZOSB        AWHSAGTYRTADGRGGGGTGNQRFAPLNSWP-DNGNLDKARR-LLWPIKQKYGNKISWAD
KATG_DECAR        AWHSAGTYRTGDGRGGAGTGNQRFAPINSWP-DNGNLDKARR-LLWPIKQKYGNKISWAD
KATG_SYNSC        AWHSAGTYRGADGRGGAGHGNQRFAPLNSWP-DNTNLDKARR-LLWPLKRKYGNAISWAD
KATG_SYNPW        AWHSAGTYRTGDGRGGAGHGNQRFAPLNSWP-DNTNLDKARR-LLWPIKRKYGNAISWAD
KATG_SYNR3        AWHSAGTYRLADGRGGAGHGNQRFAPLNSWP-DNTNLDKARR-LLWPIKAKYGSNLSWAD
KATG_PSYIN        SWHAAGTYRIADGRGGAGTGNQRFAPINSWP-DNVNLDKARR-LLWPIKKKYGNKLSWAD
KATG_SYNP2        TWHAAGTYRIADGRGGAGTGNQRFAPINSWP-DNTNLDKARR-LLWPLKKKYGNKLSWAD
KATG_SYNP6        TWHAAGTYRIADGRGGAGTGNQRFAPLNSWP-DNTNLDKARR-LLWPIKQKYGNKLSWAD
KATG1_VIBPA       SWHAAGTYRIADGRGGAGTGNLRFAPLNSWP-DNANLDKARR-ILWPIKKKYGNQLSWAD
KATG_SHEDO        TWHAAGTYRIADGRGGAGHGSQRFAPLNSWP-DNGNLDKARR-LLWPIKKKYGNKLSWAD
KATG_SHEHH        SWHAAGTYRTADGRGGAGRGNQRFAPLNSWP-DNVNLDKARR-LLWPLKKKYGNKLSWAD
KATG_AERS4        AWHSAGTYRIADGRGGGSTGNQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGNKISWAD
KATG_ALKEH        AWHAAGSYRVADGRGGGGTGNQRFAPINSWP-DNANLDKARR-LLWPIKKKYGNKLSWAD
KATG_HALHL        AWHAAGTYRVADGRGGGGTGNQRFAPINSWP-DNVNLDKARR-LLWPIKKKYGNRLSWAD
KATG_PECAS        AWHSAGSYRTTDGRGGGGTGNQRFAPLNSWP-DNVSLDKARR-LLWPIKRKYGNKLSWAD
KATG_RHOS5        AWHAAGSYRTADGRGGGGTGNQRFAPLNSWP-DNVNLDKARR-LLWPVKKKYGNAISWAD
KATG1_LEGPL       SWHAAGSYRVADGRGGAGTGNQRFAPLNSWP-DNVNLDKARR-LLWPIKKKYGNKISWAD
KATG_EDWTA        AWHSAGSYRIADGRGGAGTGNQRFAPLNSWP-DNVNLDKARR-LLWPIKKKYGNKISWAD
KATG_LEPCP        AWHAAGSYRVADGRGGAGTGNQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGAKISWAD
KATG_VIBCH        AWHSAGTYRIADGRGGGGTGNQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG_VIBVY        AWHSAGSYRVGDGRGGADTGNQRFAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG_POLAQ        AWHSAGSYRIADGRGGAGTGNQRFAPINSWP-DNANLDKARR-LLWPIKKKYGNKISWAD
KATG2_VIBPA       AWHAAGSYRIADGRGGAATGNQRFAPLNSWP-DNANLDKARR-LLWPIKRKYGNKLSWAD
KATG1_SHEAM       AWHSAGTYRIADGRGGGGHGAQRFAPLNSWP-DNGNLDKARR-LLWPIKQKYGNKVSWAD
KATG_AGRFC        TWHAAGSYRVTDGRGGANTGNQRFAPLNSWP-DNVNTDKGRR-LLWPIKKKYGNKISWAD
KATG_PARDP        AWHMAGSYRTSDGRGGANTGNQRFAPLNSWP-DNVNTDKGRR-LLWPIKKKYGNKISWAD
KATG_CHRSD        AWHSAGSYRLADGRGGGGTGNQRFAPLNSWP-DNVNTDKGRR-LLWPIKKKYGNKISWAD
KATG_MARHV        SWHAAGTYRIQDGRGGGGTGNQRFAPLNSWP-DNVSLDKARR-LLWPIKKKYGNKLSWAD
KATG_HYPNA        AWHSAGSYRLADGRGGGNTGNIRFAPLNSWP-DNGNLDKARR-LLWPIKKKYGNKISWAD
KATG_MARMM        AWHSAGSYRLADGRGGGGSGNIRFAPLNSWP-DNGNLDKARR-LLWPLKKKYGNKISWAD
KATG_PARL1        AWHSAGSYRLFDGRGGGGTGNQRFAPLNSWP-DNGNLDKARR-LLWPIKKKYGNKLSWAD
KATG_DINSH        SWHAAGSYRLGDGRGGAGTGNLRFEPLNSWP-DNASLEKARR-LLWPVKKKYGNALSWAD
KATG_ROSDO        AWHSAGTYRMQDGRGGAGSGNIRFAPLNSWP-DNASLDKARR-LLWPVKKKYGNALSWAD
F2I1Y2_PELSM      TWHQVGTYREFDGR--PNVGSHRFSPQDSWP-DNTNLDKARR-LLWPIKKKYGNKLSWSD
KATG1_SHEON       AWHSAGTYRIADGRGGAGTGNQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGNKLSWAD
KATG_SHESW        AWHSAGTYRIADGRGGAGTGNQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGNKLSWAD
KATG1_SHEFN       AWHSAGTYRMADGRGGAGTGNQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGNKLSWAD
KATG1_CELJU       AWHSAGSYRIADGRGGAGTGNQRFAPLNSWP-DNGNLDKARR-LLWPIKKKYGNKLSWAD
KATG_SYNY3        AWHAAGTYRIADGRGGAATGNQRFAPLNSWP-DNVNLDKARR-LLWPIKKKYGNKLSWGD
KATG1_IDILO       AWHSAGSYRLADGRGGGGTGNQRFAPLNSWP-DNVSLDKARR-LLWPIKKKYGNKLSWAD
KATG_VIBCB        AWHSAGTYRIADGRGGASRGNQRFAPLNSWP-DNGNLDKARR-LLWPIKRKYGNKLSWAD
KATG_BACHD        SWHAAGTYRIGDGRGGGGTGNQRFAPLNSWP-DNGNLDKARR-LLWPIKQKYGNKISWAD
KATG_GEOKA        AWHSAGTYRIGDGRGGGSTGTQRFAPLNSWP-DNANLDKARR-LLWPIKKKYGNKISWAD
KATG_ERYLH        AWHAAGTYRTGDGRGGSSSGQQRFAPLNSWP-DNGNLDKARR-LLWPIKQKYGKHISWAD
KATG_SPHAL        AWHAAGTYRTADGRGGANSGQQRFAPLDSWP-DNGNLDKARR-LLWPIKQKYGNKISWAD
KATG_PHEZH        AWHSAGTYRTGDGRGGANSGNQRFAPLNSWP-DNANLDKARR-LLWPVKKKYGAKLSWAD
KATG_ARCB4        AWHSAGTYRTGDGRGGASTGSQRLAPLNSWP-DNANLDKARR-LLWPIKQKYGNKISWAD
KATG_RUEPO        TWHAAGTYRTADGRGGGSTGNQRFAPLNSWP-DNGNLDKARR-LLWPIKKKYGDKISWAD
KATG_RUEST        AWHSAGTYRTADGRGGASTGTQRFAPLNSWP-DNGNLDKARM-LLWPIKKKYGNALSWAD
KATG_JANSC        AWHSAGTYRTYDGRGGAGTGTQRFAPLNSWP-DNGNLDKARR-ILWPIKEKYGKSLSWAD
                  :**                .   : .   :  **   ::.   :: *:* *:*  :**.*

KATG_ECOLI        LFILAGNVALENSGFRTFGFGAGREDVWEPDLDVNWGDE----------KAWLTHR----
KATG_SALTY        LFILAGNVALENSGFRTFGFGAGREDVWEPDLDVNWGDE----------KAWLTHR----
KATG_ENT38        LYILAGNVALENSGFRTFGFGAGREDVWEPDMDVNWGDE----------KAWLTHR----
KATG_CROS8        LFILAGNVALENSGFRTFGFGAGREDVWEPDMDVNWGDE----------KNWLEHR----
KATG_ERWT9        LYILAGNVALENSGFRTFGFAAGREDVWEPDLDINWGEE----------KEWLTHR----
KATG_KLEP7        LYMLAGNVALENAGFRTFGFGAGREDVWEPDLDVDWGDE----------KEWLAHR----
KATG_ACIBC        LFILAGNIALESSGFRTFGFGAGREDVWEPDNDVNWGDE----------KEWLAHR----
KATG_PSEMY        LYILAGNVALESMGFRTFGFGAGREDVWEPDQDVNWGAE----------VAWLGVDP---
KATG_METPP        LLILTGNVALESMGFRTFGFAGGREDVWEPDNDVNWGNE----------TTWLATD----
KATG_JANMA        LLVLTGNVALESMGFRTFGFAGGRADVWEPDTDVNWGAE----------TTWLGTD----
KATG_AZOC5        LMILTGNVALETMGFRTFGFAGGREDTWEPDQDVFWGSE----------TAWL-------
KATG_RALPJ        LLILTGNVALETMGFRTFGFAAGREDTWEPDNDVYWGNE----------TKWL-------
KATG_ACIAC        LLVLTGNVALETMGFRTFGFAGGREDTWEPDQDVYWGSE----------KTWLGGDARYG
KATG_PARPJ        LLILTGNVALETMGFKTFGFAGGRPDTWEPDQDVYWGNE----------KTWLGGDVRYG
KATG_PARXL        LLILTGNVALETMGFKTFGFAGGREDTWEPDLDVYWGNE----------KTWLGGDVRYG
KATG_CUPNH        LMILAGNVALETMGFKTFGFGGGREDTWEPDADVSWGKE----------KTWLGGDLRYG
KATG2_BURCJ       LLILTGDVALTTMGFKTFGYAGGREDTWEPDRDVYWGSE----------TTWLGGDLRYD
KATG_BORA1        LFILTGNVALETMGFKTFGFGGGREDTWEPDQDVYWGDE----------KTWLGGDLRYG
KATG_HERSE        LLILTGNVALETMGFKTFGFAGGRADVWEPDLDVYWGTE----------STWLGGDDRYG
KATG_XANCP        LMILTGNVALESMGFKTFGFAGGREDTWEPDQDLYWGRE----------TKWLGGDDRYA
KATG_XANC5        LMILTGNVALESMGLKTFGFAGGREDTWEPDQDLYWGRE----------TKWLGGDDRYS
KATG_XYLFA        LIVLSGNVALESMGFKTFGFAGGRVDTWEPDQDVYWGRE----------TTWLGGDVRYG
KATG1_MAGO7       LMLLTGNVALEDMGFKTFGFAGGRPDTWEADESTYWGGE----------TTWL--GNEVR
KATG_NEUCR        LLLLTGNVALESMGFKTFGFAGGRPDTWEADESVYWGAE----------TTWL--GNEDR
C7ZHZ3_NECH7      LIVLAGNVALEDMGFKTIGFAGGREDTWEAAEDVYW--R----------TTWL--GNDVR
KATG2_MAGO7       LMLLTGNVALENMGFKTLGFGGGRADTWQSDEAVYWGAE----------TTFVPQGNDVR
C7ZIK0_NECH7      LILLAGNVALESMDFEPIGFGAGRADTWQSDESVYWGAE----------TTFVPKGNDVR
KATG_FLAJ1        LMILTGNVALESMGFKTFGFAGGRADVWEPDESVYWGSE----------TTWL--GGDER
KATG_METI4        LIILAGNVALESMGLKTFGFGGGRVDSWEPDESVYWGVE----------QKWLEDK----
KATG_PSEE4        LIVLTGNVALESMGFKTFGFSGGRADVWEPDEDVYWGSE----------KVWLGGDTRYG
KATG_PSEPF        LIVLTGNVALESMGFKTFGFSGGRADVWEPDEDVYWGSE----------NKWLGGDNRYG
KATG_PSESM        LIVLTGNVALESMGFKTFGFSGGRPDVWEPEEDVYWGSE----------TTWLGGEERYG
KATG2_BURCC       LIVLTGNVALESMGFKTFGFAGGREDSWEPDEDVYWGME----------STWLD------
KATG2_CUPPJ       LIVLTGNVALESMGFKTFGFGGGREDVWEPDQDVYWGSE----------TTWLA------
KATG_CUPMC        LIVLTGNVALESMGFKTFGFGGGREDVYEPDESVYWGNE----------AEWLA------
KATG_PSEF5        LIILTGNVALESMGFKTFGFAGGRQDVWEPEDNVYWGSE----------TTWLD------
KATG_BURL3        LLILTGNVALESMGFKTFGYAGGRVDTWEPD-DVYWGSE----------KIWLEL-----
KATG1_BURVG       LFILTGNVALESMGFKTFGYGGGRADTWEPD-DVYWGSE----------KIWLEL-----
KATG_BURM1        LLILTGNVALESMGFKTFGYAGGRPDTWEPD-DVYWGSE----------KIWLEL-----
KATG_BURPS        LLILTGNVALESMGFKTFGFAGGRADTWEPE-DVYWGSE----------KIWLEL-----
KATG_SERP5        LIVLTGNVALESMGFKTFGYAGGRADTWEPD-DVYWGSE----------KIWLEL-----
KATG_RALSO        LMILTGNVALESMGFKTFGFAGGRKDVWEPEEDVYWGSE----------TTWLG------
KATG_HAHCH        LMILAGNVALESMGFKTFGFGGGRADIWEPEQDIYWGAE----------KTWLDDN----
KATG_SHEB8        LIILTGNVALESMGFKTLGFAGGRVDIWEPEADIYWGAE----------DKWLDDK----
KATG_METB6        LMILAGNVALESMGFETFGFAGGRVDTWEPDEDVYWGSE----------NTWLGDK----
KATG_METAC        LMILTGNVAMETMGFKTFGFGGGREDVWEPDQDVYWGSE----------DTWLGDE----
KATG_METHJ        LMILAGNVALESMGFKTFGFGGGREDVWEPQEDTYWGSE----------DTWLGDK----
KATG_CHLCH        LMILTGNCALESMGLKTFGFAGGREDIWEPEEDIYWGTE----------GEWLADK----
KATG_SYMTH        LMILAGNVALESMGLKTIGFAGGRADVWEPEEDIYWGSE----------QQWLGRD----
KATG_FLAPJ        LMILAGNCALESMGFKTFGFAGGREDVWEPAEDIYWGSE----------GKWLD------
KATG_GRAFK        LLVLAGNCAHESMGLKMFGFAGGREDVWEPAQDVYWGAE----------TEWLNN-----
KATG_ACAM1        LMILAGNCALESMGFKTFGFAGGREDIWEPEEDIYWGAE----------TEWLG------
KATG_POLSJ        LMILAGNVALESMGFKTFGFAGGREDIWEPEEDVYWGSE----------NTWLD------
KATG_BRASO        LFVLTGNVALESMGFKTFGFGGGRADTWEPEQDIYWGPE----------GKWLADE----
KATG_RHILO        LLILTGNVALESMGFKTFGFAGGRADVWEPEQDVYWGPE----------GKWLADE----
KATG_BEII9        LMILTGNVALESMGFKTFGFAGGRIDTWEPDQSAYWGAE----------TTWLALSNDPN
KATG_CAUVC        LYVLVGNVALESMGFKTFGFAGGRADQWEPEE-LYWGPE----------STWLDDK----
KATG_PSEU5        LFVLTGNVALESMGFKTFGFGGGRADTWEPEE-LFWGPE----------GTWLGDE----
KATG_RHOP5        LFVLSGNVALESMGFKTFGFAGGRADTWEPEE-LYWGPE----------GTWLGDS----
KATG_RHOPT        LMVLTGNVALESMGFKTFGFAGGRADVWEPEE-LYWGPE----------GTWLGDE----
KATG_RHOPS        LYVLTGNVALESMGFKTFGFAGGRADTWEPEE-LFWGPE----------GSWLGDE----
KATG_RHOPB        LYVLAGNVALESMGFQTFGFAGGRADTWEPEE-LFWGPE----------GTWLGDE----
KATG_SOLUE        LMVLAGNVALESMGFKTFGFAGGRSDVWEPEE-LYWGPE----------GTWLGDE----
KATG_CHESB        LMILAGNVALESMGFKTFGFAGGRKDVWEPEE-LFWGPE----------GTWLGDE----
KATG_NITHX        LLVLSGNVALESMGFKTFGFAGGRADVWEPEE-LYWGPE----------GTWLGDE----
KATG_NITWN        LYVLAGNAALESMGFKPLGFAGGRVDEWEPQE-LFWGPE----------GAWLGDE----
KATG_RHIL3        LLILTGNVALESMGFKTFGFAGGRADVWEPEE-LYWGPE----------GTWLGDE----
KATG_SINMW        LLILTGNVALESMGFKTFGFAGGRTDVWEPEE-LFWGPE----------GTWLGDE----
KATG_ACICJ        LMVLAGNVALESMGFKTFGFGAGRVDTWEPDQGIYWGPE----------TTWLDDK----
KATG2_SHEFN       LIVLAGNVSLENMGFKTYGFAGGRHDDWEPDM-VYWGPE----------IEMLA------
KATG_SHELP        LIVLAGNVALENMGFKTFGFAGGRNDDWEPDM-VYWGPE----------VEMLA------
KATG_ALTMD        LMILAGTVGMENMGFDTYGFAGGRTDDWEPDM-VYWGPE----------VEMLA------
KATG_COLP3        LMVLSGNVALESMGFKTFGFAGGRTDDWEPDL-VYWGPE----------TAMLS------
KATG_SHEWM        LIALTGNVALESMGFKTYGYAGGREDDWEPDL-VYWGPE----------SKFLT------
KATG2_SHEAM       LMVLAGNVSLESMGFKTFGFAGGRTDDWEAER-VDWGHE----------KKWLD------
KATG2_SHEON       LMVLTGNVALESMGFKTFGFGGGRVDDWEAEM-VNWGSE----------KAWLD------
KATG2_CELJU       LMVLTGNVALESMGFKTFGFAGGRQDDWEADT-VYWGPE----------KKWLD------
KATG2_IDILO       LMVLTGNVALESMGFETFGFAGGREDAWEPDI-VYWGPE----------KEWLKG-----
KATG_PSEA6        LMVLTGNVAMESMGFTIYGFAGGREDDFEPDL-VYWGPE----------KKWLGG-----
KATG_LEPBP        LMVLTGNVALESMGFKTYGFAGGRTDDWEADL-VYWGPE----------KKFLE------
KATG_NOVAD        LMVLTGNVALESMGFKTFGFAGGRADDWEADQ-VFWGPE----------NKWLA------
KATG2_BURVG       LMVLTGNVALESMGFQTFGFGGGREDDWQSDL-VYWGAG----------PKFMS------
KATG_GRABC        LMVLTGNVALETMGFKTYGFAGGRTDDWEPDL-IYWGSG----------AKFMS------
KATG_ECOLX        LMVLTGNVALESMGFKTLGFAGGREDDWESDL-VYWGPD----------NKPLA------
KATG_YERPE        LMVLTGNVALESMGFKTLGFAGGREDDWQSDL-VYWGAG----------NKMLS------
KATG_FRATT        LIVLAGTVSLESMGMKPIGFAFGREDDWQGDD-TNWGLS----------PEEIM------
KATG_SACD2        LLVLAGTIGMEDMGFPIVGFAFGRDDEWEPEE-VNWGPE----------GQWLT------
KATG2_LEGPA       LLVLAGNVAMESMGFKTIGFAGGREDAWEAIN-INWGPE----------GKWLE------
KATG2_HALMA       LMILAGNVAIESMGFKTFGYAGGREDAFEEDKAVNWGPE----------DEFETQ-----
KATG1_HALMA       LIVLAGNHAIESMGLKTFGWAGGREDAFEPDEAVDWGPE----------DEMEAHQ----
KATG_HALSA        LIILAGNVALESMGFETYGFAGGRKDDYTPDEAVDWGPE----------DEWETTS----
KATG_NATPD        LIVLAGNVALESMGFETFGFAGGREDDFAPDESVDWGPE----------EEMEAS-----
KATG_SALRD        LLVLAGNVAMESMGFETFGFAGGREDDFKPDESIDWGPE----------DEMETW-----
KATG_METRJ        LMVLTGNCALEIMGLPTYGFAAGRLDAWEADNATYWGPEVVEMGSVSSFDDMVNRD----
KATG_PSELT        LIILAGTVALQDMGVKILGFSLGREDVFEADESPDWGAE----------QEMLSG-----
KATG_ARCFU        LIILAGTVAMEDMGVKLFGFALGREDIFEPDESPDWGPE----------EEMLTA-----
B5Y4Y9_PHATC      LMMLTGNQALEIMGLKTIGFAFGREDIYSPEDDVYWGPE----------KEMLSND----
B8CF21_THAPS      LIVLAGNWE----DTTPLWFGGGRIDAFAPEEDVFWGNE----------SEWLKDE----
KATG3_MYCS2       LMIFAGNRALESMGCRTFGFAGGREDAWEADE-TYWGPE----------STWLAD-----
KATG_MYCGI        LIAYAGNAALEQSGFKTAGFAFGREDIWEPEE-MLWGQE----------DTWLGT-----
KATG1_MYCVP       LIAYAGNAALESAGFQTFGFAFGREDIWEPEE-MLWGQE----------DTWLGT-----
KATG_MYCSS        LIAYAGNAALEQSGFKTAGFAFGREDIWEPEE-MLWGQE----------DTWLGT-----
KATG1_MYCFO       LIIFAGNVALESAGFKTFGFAFGRQDIWEPEE-ILWGQE----------DTWLGT-----
KATG_MYCIT        LITYAGNVALESMGFKTFGFGFGREDVWEPEE-ILWGEE----------EEWLGT-----
KATG_MYCUA        LIIFAGNCALDSMGFKTFGFGFGREDVWQPEE-VMWGEE----------DVWLGT-----
KATG2_MYCS2       LLVFTGNVALESMGFKTFGFGFGREDIWEPEE-ILFGEE----------DEWLGT-----
KATG_RHOJR        LLVFAGNCALESMGFKTFGFGFGREDIWEPEE-MYWGPE----------DTWLG------
KATG_NOCSJ        LIVFAGNVALEDMGFTTFGFGFGREDIWEPEE-IYWGPE----------DTWLG------
KATG_SALTO        LLVLAGNVALESMGFKTFGFGFGREDVWEPEE-IFWGPE----------DTWLG------
KATG1_CUPPJ       LLIFAGNVAYESMGFKTFGFGFGRPDVWEPED-IFWGPE----------DTWLG------
KATG_FRACC        LMILAGNVALESMGFETFGFAGGRVDVWEPDEDVYWGPE----------TTWLD------
KATG_FRASN        LMILAGNVALESMGFTTFGFAGGREDVWEPDEDVYWGPE----------TTWLG------
KATG_STRCO        LLVLTGNVALETMGFETFGFAGGRADVWEAEEDVYWGPE----------TTWLD------
KATG_STRRE        LLILTGNVALETMGFKTFGFGGGRADVWEAEEDVYWGPE----------TTWLD------
KATG_STRGG        LLILTGNVALETMGFKTFGFAGGREDVWESEEDVYWGPE----------TTWLD------
KATG_SACEN        LMILAGNVALESMGFETFGFAGGRVDAWEPEDDVYWGAE----------TTWLGS-----
KATG2_MYCFO       LIVYSGNRAMEHMGFKTAGFAFGRPDYWEPEEDIYWGAE----------AEWLGS-----
KATG2_MYCVP       LIVYAGNRAMENMGFKTAGFAFGRPDYWEPEEDVYWGAE----------HEWLGS-----
KATG1_MYCS2       LIVYAGNVALEDMGFRTAGFAFGREDRWEPEEDVYWGPE----------QEWLDD-----
KATG_MYCA9        LIVFAGNHAMDTMGFKTFGFAFGREDRWEPEQDVYWGPE----------HTWLGD-----
KATG_MYCTU        LIVFAGNCALESMGFKTFGFGFGRVDQWEPDE-VYWGKE----------ATWLGD-----
KATG_NOCFA        LMILAGNVALETMGFKTFGFAGGRVDVWEPEEDVYWGPE----------AEWLGD-----
KATG_GLOVI        LLILAGNCALESMGFKTAGFAGGRVDIWEPENDIFWGPE----------REWLGD-----
KATG_KORVE        LMVLAGNVALESMGFKTFGFAGGREDVWEPSEDIYWGPE----------GKWLDD-----
KATG_CAUSK        LMILAADVGMETMGFKTFGFGFGREDTWEPEEDVHWGAE----------DTWLGDA----
KATG_MARMS        LMILAGNCALESMGFKTFGFAGGRVDVWQPEEDIYWGTE----------KTWLDDE----
KATG1_ALKMQ       LMILAGNCALESMGFKTFGFAGGREDIWEPEEDIYWGQE----------NEWLGDK----
KATG_DESHY        LMVLAGNCALESMGFKTFGFAGGREDVWEPQEDIYWGSE----------GEWLGDQ----
KATG_PELCD        LMVLAGNCALESMGFKTFGFAGGREDAWEPEQDIYWGAE----------EEWLATSDK--
KATG_PELPD        LMILAGNCALESMGFKTFGFGGGREDIWEPEEDIYWGSE----------AEWLATSDK--
KATG_GEOLS        LMILAGNCALESMGFKTFGFGGGREDIWEPQEDVYWGGE----------KEWLATSDK--
KATG_GEOSL        LMILAGNCALESMGFRIFGFGGGRVDVWEPEEDIYWGSE----------DTWLGDK----
KATG_DESOH        LMVLAGNCALESMGFKTFGFAGGREDVWEPETDIYWGAE----------EEWLATSDK--
KATG_CLOBB        LLILTGNCALESMGLKTLGFGGGRVDVWEPQEDIYWGSE----------KEWLGDE----
KATG_PROA2        LMILAGNCALESMGFKTFGFGGGRVDIWEPEEDIYWGKE----------VEWLGNK----
KATG_AZOSB        LMILAGNCALESMGFKTFGFGGGRADIWQPEEDIYWGAE----------KEWLATSDK--
KATG_DECAR        LMILAGNCALESMGFKTFGFGGGRVDIWQPEEDIYWGAE----------REWLATSDK--
KATG_SYNSC        LIILSGNVALESMGFRTFGFAGGRTDIWQPEEDVFWGKE----------TEWLSDE----
KATG_SYNPW        LIILSGNVALESMGFRTFGFAGGREDIWQPEEDVFWGKE----------TGWLKDE----
KATG_SYNR3        LIILAGNCALESMGLPTAGFAGGREDIWEPEDDIYWGSE----------TSWLSDE----
KATG_PSYIN        LIAYAGTIAYESMGLKTFGFAFGREDIWHPEKDTYWGSE----------KEWLAPSGS--
KATG_SYNP2        LIAYAGTIAYESMGLKTFGFAFGREDIWHPEKDIYWGSE----------KEWLAPSDN--
KATG_SYNP6        LIAYAGTIAYESMGLKTFGFAFGREDIWHPEKDIYWGPE----------KEWVPPSTN--
KATG1_VIBPA       LIAYAGTMAYESMGLKTFGFGFGREDIWHPEKDIYWGSE----------KEWLAPTNN--
KATG_SHEDO        LIAYAGTIAYESMGLKTFGFAFGREDIWHPEKDIYWGAE----------KDWLLPTDN--
KATG_SHEHH        LIAYAGTIAYESMGLKTFGFAFGREDIWHPEKDIYWGAE----------KEWLAPSGS--
KATG_AERS4        LIILAGTVAYESMGLKTFGFAFGREDIWHPEKDIYWGAE----------KEWLAPSSK--
KATG_ALKEH        LIILAGNVAYESMGFKTFGFSFGREDIWHPEKDTYWGSE----------KEWLAPSDN--
KATG_HALHL        LIILAGNVAYESMGLKTFGFSLGREDIWHPEKDIYWGSE----------KEWLAPSDS--
KATG_PECAS        LIILAGTIAYESMGLKTFGFAFGREDIWQPEKDTYWGAE----------KEWLANS----
KATG_RHOS5        LIILAGTVAYESMGLKTFGFAFGRADIWHPEKDTYWGAE----------KEWLAPS----
KATG1_LEGPL       LIALAGTIAYESMGLKTFGFGFGREDIWHPEKDVYWGSE----------QEWLG------
KATG_EDWTA        LIVLAGTMAYESMGLKTFGFAFGREDIWHPEIDTYWGSE----------KEWLAPSGS--
KATG_LEPCP        LIVLAGNVAYESMGLKTYGFAFGREDIWHPEKDIYWGSE----------KAWLAPTGG--
KATG_VIBCH        LMILAGNMAYESMGLKTFGFAFGREDIWHPEKDIYWGSE----------KEWLAKSGG--
KATG_VIBVY        LMILAGNMAYESMGLKTFGFAFGREDIWHPEKDIYWGAE----------QEWLAPSGA--
KATG_POLAQ        LMILAGTIAYESMGLKTFGFSFGREDIWHPEKDIYWGSE----------KEWLQKSGG--
KATG2_VIBPA       LIILAGNMAYESMGFKTFGFGFGREDIWHPEKDTYWGSE----------QEWLAPSGA--
KATG1_SHEAM       LMILAGNMAYESMGLKTFGFAFGREDIWHPEKDTYWGAE----------KEWLAPSGG--
KATG_AGRFC        LIALAGTIAYDVAGLKTFGFAFGREDIWAPEKDTYWGDE----------KEWLAPS----
KATG_PARDP        LIVLAGTVAYEAAGLKTYGFAFGREDIWHPEKDTYWGEE----------KEWLAPS----
KATG_CHRSD        LMVLSGTIAYEVAGLKTYGFAFGREDIWHPEKDIYWGDE----------KEWLAPS----
KATG_MARHV        LIILAGTVAYESMGLPSYGFSFGREDIWHPEKDIYWGNE----------KEWLAPS----
KATG_HYPNA        LILLSGTIAYESMGLKTYGFSFGREDIWAPEKDVYWGAE----------KEWLAPS----
KATG_MARMM        LILLAGTIAYENMGLKTFGFGFGREDIWGPEIDTYWGAE----------KEWLAPS----
KATG_PARL1        LYILAGNVAYESMGLKTFGFAFGREDIWHPEKDVYWGSE----------KEWLAES----
KATG_DINSH        LLVLAGTVAYSNMGLKTFGFAFGRKDIWGPEIDINWGSD----------SEILAPT----
KATG_ROSDO        LIILSGNMAYESMGLKTFGFGFGREDIWGPETDVYWGSE----------NEWLAPS----
F2I1Y2_PELSM      LMCLAGTMAYEQAGFKTFGFSFGREDIWEPEKDVYWGSE----------TEPLAVN----
KATG1_SHEON       LIILAGNVAYESMGLKTFGFAGGRADIWHPEKDIYWGSE----------KQWLAPS----
KATG_SHESW        LIILAGNVAYESMGLKTYGFAGGRADIWHPEKDIYWGSE----------KQWLAPS----
KATG1_SHEFN       LIILAGTIAYESMGLKTFGFAGGRADIWHPEKDIYWGSE----------KQWLAAS----
KATG1_CELJU       LMILAGNMAYESMGLKTFGFGGGREDIWHPEKDVYWGSE----------KEWLAKS----
KATG_SYNY3        LIILAGTMAYESMGLKVYGFAGGREDIWHPEKDIYWGAE----------KEWLASS----
KATG1_IDILO       LFILAGNMAYESMGLKTFGFAGGREDIWHPEEDTYWGSE----------KEWLAET----
KATG_VIBCB        LMILAGNMAYESMGFKTFGFAGGREDIWHPEKDIYWGAE----------KEWLQPS----
KATG_BACHD        LLVLAGNVAIEDMGGPVIGFGAGREDIWHPEEDIYWGSE----------KEWLTGDK---
KATG_GEOKA        LMILAGNVAIESMGGKTIGFGGGREDVWHPEEDIYWGAE----------KEWLASE----
KATG_ERYLH        LFILTGNVAIESMGGPVFGFGGGRKDVYEPEM-VYWGTE----------EQWVDTGA---
KATG_SPHAL        LFILAGNVAIESMGGPVFGFGGGRVDVYEPERDIYWGSE----------DKWVNQGV---
KATG_PHEZH        LMIMAGNVAFESMGAPVFGFGGGRADIFEPEKDVYWGTE----------EQWVGKGA---
KATG_ARCB4        LMILAGNVALESMGLKTFGFSGGRVDVWEPEEDIYWGKE----------AQWLATSDK--
KATG_RUEPO        LLILTGNVALESMGFKTFGFAGGRPDIWEPEEDIYWGSE----------GEWLAPSDT--
KATG_RUEST        LMILAGNCAIESMGLKPFGFGGGRADVWEPEEDIYWGAE----------DEWLATSDH--
KATG_JANSC        LLILVGNVALEDMGFETFGFAGGRADVWEPEEDIYWGPE----------TEWLATSDM--
                  *    .       .     :. ** * :       :                        

KATG_ECOLI        -----------------------------HPEA-----LAKAPLGATEMGLIYVNPEGP-
KATG_SALTY        -----------------------------HPEA-----LAKAPLGATEMGLIYVNPEGP-
KATG_ENT38        -----------------------------DPES-----LAKRPLAATEMGLIYVNPEGP-
KATG_CROS8        -----------------------------HPES-----LAQAPLGATEMGLIYVNPEGP-
KATG_ERWT9        -----------------------------HPES-----LANAPLGATEMGLIYVNPEGP-
KATG_KLEP7        -----------------------------HPES-----LAKQAIGATEMGLIYVNPEGP-
KATG_ACIBC        -----------------------------NSEA-----LAGSNLAATEMGLIYVNPEGP-
KATG_PSEMY        --------------------------KRVNDER-----ELTAPFGATHMGLIYVNPEGP-
KATG_METPP        --------------------------KRFTGDR-----DLDQPLAATHMGLIYVNPEGP-
KATG_JANMA        --------------------------KRFSGDR-----ELDENLSATHMGLIYVNPEGP-
KATG_AZOC5        ------------------------SHRTLE--------KFDAPLGATEMGLIYVNPEGP-
KATG_RALPJ        ------------------------EATRYSGER-----NLANPLAAVQMGLIYVNPEGPE
KATG_ACIAC        KGTPGDGT-----------LVAEPAMHGHEKDR-----VLENPLAAVQMGLIYVNPEGP-
KATG_PARPJ        KGAAGNEEDG-GVIVADVEKHGEEVSRDD-NGR-----ILENPLGAVQMGLIYVNPEGP-
KATG_PARXL        KGAAGDNDDG-GVIVADEEKHGEEVSRDN-SGR-----NLENPLGAVQMGLIYVNPEGP-
KATG_CUPNH        KGAAGKDE---GVVVADEALHGTETSRTD-SGR-----NLENPLAAVQMGLIYVNPEGP-
KATG2_BURCJ       KGGA-----------------CESQHGGN-AGR-----NLENPLAAVQMGLIYVNPEGP-
KATG_BORA1        KNEAQP--------VADKAGHGKEHGRTD-GGR-----NLENPLAAVQMGLIYVNPEGP-
KATG_HERSE        KGKGSSSQ---GEIPADAHRHGQEQARTAPAGR-----NLENPLAAVQMGLIYVNPEGP-
KATG_XANCP        HGSPGVDQ-------AHGVL-VKDDDSEVQHTR-----DLENPLAAVQMGLIYVNPEGP-
KATG_XANC5        RGSPGVDE-------AHGVL-VKDDDSQVPHTR-----DLENPLAAVQMGLIYVNPEGP-
KATG_XYLFA        AVSEGVHH-------PDEHRGAKEKAAKNSDSR-----VLENPLAAVQMGLIYVNPEGP-
KATG1_MAGO7       YSSGNEGH----KESGVIDGSESKKGHKDIHTR-----DLEKPVSAAHMGLIYVNPEGP-
KATG_NEUCR        YSEGQEGH----EGHGVVQGDESKKQHTDIHNR-----DLQSPLASSHMGLIYVNPEGP-
C7ZHZ3_NECH7      YSDGHPGT----SKAGAIDSDE--APHKDIHSR-----KLEEPLGA--LGLIYVNPEGP-
KATG2_MAGO7       YNNSVD---------------------INARAD-----KLEKPLAATHMGLIYVNPEGP-
C7ZIK0_NECH7      YNGSKD---------------------VVDRAD-----KLEKPLGAVSLGLIYVNPEGP-
KATG_FLAJ1        YNNGSDGV----PKDHGVVSADD-DADGKVHSR-----NLEKPLAAVQMGLIYVNPEGP-
KATG_METI4        ---------------------------RYSGKR-----DLEQPLAAVQMGLIYVNPEGP-
KATG_PSEE4        K----AEAPGKGDLVAEPAKRPQEQGRNLAGER-----NLENPLAAVQMGLIYVNPEGP-
KATG_PSEPF        KDPESMQPPGEGTLVAEPAEHGNEESRTNQGER-----NLENPLAAVQMGLIYVNPEGP-
KATG_PSESM        AQ-KKMQQPGDGTLVAEPENHANEESRTASGER-----NLENPLAAVQMGLIYVNPEGP-
KATG2_BURCC       -------------------------DKRYSGDR-----QLETPLAAVQMGLIYVNPEGP-
KATG2_CUPPJ       -------------------------DKRYSGVR-----DLENPLAAVQMGLIYVNPEGP-
KATG_CUPMC        -------------------------DKRYSGNR-----NLENPLAAVQMGLIYVNPEGP-
KATG_PSEF5        -------------------------DQRYSGDR-----ELENPLGAVQMGLIYVNPEGP-
KATG_BURL3        ---------------------SGGPNSRYSGKR-----DLESPLAAVQMGLIYVNPEGP-
KATG1_BURVG       ---------------------SGGPNSRYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_BURM1        ---------------------SGGPNSRYSGNR-----ELENPLAAVQMGLIYVNPEGP-
KATG_BURPS        ---------------------SGGPNSRYSGDR-----QLENPLAAVQMGLIYVNPEGP-
KATG_SERP5        ---------------------SGGQNSRYSGDR-----DLEDPLAAVQMGLIYVNPEGP-
KATG_RALSO        -------------------------DQRYTGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_HAHCH        ---------------------------RYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_SHEB8        ---------------------------RYSGER-----DLEDPLAAVQMGLIYVNPEGP-
KATG_METB6        ---------------------------RYSGDR-----KLENPLAAVQMGLIYVNPEGP-
KATG_METAC        ---------------------------RYTGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_METHJ        ---------------------------RYSGDR-----ELEKPLAAVQMGLIYVNPEGP-
KATG_CHLCH        ---------------------------RYSGER-----ELEKPLAAVQMGLIYVNPEGP-
KATG_SYMTH        ---------------------------RFGEEG-----KLEDPLAASEMGLIYVNPEGP-
KATG_FLAPJ        -------------------------DQRYSGDR-----ELENPLAAVQMGLIYVNPEGP-
KATG_GRAFK        -------------------------DERYAGE------ELENPLGAAHMGLIYVNPEGH-
KATG_ACAM1        -------------------------DQRYTGDR-----DLEATLGAVQMGLIYVNPEGP-
KATG_POLSJ        -------------------------DKRYSGDR-----DLENPLGAVQMGLIYVNPEGP-
KATG_BRASO        ---------------------------RYSGDR-----ELAGSLAAVQMGLIYVNPEGP-
KATG_RHILO        ---------------------------RYSGDR-----DLQNPLGAVQMGLIYVNPEGP-
KATG_BEII9        NK-----------------------HSRYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_CAUVC        ---------------------------RYSGER-----ELDSPLGAVQMGLIYVNPEGP-
KATG_PSEU5        ---------------------------RYSGER-----QLHPGLGAVQMGLIYVNPEGP-
KATG_RHOP5        ---------------------------RYSGER-----ELSDPLGAVQMGLIYVNPEGP-
KATG_RHOPT        ---------------------------RYSGER-----QLAEPLGAVQMGLIYVNPEGP-
KATG_RHOPS        ---------------------------RYSGER-----QLHDALGAVQMGLIYVNPEGP-
KATG_RHOPB        ---------------------------RYSGER-----QLADPLGAVQMGLIYVNPEGP-
KATG_SOLUE        ---------------------------RYSGER-----QLSEPLGAVQMGLIYVNPEGP-
KATG_CHESB        ---------------------------RYSGER-----QLSEPLAAVQMGLIYVNPEGP-
KATG_NITHX        ---------------------------RYSGER-----QLAEPLAAVQMGLIYVNPEGP-
KATG_NITWN        ---------------------------RYSGER-----ELAEPLAAVQMGLIYVNPEGP-
KATG_RHIL3        ---------------------------RYSGER-----GLAEPLGAVQMGLIYVNPEGP-
KATG_SINMW        ---------------------------RYSGER-----QLSEPLAAVQMGLIYVNPEGP-
KATG_ACICJ        ---------------------------RYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG2_SHEFN       -------------------------SDREDNGG-----KLQRPLGATHMGLIYVNPEGP-
KATG_SHELP        -------------------------SDREDRDG-----KLQRPLGATHMGLIYVNPEGP-
KATG_ALTMD        -------------------------SDREEREG-----KLQRPLGATHMGLIYVNPEGP-
KATG_COLP3        -------------------------DKRRDKKG-----KLKGPLAAVEMGLIYVNPEGP-
KATG_SHEWM        -------------------------DERRDKKG-----KLKGPLAAVEMGLIYVNPVGP-
KATG2_SHEAM       -------------------------NKRHNEKG-----ELAKPLGATQMGLIYVNPEGP-
KATG2_SHEON       -------------------------NKRHNGKG-----ELAKPMGATQMGLIYVNPEGP-
KATG2_CELJU       -------------------------DKRYSGDR-----TLEKPLAAVQMGLIYVNPEGP-
KATG2_IDILO       -------------------------DERYSGDR-----ELENPLAAVQMGLIYVNPEGP-
KATG_PSEA6        -------------------------NERYSGER-----KLEEPLAAVQMGLIYVNPEGP-
KATG_LEPBP        -------------------------DQRYKGNR-----ELKNPLAAVQMGLIYVNPEGP-
KATG_NOVAD        -------------------------DQRYHGDR-----KLQNPLAAVQMGLIYVNPEGP-
KATG2_BURVG       --------------------------NNRDKNG-----KLEKPLAATQMGLIYVNPEGP-
KATG_GRABC        --------------------------NNRDKNG-----KLEKPLAATQMGLIYVNPEGP-
KATG_ECOLX        --------------------------DNRDKNG-----KLQKPLAATQMGLIYVNPEGP-
KATG_YERPE        --------------------------DNRDKNG-----KLPKPLAATQMGLIYVNPEGP-
KATG_FRATT        --------------------------SSNVRDG-----KLAPAYAATQMGLIYVNPEGP-
KATG_SACD2        -------------------------DRRHSGDR-----KLDKPFGATEMGLIYVNPEGP-
KATG2_LEGPA       -------------------------SKRQDKDG-----KLEKPLAATVMGLIYVNPEGP-
KATG2_HALMA       --------------------------ERFDEPG-----EIQEGLGASVMGLIYVNPEGP-
KATG1_HALMA       -------------------------SERRTDDG-----ELKEPLGAAVMGLIYVDPEGP-
KATG_HALSA        -------------------------GDRFDADG-----SLKWPLGNTVMGLIYVNPEGP-
KATG_NATPD        --------------------------DRYDEAG-----ELPEPLGATVMGLIYVNPEGP-
KATG_SALRD        --------------------------GRFNEED-----ELDNPLGATVMGLIYVNPEGP-
KATG_METRJ        -------------------------KRWRGKNGD-ADYDLENPLAASHQALIYVNPEGP-
KATG_PSELT        --------------------------KERFKEG-----ELEKPFAATEMGLIYVNPEGP-
KATG_ARCFU        --------------------------KRGEKE------ELERPFAATEMGLIYVNPEGP-
B5Y4Y9_PHATC      -------------------------RFD-------ENGDIKRPLGASEMGLIYVNPEGH-
B8CF21_THAPS      -------------------------RHEKRSAED-DSTGLEKPLGAVQMGLIYVNPEGP-
KATG3_MYCS2       --------------------------ERHSGVR-----DLDQPLAASEMGLIYVDPQGP-
KATG_MYCGI        -------------------------DKRYGGSND-DKRELAEPFGATTMGLIYVNPEGP-
KATG1_MYCVP       -------------------------DKRYGGTNDSDTRELAEPFGATTMGLIYVNPEGP-
KATG_MYCSS        -------------------------DKRYGGTNE-DKRELAEPFGATTMGLIYVNPEGP-
KATG1_MYCFO       -------------------------DKRYGGTNDSTNRELANPYGATTMGLIYVNPEGP-
KATG_MYCIT        -------------------------DKRYSG-----ERELAQPYGATTMGLIYVNPEGP-
KATG_MYCUA        -------------------------DKRYSG-----KRDLAQPYGATTMGLIYVNPEGP-
KATG2_MYCS2       -------------------------DKRYGGG---EQRQLAEPYGATTMGLIYVNPEGP-
KATG_RHOJR        -------------------------DERYSG-----DRELSGPLGAVQMGLIYVNPEGP-
KATG_NOCSJ        -------------------------DERYSG-----DRELSNPLGAVQMGLIYVNPEGP-
KATG_SALTO        -------------------------DERYVS-----EKEFSAGVGATEMGLIYVNPEGP-
KATG1_CUPPJ       -------------------------DERYSG-----DRELAKPLANVQMGLIYVNPEGP-
KATG_FRACC        -------------------------DERYTG-----DRELENPLAAVQMGLIYVNPEGP-
KATG_FRASN        -------------------------DERYTG-----DRELENPLGAVQMGLIYVNPEGP-
KATG_STRCO        -------------------------DRRYTG-----DRELENPLGAVQMGLIYVNPEGP-
KATG_STRRE        -------------------------DRRYTG-----DRELENPLGAVQMGLIYVNPEGP-
KATG_STRGG        -------------------------DERYTG-----DRELENPLGAVQMGLIYVNPEGP-
KATG_SACEN        -------------------------DQRISGGE---QRELEKPLGATHMGLIYVNPEGP-
KATG2_MYCFO       -------------------------QDRYAGANG-DRTKLENPPXXPHMGLIYVNPEGP-
KATG2_MYCVP       -------------------------QDRYAGANG-DRTKLENPLGASHMGLIYVNPEGP-
KATG1_MYCS2       -------------------------K-RYTGER-----DLENPLAAVQMGLIYVNPEGP-
KATG_MYCA9        -------------------------E-RYTGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_MYCTU        -------------------------E-RYSGKR-----DLENPLAAVQMGLIYVNPEGP-
KATG_NOCFA        -------------------------K-RYSGER-----DLENPLAAVQMGLIYVNPEGP-
KATG_GLOVI        --------------------------ERYSSDR-----DLAHPLAAVQMGLIYVNPEGP-
KATG_KORVE        --------------------------KRYSGER-----DLENPLGAVQMGLIYVNPEGP-
KATG_CAUSK        ---------------------------RYTGER-----ELDKPLGAVQMGLIYVNPEGP-
KATG_MARMS        ---------------------------RYTGDR-----ELENPLAAVQMGLIYVNPEGP-
KATG1_ALKMQ       ---------------------------RYSGDR-----ELENPLAAVQMGLIYVNPEGP-
KATG_DESHY        ---------------------------RYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_PELCD        ------------------------PKSRYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_PELPD        ------------------------PKSRYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_GEOLS        ------------------------PYSRYSGER-----DLDNPLAAVQMGLIYINPEGP-
KATG_GEOSL        ---------------------------RYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_DESOH        ------------------------PKSRYSGDR-----DLENPLAAVQMGLIYVNPEGP-
KATG_CLOBB        ---------------------------REKGDK-----ELENPLAAVQMGLIYVNPEGP-
KATG_PROA2        ---------------------------RYSGER-----DLENPLAAVQMGLIYVNPEGP-
KATG_AZOSB        ------------------------PDSRYSGER-----QLENPLAAVQMGLIYVNPEGP-
KATG_DECAR        ------------------------PNSRYSGER-----NLDNPLAAVQMGLIYVNPEGP-
KATG_SYNSC        ---------------------------RHTTEG-----ALDQPLAAVEMGLVYVNPEGP-
KATG_SYNPW        ---------------------------RRNDKG-----ELNQPLAAVEMGLIYVNPEGP-
KATG_SYNR3        ---------------------------RHDNDG-----AIESPLAATEMGLIYVNPEGP-
KATG_PSYIN        ------------------------EGSRYSG-----ERDLENPLAAVMMGLIYVNPEGV-
KATG_SYNP2        ------------------------PHSRYSG-----ERDLENPLAAVMMGLIYVNPEGV-
KATG_SYNP6        ------------------------PNSRYTG-----DRELENPLAAVTMGLIYVNPEGV-
KATG1_VIBPA       ------------------------PNSRYSG-----ERDLENPLAAVMMGLIYVNPEGV-
KATG_SHEDO        ------------------------DNSRYSG-----ERNLENPLAAVMMGLIYVNPEGV-
KATG_SHEHH        ------------------------EGSRYSG-----ERDLENPLASVMMGLIYVNPEGV-
KATG_AERS4        ------------------------PGGRYSG-----ERDLDNPLAAVMMGLIYVNPEGV-
KATG_ALKEH        ------------------------PESRYSG----DRESLENPLAAVMMGLIYVNPEGV-
KATG_HALHL        ------------------------EDSRYGE----DRASLENPLAAVMMGLIYVNPEGV-
KATG_PECAS        -------------------------TERYGS-D--DRTSLENPLAAVQMGLIYVNPEGV-
KATG_RHOS5        -------------------------DSRYGDVA--DPASMENPLAAVQMGLIYVNPQGV-
KATG1_LEGPL       -------------------------AKRYDG-K--SRESLENPLAAVQMGLIYVNPEGV-
KATG_EDWTA        ------------------------EGSRYSG-----ERDLENPLAAVMMGLIYVNPEGV-
KATG_LEPCP        ------------------------EGSRYSG-----QRDLENPLAAVMMGLIYVNPEGV-
KATG_VIBCH        ------------------------ENSRYSG-----QRDLENPLAAVMMGLIYVNPEGV-
KATG_VIBVY        ------------------------ENSRYSG-----ERDLENPLAAVMMGLIYVNPEGV-
KATG_POLAQ        ------------------------KGSRYSG-----ERELSNPLAAVMMGLIYVNPEGV-
KATG2_VIBPA       ------------------------KNSRYSG-----ERDLENPLAAVMMGLIYVNPEGV-
KATG1_SHEAM       ------------------------ANSRYSG-----VRDLQNPLAAVMMGLIYVNPEGV-
KATG_AGRFC        -------------------------DGRYGDVS--KPETLENPLAAVQMGLIYVNPEGV-
KATG_PARDP        -------------------------DSRYGDVT--KAETLANPLAAVQMGLIYVNPEGV-
KATG_CHRSD        -------------------------DERYADVE--KPDTMENPLAAVQMGLIYVNPEGV-
KATG_MARHV        -------------------------DERYGDVE--KPDTMENPLAAVQMGLIYVNPEGV-
KATG_HYPNA        -------------------------DERYTDVD--KPETMENPLAAVQMGLIYVNPEGV-
KATG_MARMM        -------------------------DTRYEDVA--KPDTMENPLAAVQMGLIYVNPEGV-
KATG_PARL1        -------------------------VLRYANEE--DPESLEAPLGAVHMGLIYVNPQGR-
KATG_DINSH        -------------------------DERVTDVA--DANSMANPLAASHMGLIYVNPEGV-
KATG_ROSDO        -------------------------ENRYGDLD--DASTLENPLAAVHMGLIYVNPEGV-
F2I1Y2_PELSM      ---------------------------RYSDPE--DRSSLEAPLAASHFQLVYVNPQGV-
KATG1_SHEON       -------------------------DNPNSRYS--GARDLENPLAAVMMGLIYVNPEGV-
KATG_SHESW        -------------------------DNPNSRYS--GERDLENPLAAVMMGLIYVNPEGV-
KATG1_SHEFN       -------------------------DAENSRYS--GQRDLENPLAAVMMGLIYVNPEGV-
KATG1_CELJU       -------------------------GGEGSRYS--GERDLENPLAAVMMGLIYVNPEGV-
KATG_SYNY3        -------------------------DHRYGSED--RE-SLENPLAAVQMGLIYVNPEGV-
KATG1_IDILO       -------------------------KNRYSSDE--ERDSLENPLAAVQMGLIYVNPEGV-
KATG_VIBCB        -------------------------GGENNRYS--GERDLENPLAAVMMGLIYVNPEGV-
KATG_BACHD        ---------------------------RYSG-----DRELENPLAAVEMGLIYVNPEGP-
KATG_GEOKA        ---------------------------RYSG-----DRELENPLAAVQMGLIYVNPEGP-
KATG_ERYLH        -------------------------ETRIHPDE--G-RALENPLAAIQMGLIYVNPEGP-
KATG_SPHAL        -------------------------QTRIDPAK--GMETIEGPLAAIQMGLIYVNPEGP-
KATG_PHEZH        -------------------------KTRIVEGK--A---FEDPLAAVQMGLIYVNPEGP-
KATG_ARCB4        ------------------------ENSRYSG-----DRDLENPLAAVQMGLIYVNPEGP-
KATG_RUEPO        ------------------------ANSRYSG-----ARDLENPLAAVQMGLIYVNPEGP-
KATG_RUEST        ------------------------AQARYSG-----DRVLEDPLAAVQMGLIYVNPEGP-
KATG_JANSC        ------------------------ENTRYGE-----GRDLHNPLAAVQMGLIYVNPQGP-
                                                                    *:*::* *  

KATG_ECOLI        DHSG-EPLSAAAAIRATFGNMGMNDEETVALIAGGHTLGKTHGAGP-TS---NVGPDPEA
KATG_SALTY        DHSG-EPLSAAAAIRATFGNMGMNDEETVALIAGGHTLGKTHGAAA-AS---HVGADPEA
KATG_ENT38        NASG-EPLSAAAAIRATFGNMGMNDEETVALIAGGHTLGKTHGAAA-AT---HVGVDPEG
KATG_CROS8        NHSG-DPASAAPAIRATFGNMGMNDEETVALIAGGHTLGKTHGAAA-AN---HVGVDPEA
KATG_ERWT9        EASG-NPASAAPAIRATFGNMGMNDEEIVALIAGGHTLGKTHGAGE-AS---HVGVDPEA
KATG_KLEP7        NASG-EPLSAAAAIRATFGNMAMDDEEIVALIAGGHTLGKTHGAAE-TS---HVGAEPEA
KATG_ACIBC        QASG-DPRSAAPFIRATFGNMAMDDEEIVALIAGGHTLGKTHGAAS-AD---HVQADPEG
KATG_PSEMY        NASG-DYLAAAKDIRATFYRMAMNDEEIVALIAGGHTFGKAHGAAP-ES---HKGPEPEG
KATG_METPP        NASG-DPLAAAKDIRATFGRMAMDDEEIVALIAGGHTFGKAHGAAP-ES---HKGPEPEG
KATG_JANMA        DGSG-DYMAAAKDIRATFYRMAMDDEEIVALIAGGHTFGKAHGAAP-ES---HKGAEPEG
KATG_AZOC5        DRNG-DPISAAKFIRETFARMAMNDEETVALIGGGHTFGKTHGAAA-ES---HKGPDPEA
KATG_RALPJ        HAHG-DPLAAAKDIRETFARMAMDDEETVALIAGGHTFGKTHGAGP-AS---HVGADVEA
KATG_ACIAC        EGNP-DPVAAAHDIRETFARMAMNDEETVALIAGGHTFGKTHGAGT-AD---HVGPEPEA
KATG_PARPJ        DGNP-DPLAAAHDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AD---NVGPEPES
KATG_PARXL        DGNP-DPLAAAHDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AD---NVGPEPEA
KATG_CUPNH        DGNP-DPLAAAHDIRESFGRMAMDDEETVALIAGGHAFGKTHGAGP-AD---NIGPEPEG
KATG2_BURCJ       DGNP-DPVAAAYDIREVFGRMAMNDEETVALIAGGHAFGKTHGAGP-AD---NVGLEPEA
KATG_BORA1        DGNP-DPQASAHDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AD---NVGPEPEA
KATG_HERSE        EGNP-DPLAAAHDIRETFARMAMDDEETVALIAGGHTFGKTHGAGD-AK---HVGREPEG
KATG_XANCP        DGNP-DPLLAAKDIRDTFGRMAMNDEETVALIAGGHTFGKTHGAAD-AA---HVAAEPEA
KATG_XANC5        DGNP-DPIASARDIRDTFARMAMNDEETVALIAGGHTFGKTHGAGP-AD---NVGAEPEA
KATG_XYLFA        DGRP-DPLASARDIRETFARMAMNDEETVALIAGGHTFGKTHGAAP-AD---NVGPEPEA
KATG1_MAGO7       DGIP-DPVAAARDIRTTFSRMAMNDEETVALIAGGHTVGKTHGAAP-SD---NVGPEPEA
KATG_NEUCR        DGIP-DPVASAKDIRVTFGRMAMNDEETVALIAGGHSFGKTHGAGP-TH---HVGKEPEA
C7ZHZ3_NECH7      DGNP-DPVAAARDIRDTFGRMAMNDEETVALIAGGHSFGKTHGAGS-SD---HVGPEPEA
KATG2_MAGO7       NGTP-DPAASAKDIREAFGRMGMNDTETVALIAGGHAFGKTHGAVK-GS---NIGPAPEA
C7ZIK0_NECH7      DANS-NPADSALDIRVNFDRMGMNDEETVALIVGGHTFGKTHGAVP-GS---NIGPEPEA
KATG_FLAJ1        DGNP-DPILAAKDIRDTFGRMAMNDEETVALIAGGHTFGKTHGAAS-SD---HVDKEPEA
KATG_METI4        NGNP-DPVAAAVDIRETFTRMGMNDAETVALIAGGHTFGKAHGAGP-AS---FVGPEPEA
KATG_PSEE4        EGNP-DPVASGKDIRDTFGRMAMNDEETVALIAGGHAFGKTHGAGP-AD---NVGAEPEA
KATG_PSEPF        EGNP-DPVASAKDIRETFGRMAMNDEETVALIAGGHAFGKTHGAGP-AD---NVGPEPEA
KATG_PSESM        EGVP-DPVASARDIRETFGRMAMNDEETVALIAGGHAFGKTHGAGP-AD---NVGPEPEA
KATG2_BURCC       NGNP-DPLASARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGD-AS---HVGPEPEA
KATG2_CUPPJ       NGNP-DPAKAAVDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AS---HVGPEPEA
KATG_CUPMC        NGNP-DPVAAAIDIRETFRRMAMNDEETVALIAGGHAFGKTHGAGP-AS---HVGPEPEA
KATG_PSEF5        NGNP-DPLAAARDIRETFARMAMDDEETVALIAGGHTFGKTHGAGP-AT---HVGPEPEA
KATG_BURL3        DGTP-DPVAAAHDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AS---NVGAEPEA
KATG1_BURVG       DGKP-DPVAAARDIRDTFARMAMNDEETVALIAGGHTFGKTHGAGP-AS---HVGAEPEA
KATG_BURM1        DGNP-DPVAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AS---SVGPEPEA
KATG_BURPS        DGNP-DPVAAARDIRDTFARMAMNDEETVALIAGGHTFGKTHGAGP-AS---NVGAEPEA
KATG_SERP5        DGNP-DPVAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGP-AS---HVGDDPET
KATG_RALSO        NGNP-DPIAAARDIRETFARMAMNDEETVALIAGGHSFGKTHGAGP-AP---TWGPEPEA
KATG_HAHCH        NGNP-DPVAAAKDIRETFARMAMDDEETVALIAGGHTFGKTHGAGD-AA---NVGPEPEA
KATG_SHEB8        NGDP-DPFAAAVDIRETFARMAMNDEETVALIAGGHTFGKTHGAGD-AA---LVGPEPEA
KATG_METB6        NGKP-DPVAAAKDIRETFARMAMNDEETVALIAGGHSFGKTHGAGP-AS---HVGPEPEA
KATG_METAC        NGNP-DPIAAAKDIREVFARMAMNDEETVALIAGGHAFGKTHGAGP-AS---HVGPEPEA
KATG_METHJ        DGNP-DPVAAARDIREVFARMAMNDEETVALIAGGHAFGKTHGAGP-AS---HLGPEPEA
KATG_CHLCH        NGKP-DPLAAAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGD-AS---QVGPEPEA
KATG_SYMTH        GREP-DPLKAAQQIRETFKRMGMNDEETVALIAGGHTFGKTHGAAS-PS---HLGPEPEA
KATG_FLAPJ        NGNP-DPLASARDIRETFARMAMNDEETVALVAGGHTFGKTHGAADPNQ---YVSAEPAA
KATG_GRAFK        NGNP-DPVEAASYIRETFGRMAMNDYETVALIAGGHTFGKTHGAADAEE---YVEAEPAA
KATG_ACAM1        NGHP-DPVASGRDIRETFGRMAMNDEETVALTAGGHTFGKCHGAGD-DA---HVGPEPEG
KATG_POLSJ        NGNP-DPIAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGD-VK---HVGPEPEA
KATG_BRASO        NGKP-DPAAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDAS----LVGVEPEG
KATG_RHILO        NGNP-DPLAAARDIRDTFARMAMNDEETVALIAGGHTFGKTHGAGDAS----LVGVEPEG
KATG_BEII9        DGNP-DPLAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGPAD----HVGSEPEA
KATG_CAUVC        NGNP-DPLASARDIRETFARMAMNDEETVALIAGGHTFGKAHGAGDAS----LVGVEPEG
KATG_PSEU5        NGNP-DPKAAAVDIRETFARMAMNDYETVALIAGGHTFGKTHGAGDPS----FIGPEPEG
KATG_RHOP5        NGNP-DPVGSAKDIRETFYRMAMNDEETVALIAGGHTFGKTHGAGDPS----LLGPDPEA
KATG_RHOPT        NGNP-DPVAAAKDIRETFARMAMDDEETVALIAGGHTFGKTHGAGDPS----LIGPAPEG
KATG_RHOPS        NGNP-DPVAAAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPS----LIGAEPEG
KATG_RHOPB        NGNP-DPLGSAKDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPS----LLGPEPEG
KATG_SOLUE        NGNP-DPVAAAKDIRETFFRMAMNDEETVALIAGGHTFGKTHGAGDPS----LVGPDPES
KATG_CHESB        NGNP-DPVAAAKDIRETFYRMAMNDEETVALIAGGHTFGKTHGAGDPS----LIGPDPEG
KATG_NITHX        NGKP-DPIAAATDIRETFFRMAMNDEETVALIAGGHTFGKTHGAGDAS----LVGPAPES
KATG_NITWN        NGQP-DPLAAAKDIRETFLRMAMNDEETVALIAGGHTFGKTHGAGDAS----LVGPVPDS
KATG_RHIL3        NGTP-DPLASARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPS----FVGVDPEG
KATG_SINMW        NGNP-DPVAAAHDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDPS----FIGADPEG
KATG_ACICJ        NGKP-DPVAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDAA----LVGPEPEA
KATG2_SHEFN       KGVP-DPLGSAKNIRVAFERMAMNDEETLALIAGGHTFGKMHGAHKPK---DCLGAEPAA
KATG_SHELP        KGVP-DPLGSAKNIRTAFSRMAMNDEETLALIAGGHTFGKMHGAHKPK---DCLGAEPAA
KATG_ALTMD        KGVP-DPMGSAKNIRTAFARMAMNDEETVALIAGGHTFGKMHGAHKPA---DCLEAEPGG
KATG_COLP3        HGKP-DPLLAANDIRMSFGRMAMNDEEIVALLAGGHTLGKAHGAKKPN---GCVGAEPAA
KATG_SHEWM        HGNP-DPLLAANDIRMSFGRMAMNDEEIVALIAGGHTFGKAHGAKKPT---ECVGPEPAA
KATG2_SHEAM       NGVP-DPLAAARDIRETFGRMAMNDEETVALIAGGHTFGKAHGAHDPA---KCVGADPAA
KATG2_SHEON       NGVP-DPLASAKEIRDTFGRMAMNDEETVALIAGGHTFGKAHGAHDPA---KCVGADPAA
KATG2_CELJU       NGVP-DPLLAAKDIRDTFGRMAMNDEETVALIAGGHTFGKAHGAHKPE---TCLGKEPAA
KATG2_IDILO       NGKP-DPLLAAKDIRDTFGRMAMNDEETVALIAGGHTFGKAHGAHKPE---ECLGAEPAA
KATG_PSEA6        NGNH-DPISAAADIRDVFARMAMNDEETVALIAGGHTFGKAHGAHKPD---ECLDPAPAG
KATG_LEPBP        NGNP-DPLAAAKDIRETFGRMAMNDEETVALIAGGHTFGKAHGKSDPS---KHVGKEPAA
KATG_NOVAD        NGNP-DPLLAAKDIRETFGRMAMNDEETVALIAGGHTFGKAHGARKPE---GCVGVDPAA
KATG2_BURVG       NGNP-DPVAAAQDIREAFGRMAMNDEETLALIAGGHTFGKAHGAASPD---KCVGVAPAG
KATG_GRABC        NGVP-DPVAAARDIREAFGGMAMDDEETVALIAGGHTFGKAHGAASPS---KCVGPAPAA
KATG_ECOLX        GGKP-DPLASAKDIREAFSRMAMDDEETVALIAGGHTFGKAHGAASPE---KCIGAGPDG
KATG_YERPE        NGKP-DPVAAAKDIREAFARMAMNDEETVALIAGGHTFGKAHGAASPE---KCLGAAPGE
KATG_FRATT        DGKP-DIKGAASEIRQAFRAMGMTDKETVALIAGGHTFGKTHGAVPEDKVKQAIGPAPDK
KATG_SACD2        HGNP-DPIAAAHDIRQAFGRMGMSDEETVALIAGGHTFGKAHGAHKPS---DCVGADPEA
KATG2_LEGPA       NGVP-DPLAAAEKIRETFGRMAMNDEETVALIAGGHAFGKTHGAASGK----YLGPAPEA
KATG2_HALMA       DGNP-DPEASAKNIRQTFDRMAMNDKETAALIAGGHTFGKVHGADDPE---ENLGPEPEA
KATG1_HALMA       NGNP-DPLASAENIRESFGRMAMNDEETAALIAGGHTFGKVHGADDPE---ENLGDVPED
KATG_HALSA        NGEP-DLEGSAKNIRESFGKMAMNDKETVALIAGGHTFGKVHGADDPE---ENVGAEPAA
KATG_NATPD        DGEP-DLEGSAANIRESFGRMAMNDEETVALIAGGHTFGKVHGADDPD---EHVGGPPAD
KATG_SALRD        ESTP-DPEWSAQRIRKSFGRMAMNDRETAALIAGGHTFGKVHGAD-TD---EHLQAEPEA
KATG_METRJ        YASG-DPLASARDIRITFTRMAMNDEETVALIAGGHAFGKSHGMT-PA---KEIGPPPEM
KATG_PSELT        MGNP-DPSGSAKEIRLAFTRMGMNDEETVALIAGGHSFGKCHGAG-PS---KDLGPDPSS
KATG_ARCFU        GGNP-DPLGSAQEIRVAFRRMGMNDEETVALIAGGHAFGKCHGAG-PA---DYLGPDPSS
B5Y4Y9_PHATC      DNEP-NPTKSAHDIRQTFRNMAMDDYETVALIAGGHTFGKTHGAA-PV---SHQGPEPEG
B8CF21_THAPS      GGNP-DILASAKDIRETFSRMGMSDFETVALIAGGHTFGKAHGSADPS---KYVGAEPEG
KATG3_MYCS2       ATLP-DPLASARDIRETFRRMGMNDEETVALIAGGHTFGKSHGPTDPS---RCLGPEPEG
KATG_MYCGI        EGKP-DPLAAAHDIRETFGRMAMNDEETAALIVGGHTLGKTHGAA-DV----NVGPEPEG
KATG1_MYCVP       EGKP-DPLAAAHDIRETFGRMAMNDEETAALIVGGHTLGKTHGAA-DV----NVGPEPEG
KATG_MYCSS        EGKP-DPLAAAHDIRETFGRMAMNDEETAALIVGGHTLGKTHGAA-DV----NVGPEPEG
KATG1_MYCFO       EGKP-DPLAAAHDIRETFGRMAMNDEETAALIVGGHTLGKTHGPGPGD----LVGPEPEA
KATG_MYCIT        EGKP-DPIAAAIDIRETFGRMAMNDEETAALIVGGHSFGKTHGAGDAD----LVGPEPEA
KATG_MYCUA        EGKP-DPVAAAHDIRETFARMAMNDEETAALIVGGHSFGKTHGAGDAD----LVGPEPEA
KATG2_MYCS2       EGQP-DPLAAAHDIRETFGRMAMNDEETAALIVGGHTFGKTHGAGDAS----LVGPEPEA
KATG_RHOJR        NGQP-DPLAAARDIRETFSRMAMNDVETAALIAGGHTFGKTHGAGDAD----LVGPEPEG
KATG_NOCSJ        NGNP-DPLASARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDAD----LVGPEPEA
KATG_SALTO        RGNA-DPASAAHFIRETFRRMAMNDEETVALIAGGHTFGKTHGAGVADD---HVGPEPEG
KATG1_CUPPJ       GGNP-DPLAAARDIRETFARMAMNDEETVALIVGGHTVGKTHGAAPAAG---NVGLEPEG
KATG_FRACC        NGNP-DPIAAARDIRETFRRMAMNDEETVALIAGGHTFGKTHGAANPDE---HVGPEPEG
KATG_FRASN        NGTP-DPLAAARDIRETFRRMAMDDEETVALIAGGHTFGKTHGAGDPD----NVGPEPEG
KATG_STRCO        NGNP-DPIAAARDIRETFRRMAMNDEETVALIAGGHTFGKTHGAGPAD----AVGDDPEA
KATG_STRRE        NGNP-DPIAAARDIRETFRRMAMNDEETVALIAGGHTFGKTHGAGPAD----HVGADPEA
KATG_STRGG        NGNP-DPVAAARDIRETFRRMAMNDEETVALIAGGHTFGKTHGAGPAE----SVGADPEG
KATG_SACEN        EGKP-DPVAAARDIRETFGRMAMNDEETVALIAGGHTFGKTHGAAPDS----NLGPDSEA
KATG2_MYCFO       EGNP-DYLAAAIDIRETFGRMAMNDIETAALIVGGHTFGKTHGA-TDIE---N-GVEPEX
KATG2_MYCVP       EGNP-DPIAAAIDIRETFGRMAMNDVETAALIVGGHTFGKTHGA-TDIV---N-GPEPEA
KATG1_MYCS2       NGNP-DPQASAIDIRETFGRMAMNDVETAALIVGGHTFGKTHGN-GDAS---LVGPEPEA
KATG_MYCA9        NGNP-DPLAAAIDIRETFGRMAMNDEETAALIVGGHTFGKTHGA-GDAG---LVGPDPEA
KATG_MYCTU        NGNP-DPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGA-GPAD---LVGPEPEA
KATG_NOCFA        NGNP-DPLAAAVDIKDTFGRMGMTVEETVALIAGGHTFGKTHGA-GDAA---LVGAEPEA
KATG_GLOVI        NGKP-DPMAAAHDIRETFGRMAMNDEETVALIAGGHTFGKCHGAAEPS---QYVGAEPEG
KATG_KORVE        NGKP-DPAAAAVDIRETFARMAMNDEETVALIAGGHTFGKTHGAGVPT---EYVGPEPEG
KATG_CAUSK        NGKP-DPLAAAHDIRETFARMAMNDEETVALIAGGHTFGKAHGAGDAAH----VGVEPEA
KATG_MARMS        EGKP-DTLASARDIRDTFGRMAMNDEETVALIAGGHTFGKAHGAGDAAQ----VGADPEA
KATG1_ALKMQ       NGQP-SALASGKDIRDTFARMAMNDEETVALVAGGHTFGKCHGAGSAT----HVGPEPEA
KATG_DESHY        NGQP-SVLASGRDVRDTFKRMAMNDEETVALVAGGHTFGKCHGAGPAS----HVGPEPEA
KATG_PELCD        DGNP-DPVASGRDVRETFARMAMNDEETVALVAGGHTFGKCHGAGPAT----HVGPEPEA
KATG_PELPD        DGNP-DPVASGRDVRETFGRMAMNDEETVALVAGGHTFGKCHGAGPAT----HVGPEPEA
KATG_GEOLS        DGNP-DPVASGRDVRETFARMAMNDEETVALVAGGHTFGKCHGAGTAD----HVGPEPEA
KATG_GEOSL        NGEP-DPVASGRDVRETFARMAMNDEETVALVAGGHTFGKCHGAGPAT----HVGPEPEA
KATG_DESOH        DGNP-DPVAAGYDVIETFARMAMDPEETVALVAGGHTFGKCHGAGPAS----HVGPEPEA
KATG_CLOBB        NGNP-DPLGSAHDVRETFARMAMNDEETVALIAGGHTFGKCHGAASPS----YVGPAPEA
KATG_PROA2        DGKP-DPVAAGRDIRETFARMAMNDEETVALVAGGHTFGKCHGVGDPK----LVGPEPEA
KATG_AZOSB        DGNP-DPVASGRDVRETFARMAMNDEETVALVAGGHTFGKAHGAGDPK----LVGPEPEG
KATG_DECAR        DGNP-DPVASGRDIRETFARMAMNDEETVALTAGGHTFGKAHGAGDPA----LVGPEPEA
KATG_SYNSC        HGHP-DPVASGPDVRDTFARMGMTMEETVALVAGGHTFGKCHGAAPVS----QLEAEPEG
KATG_SYNPW        HGEP-DPVASGRDVRETFARMGMTVEETVALVAGGHTFGKCHGAAPDS----HLEAEPEG
KATG_SYNR3        HGEP-DPVASGREVRDTFARMGMNNEETVALVAGGHTFGKAHGAAPSA----HLGADPEG
KATG_PSYIN        DGNP-DPLKTAHDIRVTFERMAMNDEETVALTAGGHTVGKCHGNGDADQ----LGAEPEG
KATG_SYNP2        DGNP-DPLKTAHDIRITFSRMAMNDEETVALTAGGHTVGKCHGNGDATL----LGPEPEA
KATG_SYNP6        DGNP-DPLKTAHDVRVTFARMAMNDEETVALTAGGHTVGKCHGNGNAAL----LGPEPEG
KATG1_VIBPA       DGQP-DPLKTAHDVRVTFARMAMNDEETVALTAGGHTVGKAHGNGDAAN----LGPEPEG
KATG_SHEDO        DGKP-DPLKTAQDIRETFARMAMNDEETVALTAGGHTVGKAHGNGNADL----LGPEPED
KATG_SHEHH        DGHP-DPLKTANDVRVTFERMAMNDEETVALTAGGHTVGKCHGNGDAEL----LGPVPEG
KATG_AERS4        DGNP-DPLKTAKDMRVTFARMAMDDEETVALTAGGHTVGKCHGNGDARL----LGPEPEG
KATG_ALKEH        DGNP-DPLKTAEDVRVTFARMAMNDEETVALTAGGHTVGKCHGNGDAEK----IGPEPEA
KATG_HALHL        DGNP-DPLRTAEDVRITFERMAMNDEETVALTAGGHTVGKCHGNGDVEN----LGPDPES
KATG_PECAS        DGKS-DPLRTAQDMRVTFSRMAMNDEETVALTAGGHTVGKTHGNGDASL----LGAAPES
KATG_RHOS5        NGEP-DPLRTALHVRETFARMAMNDEETVALTAGGHTVGKCHGNGDAAL----IGPDPEA
KATG1_LEGPL       NGQP-DPLRTAQDVRVTFGRMAMNDEETVALTAGGHTVGKCHGNGNAKF----LGPDPEA
KATG_EDWTA        DGHP-DPQKTANDVRVTFARMAMNDEETVALTAGGHTVGKCHGNGSAAN----LGAAPEG
KATG_LEPCP        DGQP-DPLKTAQDVRVTFARMAMDDEETVALTAGGHTVGKSHGNGSAAN----LGPAPEG
KATG_VIBCH        DGNP-DPLKTAQDMRVTFARMAMNDEETVALTAGGHTVGKAHGNGKASN----LGPDPEG
KATG_VIBVY        DGNP-DPLKTAKDMRVTFARMGMNDEETVALTAGGHTVGKAHGNGNAAN----LGADPES
KATG_POLAQ        DGKP-DPLKTAQDMRVTFARMAMNDEETVALTAGGHTVGKAHGNGNAAN----LGPAPEA
KATG2_VIBPA       DGNP-DPLKTAQDMRVTFARMAMNDEETVALTAGGHTVGKCHGNGDAAN----LGPDPEG
KATG1_SHEAM       DGNP-DPLKTAQDMRVTFARMAMNDEETVALTAGGHTVGKAHGNGNAAN----LGPEPEA
KATG_AGRFC        NGKS-DPLATAAQMRETFARMGMDDEETVALTAGGHTIGKSHGNGSAAN----LSPDPEA
KATG_PARDP        NGKS-DPQATAYQMRETFARMGMNDEETVALTAGGHTVGKCHGNGNVTD----LSPDPEA
KATG_CHRSD        NGQP-DPQKTAEQVRETFARMAMNDEETAALTAGGHTIGKCHGNGEAEN----LSAEPEA
KATG_MARHV        NSQP-DPIKTGEQVRVTFARMAMDDEETAALTAGGHTVGKCHGNGDAGA----LGPEPEA
KATG_HYPNA        NGKS-DPLKSAAQVRETFARMAMNDEETAALTCGGHTVGKAHGNGDAGK----LSPPPEG
KATG_MARMM        NGKP-DPLKTAAQVRTTFARMAMNDEETAALTAGGHTVGKTHGNGDAGA----LGPEPEG
KATG_PARL1        DGKP-DPLKSAHDVRVTFKRMAMNDEETAALTAGGHTVGKAHGNGLESN----LSAPPEA
KATG_DINSH        NGTP-DPAQTAKYVRMTFARMAMNDEETAALTVGGHTVGKAHGGTMADK----VGADPAG
KATG_ROSDO        NGQP-DPARTAQHVRETFARMAMDDEETAALTCGGHTVGKAHGRGAVDN----IGVEPEA
F2I1Y2_PELSM      EGKP-DPVRTAMDVRETFGRMGMNDVETAALTVGGHSIGRAHGNGDPSN----LGPEPAA
KATG1_SHEON       DGKP-DPLRTAQDVRITFARMAMDDEETVALTAGGHTVGKCHGNGKAQD----LGPEPEG
KATG_SHESW        DGNP-DPLRTAQDIRITFARMAMDDEETVALTAGGHTVGKCHGNGKAQN----LGPEPEA
KATG1_SHEFN       DGQP-DPLKTAQDIRVTFERMAMNDEETVALTAGGHTVGKCHGNGRAEN----LEAAPEG
KATG1_CELJU       DGNP-DPLRTAKDIRETFARMAMNDEETVALTAGGHTVGKAHGNGNAAN----LGPDPEA
KATG_SYNY3        DGHP-DPLCTAQDVRTTFARMAMNDEETVALTAGGHTVGKCHGNSKAEL----IGPEPEG
KATG1_IDILO       DGNP-DPLRTAKDVRETFKRMAMNDEETCALTAGGHTVGKCHGNGKEEN----LGPEPEA
KATG_VIBCB        DGKP-DPLKTAHDMRVTFARMAMNDEETVALTAGGHTVGKAHGNGDASV----LEPEPEG
KATG_BACHD        DGKP-DPIKAAHDIRETFGRMGMNDEETVALIAGGHTFGKAHGAGNPDH----VGPEPEA
KATG_GEOKA        DGKP-DPVAAARDIRETFRRMGMNDEETVALIAGGHTFGKAHGAGPASH----VGPEPEA
KATG_ERYLH        GGDPHDPEGMARDMRETFARMAMNDEETVALTAGGHAFGKCHGAKPADT----FGTAPEG
KATG_SPHAL        QGNPHDDEGMARDMKETFKRMAMNDEETVALTAGGHTFGKAHGNGDPSL----LGPAPAG
KATG_PHEZH        DGSP-DPWASARDIRMTFARMGMNDEETLALTAGGHTFGKCHGAGDAAK----IGAEPEG
KATG_ARCB4        DGVP-DPIKSGIDIRETFARMAMDDEETVALTAGGHTFGKCHGAGDAAN----VGAEPEA
KATG_RUEPO        DGNP-DIVASGHDVIETFGRMAMDEAETVALVAGGHTFGKAHGNGPASA----VGPEPEA
KATG_RUEST        DGNP-DPIASGRDIRETFARMAMNDEETVALTAGGHTFGKAHGNGPVDA----VGPEPEA
KATG_JANSC        DGNP-DPLASAFDIRDTFARMAMNDEETVALVAGGHTFGKAHGAGDPDL----VGAEPEG
                       .    .  :   *  *.*   *  **  ***:.*: **                 

KATG_ECOLI        APIEEQGLGWASTYGS-GVGADAITSGLEVVWTQTPTQWSNYFFENLFKYEWVQTRSPAG
KATG_SALTY        APIEAQGLGWASSYGS-GVGADAITSGLEVVWTQTPTQWSNYFFENLFKYEWVQTRSPAG
KATG_ENT38        SLIESQGLGWTSTHGT-GVGADAITSGLEVVWSQTPTQWSNYFFENLFKYEWVQTRSPAG
KATG_CROS8        APIEAQGLGWHSSFGS-GAGADAITSGLEVTWTQTPTQWSNYFFENLFKYEWVQTRSPAG
KATG_ERWT9        APLESQGLGWTSSYGS-GSGADAITSGLEVIWTQTPTQWSNYFFENLFKYEWVQTHSPAG
KATG_KLEP7        APLEAQGLGWHSSYGS-GAGADAITSGLEVVWTQTPTQWSNYFFENLFKYEWVQTRSPAG
KATG_ACIBC        APIEQMGFGWANSYGT-GVGKDAITSGLEVIWSQTPTQWSNYFFENLFKYEWVQERSPAG
KATG_PSEMY        APIEAQGLGWTSNFGS-GFGKDTVSSGLEVTWTKTPALWSNNFFENLFKFEWELTKSPAG
KATG_METPP        APLEAQGLGWTSSFGS-GHGKDTVSSGLEVTWTTTPARWSNDFFEHLFKFEWELTQSPAG
KATG_JANMA        APIEAQGLGWVSNFGD-GYGKDTVSSGLEVTWTKTPALWSNNFFENLFKYEWEITKSPAG
KATG_AZOC5        AALEAQGLGWASNYGT-GHGADTIGSGLEVTWTQTPAQWSNFFFENLFKYEWVQTRSPAG
KATG_RALPJ        APLEAQGLGWASTFGT-GKGADAITSGLEVTWTQTPAQWSNFFFENLFKYEWVQEKSPAG
KATG_ACIAC        AGLEQQGLGWASSFGS-GKAGDAITSGLEVTWTSTPAQWGNEFFENLFKFEWELTKSPAG
KATG_PARPJ        AELEEQGLGWKNSYGS-GKGADTITSGLEVTWTTTPTKWSNNFFENLFKYEWELTKSPAG
KATG_PARXL        ADLENQGLGWKNSFGT-GKGADTITSGLEVTWTTTPTKWGNGFFENLFKYEWELTKSPAG
KATG_CUPNH        ADLERQGLGWASTFGT-GKGADTITSGLEVTWSNTPTKWGNSYLENLFGHEWELTKSPAG
KATG2_BURCJ       AGLEQQGLGWKNSFGT-GKGADTITSGLEVTWSDTPTQWGMGFFKNLFGYEWELTKSPAG
KATG_BORA1        AELENQGLGWKNSFGT-GKGSDTITSGLEVTWTSTPTKWSNNFFWNLFGYEWELTKSPAG
KATG_HERSE        EDMDSQGLGWKSSFGS-GVGGDTISSGLEVTWTQTPAQWSNYFFENLFKYEWELTKSPAG
KATG_XANCP        SDLESQGLGWHNSFGS-GKGGDTITSGLEVTWTTTPAQWSNDFFDHLFGFEWELSKSPAG
KATG_XANC5        GELESQGLGWHNRYGS-GKGADTITSGLEVTWTTTPAQWSNDYFDHLFGFEWELSKSPAG
KATG_XYLFA        GELEQQGLGWHNRFGS-GKAGDTITSGLEVTWTKTPTQWSNDFFEHLFGYEWELTKSPAG
KATG1_MAGO7       APIENQGLGWSNKHGS-GKGPDTITSGLEVIWTKEPAKFTMNYLEYLFKYEWELTKSPAG
KATG_NEUCR        APIEHQGLGWANSFGQ-GKGPDTITSGLEVTWTPTPTKWGMGYLEYLYKFDWEPTKSPAG
C7ZHZ3_NECH7      AGLEAQGLGWSNTYKS-GKGPDTTTSGLEVTWTKTPTKWSNNFFEYLFKFEWELTKSPAG
KATG2_MAGO7       ADLGMQGLGWHNSVGD-GNGPNQMTSGLEVIWTKTPTKWSNGYLESLINNNWTLVESPAG
C7ZIK0_NECH7      ADLGEMGLGWHNKVGE-GNGPNQMTSGLEVIWTKTPTKWSNGFLTSLLTNNWTLVESPAG
KATG_FLAJ1        AGLELQGFGWKNSFGS-GKGADAITSGLEVTWTKTPTQWSNNFFENLFAFEWELSKSPAG
KATG_METI4        AGIAEQGLGWRSSYRS-GKGADAIGSGLEVIWTRTPTRWNNDYFQFLFEYEWEPTKSPAG
KATG_PSEE4        AGLEQQGFGWHNTFGT-GKGGDTITSGLEVTWTSTPTKWSNEYLNNLFNFEWELTKSPAG
KATG_PSEPF        AGLEEQGLGWKNSFGT-GKGADTITSGLEVTWTTTPTKWSNNYLENLFGFEWELTKSPAG
KATG_PSESM        AGLEQQGFGWSNKFGT-GKGGDTITSGLEVTWTSTPTQWSNEYLENLFAFDWELTKSPAG
KATG2_BURCC       APLEQMGLGWKSSFGS-GKAGDAIGSGLEVIWTSTPTQWSNNFFWNLFGYDWELTKSPAG
KATG2_CUPPJ       AGIEEQGLGWRSSFGS-GKGSDAITSGLEVIWTSTPTKWSNNFFWNLFGYEWELTKSPAG
KATG_CUPMC        AGLEEQGLGWRSSFGT-GKGGDAIGSGLEVIWTTTPTKWSNDFFKHLFEYEWELTKSPAG
KATG_PSEF5        AGLEEQGLGWKSSFGT-GVGGDAITSGLEVIWTTTPTRWSNDFFDHLFGYEWELTTSPAG
KATG_BURL3        AGLEEQGLGWKSTFGT-GKGKDAITSGLEVTWTSTPTQWSNDFFKHLFSYEWELTKSPAG
KATG1_BURVG       AGIEQQGLGWKSTYGS-GKAGDAITSGLEVTWTSTPTQWSNDFFKHLFSYEWELTKSPAG
KATG_BURM1        AALEQQGLGWQSTFGT-GKGKDAITSGLEVTWTSTPTKWSNDFFKHLFSYEWELTKSPAG
KATG_BURPS        AGIEAQGLGWKSAYRT-GKGADAITSGLEVTWTTTPTQWSHNFFENLFGYEWELTKSPAG
KATG_SERP5        AGLERQGLGWQSSFGT-GKGKDAITSGLEVTWTTTPTQWNHDFFKHLFEYEWELTQSPAG
KATG_RALSO        AGIEEQGLGWSSRFGT-GKGTDAITSGLEVTWTTTPTQWSNNFFQNLFGYEWELTKSPAG
KATG_HAHCH        AGLEEQGLGWRSSYGS-GKAGDAITSGLEVTWTETPTQWSNNFFENLFGYEWELTKSPAG
KATG_SHEB8        ASIEQQGLGWKSSYKS-GKGGDAISSGLEVTWTSTPTQWSNNFFENLFGYEWELTKSPAG
KATG_METB6        APIEQQGLGWKSSFGT-GKGGDAIGSGLEVTWTSTPTKWSNNFFRILFSYEWELTKSPAG
KATG_METAC        ASIEAQGLGWKSSFGT-GKGDDTITGGLEVTWTNTPTKWSNNFFRILFGYEWELTKSPAG
KATG_METHJ        AGIEEQGLGWKNSFGT-GKGNDTITSGIEITWTPTPTKWSNNFFRVLFSYEWELTKSPAG
KATG_CHLCH        AGIEEQGLGWKNQYGT-GKGKDTITSGLEVIWTTTPTKWSNNFFWNLFGYEWELTKSPAG
KATG_SYMTH        APIEEMGLGWKNSYGT-GKGGDTITSGLEVTWTSSPTKWTSNFLWNLFGYEWELTKSPAG
KATG_FLAPJ        ASIEEQGLGWKNTFGS-GSGEHTISSGLEGAWTTTPAKWSHNYLENLFGFEWELTKSPAG
KATG_GRAFK        AGIESQGLGWKNTFGT-GNGADTITSGIEGAWTDTPTKWSNKYFDNLFKYDWECIKGPGG
KATG_ACAM1        ARIEDQCLGWKSSFGT-GKGVHAITSGIEGAWTTNPTQWDNNYFENLFGYEWELTKSPAG
KATG_POLSJ        AGIEEQGLGWNSGFGT-GKGGDTISSGLEVTWSTTPTKWGNNYFDNLFGYEWELTTSPAG
KATG_BRASO        ADIAQQGLGWASKYAS-GKAGDTITSGLEVIWTTTPTKWSNNYFENLFNYEWELTKSPAG
KATG_RHILO        ADIEQQGLGWASKFGT-GKGGDAIGSGLEVIWTTTPTKWSNNFFDNLFGFDWELTKSPAG
KATG_BEII9        AAVEQQGLGWKSSFGT-GVGKDAITSGLEVIWTQTPIQWSNHYLENLFGFEWELTKSPAG
KATG_CAUVC        GAIEAQGFGWASKHGT-GKGPDAITGGPEVIWTQTPTRWSNHFFDNLFKYEWELTQSPAG
KATG_PSEU5        ALIEDQGLGWRSKFQT-GIGPDAITSGLEVIWSQTPVKWSNYFFENLFNFEWELTKSPAG
KATG_RHOP5        GALEDQGLGWKSGYGT-GFGADAITGGPEVIWSQEPTKWSNHFFENLFNFDYELTKSPAG
KATG_RHOPT        GLLEEQGLGWTSKYGS-GFGADAITGGPEVIWTQTPTQWSNHFFENLFGFEWELDKSPAG
KATG_RHOPS        GALEDQGLGWKSKFGT-GFGADAITGGPEVIWTQTPTQWSNFFFENLFGFEWELDKSPAG
KATG_RHOPB        GDVEDQGLGWKSKYGT-GFGADAITGGPEVIWSQEPTKWSNHFFDNLFKFEWELTKSPAG
KATG_SOLUE        GALEDQGLGWKSKFGT-GFGADAITGGPEVTWSQTPTQWSNSFFKNLFENEWELTNSPAG
KATG_CHESB        AAIEDQGLGWKSGHGT-GFGADTITGGPEVTWSQTPTRWSNYFFENLFGYEWELTKSPAG
KATG_NITHX        APIEDQGLGWNSKFGT-GKGGDSIGSGLEVTWTQTPTTWDNNFFDTLFKYEWELTKSPAG
KATG_NITWN        APIEDQGLGWKGRFGT-GKGADAIGSGLEVTWTQTPTKWDNNFFDTLFGFEWELTKSPAG
KATG_RHIL3        GELEAQGLGWTSKFNT-GVGRDAIGSGLEVTWTQTPTQWSNYFFENLFAFEWELTKSPGG
KATG_SINMW        GAIEDQGLGWKSTFGT-GVGKDAITGGPEVTWSQTPTRWSNYFFENLFNFEWELSKSPAG
KATG_ACICJ        APIEQQGLGWISSYGT-GKGSDAITGGPEVTWTQTPTQWSNFYFDNLFNYEWELTKSPAG
KATG2_SHEFN       AGIEEQGLGWKNKCGK-GHSEDTITSGLEGAWTQAPTKWTSLYLSNLLTFEWKQTRSPAG
KATG_SHELP        AGIEAQGLGWHNKCGK-GHSEDTITSGLEGAWTQAPTKWTSLYLSNLLTYDWQQTRSPAG
KATG_ALTMD        AGLEEQGLGWKNNCGK-GNAEDTVTSGLEGAWTQLPTKWTSLYLQNLLGFEWKQTRSPAG
KATG_COLP3        ADIEAQGLGWKNKCGT-GVGADTISSGLEGAWTVTPTQWSSNYLDNLMNFNWVLTKSPAG
KATG_SHEWM        AAVEEQGFGWKNRCGT-GSGADTTSSGLEGAWTITPTQWTTNYLDNLFTFNWVKTKSPAG
KATG2_SHEAM       AGVEAQGLGWKNKCGK-GHSEDTVTSGLEGAWSVSPTQWTMQYLDNLYGFEWVQSKSPAG
KATG2_SHEON       AGIEEQGLGWKNKCGK-GHSEDTVTSGLEGAWSSNPTKWTMEYLTWLYTFDWVQTKSPAG
KATG2_CELJU       AGIEEQGLGWTNKCGK-GNAEDTITSGLEGAWSVNPIAWTTQYLDNLFAFEWVQVRSPAG
KATG2_IDILO       AGVEEQGLGWKNKCGK-GNAEDTITSGLEGAWSVNPTAWTTQYLDNLFGFEWEQTKSPAG
KATG_PSEA6        ATIEEQGLGWKNKCGK-GNAEDTITSGLEGAWSVSPTQWTMQYLDNLFGFEWVETQSPAG
KATG_LEPBP        AGLEEQGFGWKNNYKK-GNAEDTITSGLEGAWTANPTKWTTQYLNNLFGFEWVQTKSPAG
KATG_NOVAD        GAVEDQGLGWNNKCGK-GNAEDTVSSGLEGAWTANPIAWTTQYLDNLYAFEWVQTRSPAG
KATG2_BURVG       AGVEAQGLGWANKCGT-GKGVDTITSGLEGAWSVDPVHFTMQYLDNLLGHDWVLTKSPAG
KATG_GRABC        AGIEEQGLGWKNKCGT-GKGPDAITSGLEGAWSADPVNFTSQYLDNLFGFDWVLTKSPGG
KATG_ECOLX        APVEEQGLGWKNKCGT-GNGKYTITSGLEGAWSTSPTQFTMQYLKNLYKYEWELHKSPAG
KATG_YERPE        AGLEQQGLGWANKCGS-GNGKDTITSGLEGAWTTDPTHFTMQYLSNLYKHEWVLTKSPAG
KATG_FRATT        APIEQQGLGWHNSYGT-GNGDDTMGSGLEGSWTSTPTFWNHDFLHNLYNLDWKKTLSPAG
KATG_SACD2        ASMEEQGLGWTNKCGK-GNAEDTVTSGLEGAWTVSPAEWTHNFLQNLYAFEWELTTSPAG
KATG2_LEGPA       AGIEEQGFGWKNSYGS-GKGKDTITSGLEGAWTVTPTHWSHNYLQNLFNFNWVKTKSPGG
KATG2_HALMA       APIEQQGLGWQNKNGN-SKGGEMITSGIEGPWTQSPTEWDMGYINNLLDYEWEPEKGPGG
KATG1_HALMA       APIEQMGLGWENDYGS-GKAGDTITSGIEGPWTQAPIEWDNGYIDNLLDYEWEPEKGPGG
KATG_HALSA        APIEKQGLGWENEFGE-GKGPDTITSGIEGPWNTTPTQWDMSYVDNLLEYEWEPEKGPGG
KATG_NATPD        APIDLQGLGWENDFGE-GKGPDTITSGIEGPWNTTPTQWDMSYIDNLLDYEWWPEKGPGG
KATG_SALRD        APIEQQGLGWHNEHGS-GKGGDTITSGIEGPWTDAPTEWDMGYLDFLLDYEWEVHKGPGG
KATG_METRJ        APMEAMGLGWHNPKGS-GAGKDTMTNGIEGSWTPDPTKWDNAYLENLFRFEWEQTRSPAG
KATG_PSELT        SPIEQMGLGWKYTYKT-GKASDTYTSGFEVIWSSKPTKFGIQYLKFLLEFEWELEKSPDG
KATG_ARCFU        SPIEMQGLGWKYNYGK-GKGSDTFTSGLEVTWSPTPTKFGINYLRILFTYEWELEKSPAG
B5Y4Y9_PHATC      ASIEHQQLGYLSDYGT-GKGKDTTTSGLEGAWTETPIQWDMNYFKNLFEYEWEVHKGPGG
B8CF21_THAPS      APVEQMGLGWKNAYGT-GKGRDTITSGLEGAWTNKPTQWDNGYFELLFKYDWTQSKSPGG
KATG3_MYCS2       APLEALGLGWVNSFGT-GNGADTVTSGLDGIWTATPTKWDMSFLTTLFAYEWDVALSPAG
KATG_MYCGI        APMEQQGLGWKCPFGT-GNGNDTVTSGLEVIWTGTNSQWSNAFLENLYGNEWELTKSPAG
KATG1_MYCVP       APIEQQGLGWKCPFGT-GNAGDTVTSGLEVVWTTTPTKWSNAYLELLYGYEWELTKSPGG
KATG_MYCSS        APIEEQGLGWKCPFGT-GNANDTVTSGLEVIWTGTNSEWSNRYLEILYGNEWELTKSPAG
KATG1_MYCFO       APIEQQGLGWKCAFGS-GKGSDTITSGLEVVWTTTPTKWSNSYLEILYGYEWELTKSPGD
KATG_MYCIT        APIEQQGLGWKSSYGT-GSGKDAITSGLEVVWTPTPTKWDNSFLETLYGYEWELTKSPAG
KATG_MYCUA        APIEQQGFGWKSSFGS-GKGKDAITSGLEVVWTPTPTQWGNGFLELLYGYEWELTKSPAG
KATG2_MYCS2       APIEQQGLGWKSSYGT-GKGPDTITSGLEVVWTNTPTKWDNSFLEILYGYEWELTKSPAG
KATG_RHOJR        APIEQQGLGWKSAYGT-GVGKDAITSGLEVVWTPTPTKWDNSFLEVLYGYEWELTKSPAG
KATG_NOCSJ        APLEAQGLGWHSSFGS-GKGEDTITSGIEVTWTYHPTRWDNEFFHILYAYEWELMKSAAG
KATG_SALTO        APLEAQGLGWMSSHAS-GVGADTISSGLEVTWTDRPTQWSNRFFEILFGYEWELTTSPGG
KATG1_CUPPJ       APIEEQGLGWKNKFGS-GKGSDAITSGLEGAWTNNPTKWDNGFLENLFKYEWELTTSPAG
KATG_FRACC        APIEEQGFGWTSTFGT-GRGGDTITSGLEGAWTNTPVSWDNSFFEILFSYEWELTKSPAG
KATG_FRASN        APLETQGLGWKNAFGT-GKGADAITSGLEGAWTPTPVSWDNSFFETLFGYEWALTKSPAG
KATG_STRCO        AAMEQQGLGWKSTHGT-GKGGDAITSGLEVTWTSTPTQWGNGFFKNLFEFEYELEQSPAG
KATG_STRRE        ASLEEQGLGWRSTYGT-GKGADAITSGLEVTWTSTPTQWSNGFFKNLFEYEYELEQSPAG
KATG_STRGG        APLEEQGLGWRSSYRS-GKGGDAITSGLEVTWTSTPTRWGNEFFHNLFAYEYELTKSPAG
KATG_SACEN        APLEAQGLGWHNSHGT-GKGADTITSGLEVTWTSTPTQWSNGFFENLFGYEYELYQGPGG
KATG2_MYCFO       XPLEQMGLGWANP----GLGNDTVSSGLEVTWTQHPTKWDNSFLEILYSNEWELTKSPAG
KATG2_MYCVP       APLEQMGLGWSNP----GVGIDTVSSGLEVTWTHTPTKWDNSFLEILYGNEWELFKSPAG
KATG1_MYCS2       APLEEVGLGWRNPQGT-GVGKDAITSGLEVTWTHTPTKWDNSFLEILYGNEWELTKSPAG
KATG_MYCA9        APLEQMGIGWKSAFGS-GKGNDAIGSGLEVIWTHTPTKWDNSFLEILYGNEWELTKSPAG
KATG_MYCTU        APLEQMGLGWKSSYGT-GTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAG
KATG_NOCFA        APLEQMGLGWKSSHGT-GKGADAITSGLEVVWTTKPTQWSNDFFEILFGYEWELTKSPAG
KATG_GLOVI        AGIERQGLGWDNSFGS-GRGVHTITSGLEGAWTKNPIQWDNGYFENLFEYEWELTKSPAG
KATG_KORVE        AGIEEQGLGWKNKLGH-GHGYHTITSGLEGAWTTNPIKWDNGFFDNLFGYDWELTKSPAG
KATG_CAUSK        AGIALQGLGWKNSFGS-GVGSDAITSGLEGPWTPNPIKWDNGFFDTLFGHEWELTKSPAG
KATG_MARMS        AGIAEQGFGWSNSMGT-GKGVDTISSGLEGAWTKSPIAWDNGYFENLFEYDWELTKSPAG
KATG1_ALKMQ       ANIEEQGLGWKNSMGS-GKGIHTISSGIEGAWTPTPIKWDNSYLDTLFNYDWDLVKSPAG
KATG_DESHY        APLEEQGLGWKSTFRS-GKGGDTIGSGIEGAWKPNPTTWDMGYLETLFKYDWDLVKSPAG
KATG_PELCD        APIEEQGLGWKSSFGS-GKGGDTISSGIEGAWKPNPTKWDMGYLKVLFKYEWEKVKSPAG
KATG_PELPD        APIEEQGLGWKSSFRS-GKGGDTIGSGIEGAWKPNPTTWDMGYLKVLFKYEWELVKSPAG
KATG_GEOLS        APLEAQGLGWISSYKS-GKGGDTISSGIEGAWKPNPTTWDMGYLKVLFKYEWELVKSPAG
KATG_GEOSL        APLEDQGLGWKSTFRS-GKGGDAIGSGLEGAWKPNPTTWDMGYLKVLFKYEWELVKSPAG
KATG_DESOH        APIEAQGLGWKSSFGT-GKGGDTITSGIEGAWKPYPTRWDMGYLKVLFKYEWELVKSPAG
KATG_CLOBB        APIEEQGLGWKNTYGS-GNGDDTIGSGLEGAWKANPTKWTMGYLKTLFKYDWELVKSPAG
KATG_PROA2        ADIEEQGLGWKSGYGI-GKGDETMTSGLEGAWTPDPIHWDMGYLGMLFRYEWELTKSPAG
KATG_AZOSB        APIEAQGLGWINSFGT-GHGVHTTTSGIEGAWKPNPTKWDNGYFDMLFGYEWALTRSPAG
KATG_DECAR        APIEEQGLGWINKFGS-GKGIHATTSGIEGAWKPNPTKWDNGYFDMLFGYEWELTRSPAG
KATG_SYNSC        AELHQQGLGWHNRFES-GKGEHTITSGIEGAWKPHPTRWDQGYFEMMFTYEWELTKSPAG
KATG_SYNPW        AALHEQGLGWRNTYES-GKGEHTITSGIEGAWKPNPTRWDQGYFQMMFTYEWELTKSPAG
KATG_SYNR3        AALEQLGLGWQNTYAS-GCGADTITSGIEGAWKPNPTRWDQGYFEMLFGYEWELHQSPAG
KATG_PSYIN        AEIEDQGFGWLNKTKR-GIGRDTVSSGIEGAWTTNPTQWDNGYFQLLLNYEWELKKSPAG
KATG_SYNP2        ADLDDQGLGWLNKTQR-GIGRNTVTSGIEGAWTTYPTQWDNGYFRLLLNYDWELKKSPAG
KATG_SYNP6        ADVEDQGLGWINKTQS-GIGRNAVTSGLEGAWTPHPTQWDNGYFRMLLNYDWELKKSPAG
KATG1_VIBPA       ADIHDQGLGWLNKTTR-GVGNNAVTSGIEGAWTSQPTQWDNGYFHLLLNYDWELKKSPAG
KATG_SHEDO        ADIHDQGFGWLNKAKR-GIGRDTVTSGIEGAWTTHPTQWDNGYFTMLLNHEWELCKSPAG
KATG_SHEHH        ADVEDQGLGWINKSQR-GIGRDTVSSGLEGAWTTHPTQWDNGYFTLLLNHEWQLNKSPAG
KATG_AERS4        AAVEDQGLGWLNKTQR-GIGRNAVTSGIEGAWTTHPTRWDNGYFYLLFNYEWELKKSPAG
KATG_ALKEH        ADVEEQGLGWRNLASR-GVGRDTVTSGLEGAWTTHPTRWDDGYFDMLLNHEWELTKSPAG
KATG_HALHL        ADVEEQGLGWNNKVTR-GVGRDTVSSGIEGAWTTYPTRWDNGYFHLLLNYEWELTKSPAG
KATG_PECAS        ADVEEQGLGWHNPTGS-GKGRYTVTSGLEGAWTTHPTQWDNGFFQMLLNHEWELRKSPAG
KATG_RHOS5        ADVVEQGLGWMNHSTR-GVGRNTVTSGIEGAWTTHPTRWDNGYFDLLFGYEWELRKSPAG
KATG1_LEGPL       ADVEDQGLGWINKTTR-GIGRNTVSSGIEGAWTTHPTQWDNGYFYLLLNYDWELKKSPAG
KATG_EDWTA        ADLQEQGLGWNNHTTR-GIDRDTVSSGIEGAWTSKPTQWDNGYFDMLLGHEWTLTKSPAG
KATG_LEPCP        ADVHEQGLGWNNHSSR-GIGRDTVTSGIEGAWTTHPTQWDNGYFKLLLGYDWELKKSPAG
KATG_VIBCH        AELHEQGLGWNNHTSR-GIGRNTVTSGIEGAWTTHPTRWDNEYFYLLLSYEWQLTKSPAG
KATG_VIBVY        ADLEEQGLGWNNHKSR-GIGRDTVTSGIEGAWTTNPTQWDNGFFHLLFSYDWWLQKSPAG
KATG_POLAQ        APIDEQGLGWMNHKTR-GIGRDAVTSGLEGAWTTHPTQWDNGYFNLLLNYDWKLTESPAG
KATG2_VIBPA       ADVHEQGLGWMNHKTR-GIGRDTVTSGLEGAWTTHPTQWDNGYFYLLFKYDWELKKSPAG
KATG1_SHEAM       APLEEQGFGWMNHQSR-GIGRNTVTSGIEGAWTTHPTRWDNGYFHLLFSYDWALTKSPAG
KATG_AGRFC        AGPEYQGLGWINTKGR-GIGRDTVVSGIEGAWTSEPTKWDNGFFDMLFKHEWTLTHSPAG
KATG_PARDP        AGPEFQGLGWMNTKGR-GIGRNTMVSGLEGAWTTHPTQWDNGFFEMLFKHEWTLTHSPAG
KATG_CHRSD        ADVEYQGIGWMNTKGR-GIGRDTVVSGIEGAWTKNPTQWDMGWFDMLFNHEWELKKSPAG
KATG_MARHV        ADVEEQGFGWSNPNMK-GKAANAVTSGIEGAWTTHPTKFDMGYFDLLFGYEWELKKSPAG
KATG_HYPNA        NDLETQGFGWMNPNMD-GKATNAVTSGIEGAWTTHPTKWDMGYFHLLFGYEWELTKSPAG
KATG_MARMM        AELENQGFGWVNPNLG-GKASNAVTSGLEGAWTTNPTQFDMGYFELLFGYEWELKKSPAG
KATG_PARL1        ADIEEQGFGWVNHKTR-GVGRDTVTSGLEGAWTSKPTTFDMGYFDMLFGHEWELKKSPAG
KATG_DINSH        CPVHMQGFGWENPGFD-GNANTAHTSGLEGAWTSNPTQWDNGYLELLFKYDWEVTKSRAG
KATG_ROSDO        AGIEAQGFGWSNPRHD-GKATNAFTSGIEGAWTTHPTQWDMGYFKLLFGYEWQLTKSPAG
F2I1Y2_PELSM      AEIHEQGFGWNQKN---GTGANQVTSGLEGAWTTNPDKWDHQYLDLLLNYQWESKKSPAG
KATG1_SHEON       EDVEAQGLGWLNKKGR-GVGCDAVTSGLEGAWTTHPTQWDNGYFYLLLNYDWELKKSPAG
KATG_SHESW        EDVEAQGLGWLNKHGR-GVGRNTVTSGIEGAWTTHPTQWDNGYFSLLLGYDWELKKSPAG
KATG1_SHEFN       AELEDQGLGWLNKTSR-GIGRDTVTSGIEGAWTTHPTQWDNGYFELLLNYDWELKKSPAG
KATG1_CELJU       ADVEEQGLGWVNHKTR-GIGRDTVTSGIEGAWTTHPTKWDNGYFDMLLNHDWELTKSPAG
KATG_SYNY3        ADVVEQGLGWHNQNGK-GVGRETMSSGIEGAWTTHPTQWDNGYFYMLFNHEWELKKSPAG
KATG1_IDILO       ADVEEQGMGWRNSGGK-GVGRDTMSSGIEGAWTTNPTQWDNGYFYLLFNYEWELKKSPAG
KATG_VIBCB        AEIEDQGFGWLNKTSR-GIGRDTVTSGVEGAWTTHPTKWDNGYFHLLFTYDWEITKSPAG
KATG_BACHD        APIEAQGLGWQNTYGS-GKGRDTITSGLEGAWTANPTQWDNGFFDLLFGYEWWLTKSPAG
KATG_GEOKA        APIEAQGLGWISSYGK-GKGRDTITSGIEGAWTPTPTQWDNSYFRLLFEYEWKLTKSPAG
KATG_ERYLH        ENLHLMGMGWLTDEEE-IRNGHVTTSGIEGPWTPNPTQWGNDYFRLLFKYEYELTQSPAG
KATG_SPHAL        SDLAAQGFGWVSSHESGGIGEHAVTSGIEGAWTNTPREWTENYFRLLFDYDYELVKSPAG
KATG_PHEZH        ADIAQQGLGWTSSHES-GMGDHTITSGLEGPWTPTPIKWDMSYFHMLLDYKYELVRSPAG
KATG_ARCB4        EGLVAQGLGWLSKFLS-GKGDDTITSGIEGSWTANPTRWDNEYFDILLSYDWELTKSPAG
KATG_RUEPO        APIEAMGLGWLSTHGS-GKGADAITSGIEGAWKPHPTTWDMGYFKVLFKYDWELTKSPAG
KATG_RUEST        APIEAMGQGWLSSHKS-GKGVDTITSGIEGAWTPNPIQWDMGYFDVLFGYDWELTKSPAG
KATG_JANSC        ADVAEMGLGWKNGFES-GKGVHSTTSGVEGPWTPTPTQWDMSYFDVLFGHEWELTKSPAG
                          *:               .* :  *.     :   :.  :   .:    .  .

KATG_ECOLI        AIQFEAVDAPE--IIPDPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQAFNEAF
KATG_SALTY        AIQFEAVDAPD--IIPDPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQAFNEAF
KATG_ENT38        AIQFEAVDAPE--IIPDPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQAFNEAF
KATG_CROS8        AIQFEAVDAPE--IIPDPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQAFNEAF
KATG_ERWT9        AIQFEAQDAQA--SIPDPFDADKKRKPTMLVTDLTLRFDPEFEKISRRFLQDPQSFNEAF
KATG_KLEP7        AIQFEAKDAPE--IIPDPFNPEKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQAFNEAF
KATG_ACIBC        AIQWVAADAEA--IIPDPFDPSIKRKPTMLTTDLTLRFDPEFEKISRRFLNDPQAFANAF
KATG_PSEMY        AKQWVAKDAPE--IIPDAHVPGKFHKPTMLTTDLTLRFDPEFGKISKRFYEDPQAFADAF
KATG_METPP        AKQWTAKDAPE--IIPDAHVPGKKLKPTMLTTDLTLRVDPEFEKISRRFLDNPQGFADAF
KATG_JANMA        AKQWVAKDAED--IIPDAHIKGKFHKPTMLTTDLTLRFDPEFGKISKRFYEDPQAFAEAF
KATG_AZOC5        AIQWEAKDGPD--IIPDAHNPEKKHKPTMLTTDLSLRFDPIYEKISRRFLENPQAFAEAF
KATG_RALPJ        ALQWVAKDAEA--IIPGPTPDSPKRRPTMLTTDLSLRFDPAYEKISRRFLDNPQAFAEAF
KATG_ACIAC        AHQWQAKNAPA--TIPDAHDPSKKRVPTMLTTDLSLRFDPAYEKISRRFLENPQAFAEAF
KATG_PARPJ        ANQWVAKGADE--TIPHAHDPSKKQRPTMLTTDLSLRFDPAYEKISRRFLENPDQLADAF
KATG_PARXL        AHQWVARDAGE--TIPHAHDPSKKLRPTMLTTDLSLRFDPVYEKISRRFLENPDQLADAF
KATG_CUPNH        ANQWVAKDAAE--TIPHAYDPAKKLRPTMLTTDLSLRFDPAYEKISRRFLEHPDQLADAF
KATG2_BURCJ       AHQWVAKNAEP--TIPHAHDPSKKLLPTMLTTDLSLRFDPVYEKISRHFMDNPDVFADAF
KATG_BORA1        AHQWIPKHGAGAGSVPDAHDPSKRHVPSMLTSDIALRVDPAYEKIARRFFENPDEFADAF
KATG_HERSE        AHQWVAKGADA--VIPHAHGGAP-LLPTMLTTDLSLRFDPAYEKISRRFLEHPEQFADAF
KATG_XANCP        AHQWVAKNAQA--IIPDAHDASKKRLPTMLTTDLALRIDPAYEAISRRFHANPDQFADAF
KATG_XANC5        AHQWVAKNADA--IIPDAHDASRKHRPTMLTTDLALRFDPAYEAISRRFQQHPEQFADAF
KATG_XYLFA        AYQWVAKNAAA--TIPHAHDPSKKLLPMMLTSDLALRFDPIYEKISRHFHAHPDQFADVF
KATG1_MAGO7       ANQWVAKNAEE--FIPDAFDPSKKHKPRMLTTDLSLRFDPEYEKISRRFLENPEQFKDAF
KATG_NEUCR        ANQWVAKNAEP--TIPDAYDPNKKKLPTMLTTDIALRMDPAYDKICRDYLANPDKFADAF
C7ZHZ3_NECH7      AHQWVAKDAPE--IIPDAYDPNKKQRPTMLTTDLSLRFDPEYEKISRRFLNNFDEFSEVF
KATG2_MAGO7       AHQWEAVNGTV--DYPDPFDKTKFRKATMLTSDLALINDPEYLKISQRWLEHPEELADAF
C7ZIK0_NECH7      AHQWEALNGTV--DYPDPFDKTKFRRATMLTSDLALIHDPEYLKICKRWQKNPEELRKAF
KATG_FLAJ1        AHQWVAKNAEA--IIPDAFDSTKKHLPTMLTTDLSLRLDPEYEKISRRFLENPDQFADAF
KATG_METI4        AWQWVAKDAPE--IVPDPFDPAKKRKPTMLTTDLSLRFDPVYEKIARAYYEQPDLFADAF
KATG_PSEE4        AHQWRPKDGKGANTVPDAHDTTKRHAPSMLTSDLALRFDPIYEPIARRFKDNPDQLADAF
KATG_PSEPF        AHQWKPKNGAGAGTIPHAHDPNKRIDPTMLTSDLALRFDPTYEKISRRFLANPDQLADAF
KATG_PSESM        AHQWTPKNGAGAGKIPDAHDPSKRHAPSMLTSDLALRFDPAYEQISRRFLANPEQLADAF
KATG2_BURCC       AHQWQPKGGAGADSVPDPFEPGKRRVPTMLTSDIALRADPTYEKISRRFFENPNEFAEAF
KATG2_CUPPJ       AHQWKPNGDAGANSIPDPYDPSRRRGPTMLTTDLSLRVDPAYEKISRRFHENPDQFADAF
KATG_CUPMC        AHQWKPKGNAGAGTVPDPADPSKRRSPSMLTTDLSLRFDSIYGKISRRYYDHPDELADAF
KATG_PSEF5        AHQWRPKAGAGADSVPDPHDPNKRRTPSMLTTDLSLRFDPAYEAISRRFHEHPEQLAEAF
KATG_BURL3        AHQWVAKD--AGDVIPDAFDASKKHRPTMLTTDLSLRFDPAYEKISRRFYENPAEFADAF
KATG1_BURVG       AHQWVAKD--AEAVIPDAFDPSKKHRPTMLTTDLSLRFDPAYEKISRRFYENPDEFADAF
KATG_BURM1        AHQWVAKD--AEAVIPDAFDPSKKHRPTMLTTDLALRFDPEYEKISRRFYEHPDQFADAF
KATG_BURPS        AHQWVAKG--ADAVIPDAFDPSKKHRPTMLTTDLSLRFDPAYEKISRRFHENPEQFADAF
KATG_SERP5        AHQWVAKD--VGETIPDAFDPAKKQRPTMLTTDLSLRFDPAYEKISRRFYEHPDQLADAF
KATG_RALSO        AHQWVAKD--AAETIPDAHDPSAKHLPTMLTTDLSLRFDPAYEKISRRFYEHPEQFADAF
KATG_HAHCH        AHQWVPKGGAGADKIPDAHDPSKRHVPTMLTTDLSLRFDPAYEKISRRFYENPDQLADAF
KATG_SHEB8        AHQWIPKNGAGKGVIPDAHDASKRHVPAMLTTDLALIFDPDYEKISRRFFEHPDEFADVF
KATG_METB6        AYQWQPKDGAGAGTIPDAHDKNKRRAPTMLTTDLSLRFDPVYEKISRHFYENPDQLADAF
KATG_METAC        AYQWKPKGGAGAGTIPDAHDPSKRHAPSMMTTDLSLRFDPVYEKISRHFYENPGQLADSF
KATG_METHJ        AYQWKPKGEAGAGTVPDPHDPKKRHAPGMLTTDLALRFDPIYEKISRRFYENPELFADAF
KATG_CHLCH        AYQWTPKYGVGANTVPDAHDPSKRHAPAMMTTDLALRFDPDYEKIARRYYENPDQFADAF
KATG_SYMTH        AWQWRPKNGAGEGTVPDAHDPNKRHAPGMLTTDIALRVDPVYEKIARRFLENPDEFAKAF
KATG_FLAPJ        AHQWKPKNGAGAGTVPDAHNSSKSHAPTMLTADLALRADPIYEKISRRFLENPAEFEEAF
KATG_GRAFK        AYQWQPKDNAGAGTVPDAHDPDKKHAPFMLTTDLSLKMDPEYEKISRHFYENPDEFADAY
KATG_ACAM1        ANQWVPQGGAGANTVPDAHDPSRRHAPIMTTADMAMRMDPIYSPISRRFLDNPDQFADAF
KATG_POLSJ        AQQWKPKGDAGAGTVPDAHDPSKRHAPAMLTTDLSLRLDPAYEKISRRFHENPDQLADAF
KATG_BRASO        AHQWTPKGGAGAGTVPDAHDPSKRHAPSMLTTDIALRVDPAYEKISRRFLEHPDQFADAF
KATG_RHILO        AHQWTPKGGAGAGTVPDAHNSAKRHAPSMLTTDLALRFDPSYATISKRFHENPDQFADAF
KATG_BEII9        AHQWRPKNGAGAGSVPDAFDPNKRHAPSMLTTDLALRADPAYEKIARRYLENPAEFADAF
KATG_CAUVC        AKQWQAKN--APADIPDAFDPNKTHVPRMLTSDLALRFDPAYEKISRRFYENPDQFADAF
KATG_PSEU5        AHQWVAKD--APEIIPDPFDPNKKRKPTMLTTDLSLRFDPIYEPISRHFLENPDEFADAF
KATG_RHOP5        AQQWVAKN--AEPSIPDPFDPSKKRLPTMLTSDLALRFDPIYEKISRRFFENPDQFADAF
KATG_RHOPT        AKQWKAKG--AEATVPDPFDPAKKRVPTMLTTDLSLRFDPIYEKISRRFLENPDQFADAF
KATG_RHOPS        AKQWKAKG--AEATVPDPFDPTKKRVPTMLTTDLSLRFDPAYEKISRRFFENPDQFADAF
KATG_RHOPB        AQQWVAKN--AEPSVPDPFDPSKKRLPTMLTSDLALRFDPIYEKISRRFYENPDEFADAF
KATG_SOLUE        AKQWRAKN--GQATIPDPFDKSKKRVPTMLTTDLSLRFDPAYEKISRRFYENPDQFADAF
KATG_CHESB        AWQWKAKN--AEATVPDAHDPSKKHVPTMLTTDLSLRFDPIYEKISRRFLENPDQFADAF
KATG_NITHX        AYQWQAKD--APAITPDAHDTSKKHVPTMLTTDLSLRFDPAYGKISKHFHENPDQFADAF
KATG_NITWN        AHQWRAKD--APAITPDPFDESKKHVPTMLTTDLSLRFDPIYGEISKRFHENPDQFADAF
KATG_RHIL3        AHQWQAKN--ADASIPDAYDASKRHLPTMLTSDLALRFDPVYEKISRRFLENPDQFADAF
KATG_SINMW        AHQWKAKN--AEASVPDAYDATRKHVPTMLTTDLSLRFDPVYEKISRRFLENPDQFADAF
KATG_ACICJ        AWQWVAKD--AGDVIPDAFDAAKKHRPTMLTTDLSMRMDPAYEKISRRFHQNPDEFADAF
KATG2_SHEFN       AIQWIPTDESLHKAVPDAHVKGKFHAPVMTTADLALKYDPEYRKIAERFLADPEEYRLAF
KATG_SHELP        AIQWIPTDESVHKAVPDAHVKGKFHAPVMTTADLALKYDPEYRKIAERFLADPEEYRLAF
KATG_ALTMD        AIQWVPTDESLHTSVPDAHVEGKKNPPVMTTADLALKYDPEYRKIAERFLADPKEYQTAF
KATG_COLP3        AKQWIPDNKAAANLVPDAHIPNKRHAPIMFTTDIALKEDPQFRKIVERFRADPTQFDLAF
KATG_SHEWM        AIQWIPDTDTAANLVPDAHDPTKRHAPIMFTTDIAIKEDPKFRAIAESFRKSPDKYELAF
KATG2_SHEAM       HIQWIPANGAGDNLVPDAHVAGKRHAPIMFTTDIALKEDPSYREITSRFRKDPKAFELAF
KATG2_SHEON       HIQWTPADGKAANLVPDAHLPDKRHAPIMFTSDIALKADPIYREITTRFLKNPQEFELAF
KATG2_CELJU       AVQWIPKDGQAANLVPDAHDKTKRHAPIMFTTDLALKEDPEYRKISLRFKENPKEFELAF
KATG2_IDILO       AIQWIPVDGQASNLVPDAHVEGKRHAPIMFTTDLSLKEDPEYRKIAKRFHEDPKEFELAF
KATG_PSEA6        ATQWIPKDNAGANLVPDAHVKSKRHAPIMFTTDLALKEDPQYRKIAERFHANPKEFELAF
KATG_LEPBP        AIQWVPKDGAGANMVPDAHDKSLRHAPIMFTTDLALKFDPSYKVIAKRFQENPKEFELAF
KATG_NOVAD        AIQWVPKED--ATFVPDAHVKDKLHKPIMFTTDLALKTDPAYRKITTKFRQNPDAFADAF
KATG2_BURVG       AHQWMPKDAQS--IVPDAHDPSKLHPLMMFTTDIALKVDPAYSKIAKRFEEHPDEFKLAF
KATG_GRABC        AVQWKPKDASADQLVPDAFDASKRHPPMMFTTDIALKTDPSYRKIALSFQKDPEKFKAAF
KATG_ECOLX        AYQWKPKKAAN--IVQDAHDPSVLHPLMMFTTDIALKVDPEYKKITTRFLNDPKAFEQAF
KATG_YERPE        AWQWKPKNAAN--VVPDATDPTKFHPLMMFTTDIALKVDPEYKKITTRFLENPEEFKMAF
KATG_FRATT        AHQWTPTNAKPENMVPDAHKPGVKHKPIMFTTDLALKEDDGFNKYTQEFYNNPEEFKEEF
KATG_SACD2        AKQWVPKGGAATNMVPDAHDSSKRHAPIMLTTDLALKEDPAYRKITQRWLEDPEEFTRAF
KATG2_LEGPA       AIQWVPENSNASSMVPDAFDPSKRHAPVMLTTDLALKFDPVYSKIAKRFLDNPKEFDDAF
KATG2_HALMA       AWQWAPKSEELKNSVPDAHDPDEKQTPMMLTTDIALKRDPDYREVMETFQENPMEFGMNF
KATG1_HALMA       AWQWTPTDEALANTVPDAHDPSEKQTPMMLTTDIALKRDPDYREVMERFQENPMEFGINF
KATG_HALSA        AWQWTTKSGELNESAPGVQDPTDTEDVMMLTTDVALKDDPDYREVLETFQENPREFQQSF
KATG_NATPD        AWQWTTESGELDAAAPSVDGSSEKEDVMMLTTDVALKRDPDYREVLERFQENPDEFQEAF
KATG_SALRD        AWQWRPKSDELKGVVPDAHDASETVDPMMLTTDVALKRDPDYREIIEDFRENPDAFEDAF
KATG_METRJ        ALQWTPKDPD-APKTPDAHVAGQMHPLMMMTSDIALKVDPDYRKVCEKFLNDFDAFTQAF
KATG_PSELT        KNQWVAKNAP--EMIPDPFDPNKKHKPRMLTADLALKFDPIYSKIAKKFLENPEEFEKAF
KATG_ARCFU        KNQWVAKDAP--EIIPDAHDPNKKHRPRMLTADLALRFDPEFSKIARRFLENPEEFEKAF
B5Y4Y9_PHATC      RHQWRPTDKSTFEMVPDAHEKGKKNPPMMFTTDISLKIDPIYGPISRHFYHHPDEFSAAF
B8CF21_THAPS      ATQWIPRRGSGVADVPDAHDASVKHLPIMFTTDLALRYDPIYGPISQRFHLNPHEFTDAF
KATG3_MYCS2       MWQWVPRNGAGAGTVPDPYDPSRTHAPTMLTTDLALQEDPRYRVIALRFLENPDEFADTF
KATG_MYCGI        AWQFEAKNAEA--TIPDPFGG-PPRKPTMLVTDVAMREDPIYGQITRRWLDHPEEMDAAF
KATG1_MYCVP       AWQFEAKDAEA--IIPDPFGG-PPRKPTMLVTDVSMRVDPIYGPITRRWLDHPEEMNEAF
KATG_MYCSS        AWQFEAKNAEA--TIPDPFGG-PPRKPTMLVTDVSMREDPIYGQITRRWLDHPEEMDEAF
KATG1_MYCFO       AWQFEAKDAEA--IIPDPFGG-PPRKPTMLVTDISMRVDPIYGPITRRWLEHPEELNEAF
KATG_MYCIT        AWQFTAKDGAGAGTIPDPFGG-AGRAPTMLVTDISLRESPIYADITRRWLDHPEELADAF
KATG_MYCUA        AWQFTAKDGAGAGTIPDPFGG-PGRAPTMLVTDISMREDPIYRRITQRWLEHPEELTEAF
KATG2_MYCS2       AWQFTAKDGAGAGTIPDPFGG-PGRNPTMLVTDISMRVDPIYGKITRRWLDHPEELSEAF
KATG_RHOJR        AWQWTAKDGAGAGTIPDPFDSSAGRAPTMLTTDLSLRIDPAYEKITRRWLDHPEEFAEEF
KATG_NOCSJ        ANQWRPKNGAGADMVPDAHDPSKRREPRMLTSDLALRFDPEYAKISSRFKDHPEEFALAF
KATG_SALTO        AKQWVAKD--AEAIIPDAYDSTKKHKPTMLTTDLSLRVDPAYERISRRFLENPDEFALAF
KATG1_CUPPJ       AKQWKPKNPEANDTVPDAHGASRRHSPTMLTTDLSLRMDPIYGPIAKRFHDNPDQLEDAF
KATG_FRACC        ANQWKPKDGAGAGTVPDAHDAAKSHAPTMLTTDLALRFDPIYEPISRRFLENPSAFADAF
KATG_FRASN        AYQWKPKGGAGAGTVPDAHDAAKSHAPTMLTTDLALRFDPVYEPISRRFLEHPDELADAF
KATG_STRCO        ANQWVAKD--APEIIPDAHDPAKKHRPRMLTTDLSLRLDPIYGPISRRFYENPEEFADAF
KATG_STRRE        AHQWVAKN--APEIIPDAHDPSKKHRPRMLTTDLSLRFDPIYEPISRRFYENPEEFADAF
KATG_STRGG        AHQWIAKD--AEATIPDAHDASKKQKPQMLTTDLSLRFDPAYEQISRRFHENPEEFADAF
KATG_SACEN        GWQWRPKDGAGEGTVPDAHDPSKKIAPNMLTTDLSLKVDPIYEPISRRFWENPQEFADAF
KATG2_MYCFO       ANQWKPKDNGWANSWPMAQGTGKTH-PSMLTTDLSMRFDPIYGEITRRWLDHPEELAEEY
KATG2_MYCVP       ANQWRPKDNGWANSVPMAQGTGKTH-PAMLTTDLSMRMDPIYGEITRRWLDHPEELAEEY
KATG1_MYCS2       ANQWKPKDNGWANSVPLAHEDGKTH-PSMLTSDLALRVDPIYEQITRRWLDHPEELAEEF
KATG_MYCA9        AHQWKPKDGGWANSVPMAQGTGKTH-PSMLTTDLSMRFDPIYGQITKRWLDHPEELADAY
KATG_MYCTU        AWQYTAKDGAGAGTIPDPFGGPGRS-PTMLATDLSLRVDPIYERITRRWLEHPEELADEF
KATG_NOCFA        ANQWVAKDAQPIIPDPFDPAK-KRL-PTMLTTDLSLRVDPEMEVISRRFKDNPDEFADAF
KATG_GLOVI        AHQWTPKNPEAASTVPDAHDPHKRHAPMMATTDLAMRADPAYEKISRRFYDNPDQLAHAF
KATG_KORVE        ANQWTPKNGAGKDTVPDAHDKTKRHAPFMATTDISLKVDPIYGPISKRFHEHPQEFADAF
KATG_CAUSK        AFQWTPKDPEAGPKAPDAHDPSRQVAPMMLTTDLALRLDPNYGPISKRFHENPDQFQDAF
KATG_MARMS        AWQWTPKDGAAANSVPDAHDSSKRHAPIMFTSDLALRDDPIYAPISKRFYENPDQLADAF
KATG1_ALKMQ       AWQWVPTDPTAADSVPDAHDPSKRHAPMMTTADLALRMDPIYGPIAKGFRENPEAFADAF
KATG_DESHY        AWQWVPTDPAAADTVQDAHDPAKRHAPMMTTADLSLRMDPIFGPIAKRFRDNPEEFADAF
KATG_PELCD        AWQWLAKDVDEEDMIVGAHDPSKKFRPMMTTADLSLRFDPIYEPIARRYLENPEEFADAF
KATG_PELPD        ANQWLAKDVDEEDMVVDAHDPSKKHRPMMTTADLSLRFDPIYEPIARDYQQNPEKFADAF
KATG_GEOLS        AHQWLAKDVADEDMVVDAHDPAKKRRPMMTTADLSLRFDPAYEKIARRYLANPDEFADAF
KATG_GEOSL        ANQWLAKDVADEDMVVDAHDPSKKRRPMMTTADLSLRFDPIYEPIARRYLANPEEFADAF
KATG_DESOH        AYQWLAMDVDEEDMVIDAHDPSKKHRPMMTTADLSLRFDPVLGPIAKRFSKNPKAFADAF
KATG_CLOBB        AYQWLAKNVDEEDMVIDAEDSTKKHRPMMTTADLGLRYDPIYEPIARNYLKNPEKFAHDF
KATG_PROA2        AWQWKPKDVAEEDLAPAAHDPSKRVPTMMTTADLAMRMDPIYGPISQRYYEHPDQFADAF
KATG_AZOSB        AHQWVAQNVKPEDMIPDAHDPSKKHPPMMTTADLSLRFDPIYEPIARRFHKNPADFADAF
KATG_DECAR        AKQWVAKDCKPEHLIPDAHDPSKKHPPMMTTADLAMRFDPIYGPISRRFHQDPAAFADAF
KATG_SYNSC        AWQWVAKDVKPEHMIPDAHVPGRASAPIMTTADLSLRHDPLMEPVARRFHQDQDAFADAF
KATG_SYNPW        AWQWTAKDVKPEHMIPDAHVAGKSSAPIMTTADLSLRHDAIMEPVARRFHLDQEAFADAF
KATG_SYNR3        AWQWHPKDVKAEHMIPDAHVPGRSAPPMMTTADLSLRFDPVYEPIARRFLGDPQAFGNAF
KATG_PSYIN        AWQWEPINIKEEHRPVDVEDASIRLTPIMTDADMAMKMDPEYRKISDRFHQDQDYFSEVF
KATG_SYNP2        AWQWEPINIKEEDKPVDVEDPSIRLSPIMTDADMAMKMDPDYRQISERFYQDPAYFAETF
KATG_SYNP6        AWQWEPINPREEDLPVDVEDPSIRRNLVMTDADMAMKMDPEYRKISERFYQDPAYFADVF
KATG1_VIBPA       AWQWEPIDIKEEDKPVDPENPNVRHNPIMTDADMAMKMDPEYRKISERFHSDPAYFADTF
KATG_SHEDO        AWQWQPINIKEEDKPRDVEDPSISTMPMMTDADMAMKMDPEYRKISEHFHRDPEYFSKVF
KATG_SHEHH        AWQWEPINIKEEDKPVDVEDLTQRYNPIMTDADMAMKLDPDYQIISARFDKDPEYFSDVF
KATG_AERS4        AWQWEPVNIREEDKPVDVEDPAIRHNPIMTDADMALKFDPEYRKIAERFRADPAAFSDAF
KATG_ALKEH        AWQWQPVDIKEEDMPVDVEDPSIRHMPMMTDADMAMKMDPEYRKYAERFQKDPEYFNEVF
KATG_HALHL        AWQWEPVDIKEEDKPVDVEDPSIRLNPIMTDADMAMKMDPAYRKISERFYNDPAYFDEVF
KATG_PECAS        ASQWEPVSIKEEDKPVDVEDPSIRYNPMMTDADMALKVDPEYRKISERFSRDQAYFSEVF
KATG_RHOS5        AWQWEPIDIREEDKPVDVEDPSIRYNPIMTDADMAMKMDPIYRPIAERFHRDPAYFSDVF
KATG1_LEGPL       AWQWEPIHIKEEDKPVDVEDPAIRRNPIMTDADMAIKMDPVYRKIAERFYKDPDYFAEVF
KATG_EDWTA        AWQWVPIQIAEEDKPVDVEDPSIRLLPIMTDADMAMKVDPTYRQIAERFRQDPAYFSDVF
KATG_LEPCP        AWQWEPVGIKEDDKPVDVEDPSIRLNPIMTDADMAMKMDPAYRRISERFAADQAYFSEVF
KATG_VIBCH        AWQWEPVNIKEEDKPVDVEDPSIRYNPMMTDADMALKIDPEYRKISERFYKDPAYFSEVF
KATG_VIBVY        AWQWEPVNIKEEDKPVDVEDPTIRHNPIMTDADMALKLDPEYRKISERFHKDPAYFSETF
KATG_POLAQ        AHQYEPINIKEEDKPVDVEDASIRCMPMMTDADIALKMDPEYRKISERFSKDQAYFSETF
KATG2_VIBPA       AWQWEPIDIEEQDKPVDVEDGSKRYNPIMTDADMALKMDPEYRKISERFQQDPAYFEDMF
KATG1_SHEAM       AWQWEPVNIREEDKPVDVEDPNIRSNPMMTDADMALKMDPDYRRIAERFFHDPDYFADTF
KATG_AGRFC        ASQWAPITIAEEDKPVDVEDASIRTIPMMTDADMALKVDPIYREISLKFKDDQDHFSDVF
KATG_PARDP        ASQWEPITIAEEDKPADVEDPSIRHMPMMTDADMALKVDPIYREISLRFMNDFEAFSDAF
KATG_CHRSD        AWQWEPVDIAEEDMPVDVEDPSIRRMPIMTDADMAMKVDPVYNEICRKFMDDPEYFSETF
KATG_MARHV        AWQWEPINMKEEDKPLDASDPSKRHNPIMTDADMAMKMDPKYRAICEKFMADPEYFKDCF
KATG_HYPNA        ASQWRPINIKEEDMPVDPTDPTKRVMPMMTDADMAMKMDPAYNAICQKFMADQAYFSDTF
KATG_MARMM        AQQWQPINIKPEHMPVDASDPSQRRMPIMTDADMAMKMDPAYRAICEKFMADPAYFKDTF
KATG_PARL1        AWQWQPIDIKEEDMPVDVEDPSIRRMPIMTDADMAMKVDPIYREICERFRKDPEYFKDTF
KATG_DINSH        AFQWEPVNIAEEDMVPDATDPSIKHNPIMTDADMAMKVDPIYREICERFHKDPDYLADTF
KATG_ROSDO        AWQWEPIDIKEEDMPVDPTDPSKRHQPMMTDADMAMKVDPIYNEICQKFMADPEYFADVF
F2I1Y2_PELSM      AWQWEPIDLEDEKKPVDLADPTKKARLMFTDADMAMAMDPEYRKISEKFYKDPKFFEDSF
KATG1_SHEON       AWQWEPINIKEEDKVISVGDPAKKFNPIMTDADMAMKIDPEYRKISERFYQDPAYFSEVF
KATG_SHESW        AWQWEPINIKEEDKPVDVEDPTIRHNPIMTDADMAMKMDPEYRKISEKFYKDPAYFSEVF
KATG1_SHEFN       AWQWQPINIKEEHKPVDVEDPSIRLSPIMTDADMAMKMDPEYRKISDRFYQDPAYFSEVF
KATG1_CELJU       AWQWKPVSIKEEDMPVDVEDPSIRCTPLMTDADMAMKMDPEYRKISERFYSDPAYFSEVF
KATG_SYNY3        AWQWEPVNIKEEDKPVDVEDPNIRHNPIMTDADMAMIKDPIYRQISERFYREPDYFAEVF
KATG1_IDILO       AWQWEPIDIKEEDKPVDVEDPSIRHNPIMTDADMAMKMDPDYRKIAEKFYKDPEYFADVF
KATG_VIBCB        AAQWEPIDIKEEDMPVDVEDSSIRHNPMMTDADMALKYDPEYRKIAERFRDNPKEFEDCF
KATG_BACHD        AYQWQAVDPDEKDLAPDAEDPSVKVPTVMLTTDLALRHDPEYEKISRRFHKNPDEFADAF
KATG_GEOKA        AYQWEAVNLREEDLAPDAEDPNVKVPPMMMTTDLALRFDPEYEKIARRFYENPEEFADAF
KATG_ERYLH        AYQWTPVDPEEADMAPDARDPSKKVPTIMTTADMALKRDPDYRKISERFRDDQAALDDAF
KATG_SPHAL        AWQWQPINQKEEDMAPAAWDPGIKVPTMMTTADMALKRDPAYRAISERFRNDHEAFKDAF
KATG_PHEZH        AKQWQPVNPKPEDLAPGAHSPDRRVPTMMTTADLAFAMDPEYRKIAERFRDNPDQFADAF
KATG_ARCB4        AWQWIPKNPKEEHLAPAAHDKTKKVTTIMTTADMAMKMDPIYAKISKRFHENPQEFADAF
KATG_RUEPO        ANIWLATNVEDEDMVEDAFDPSKKHRPMMTTADLSLRYHPKLLPHAKRFAEDPAAFADAF
KATG_RUEST        AWIWHAKDLKEDDHAPEVDGSGKKVPIMMTTADMAMKMDPIYGPISKRFHENPEEFAEAF
KATG_JANSC        AHQWRPVDHEN-DQAPQVDGNG-TVPIMMTTADMAMRMDPAYEKISRDFHANPDKFADAF
                     : .                      :  :*: :            :          :

KATG_ECOLI        ARAWFKLTHRDMGPKSRYIGPEVP-KEDLIWQDPLPQPIYN-PTEQDIIDLKFAIADS--
KATG_SALTY        ARAWFKLTHRDMGPKARYIGPEVP-KEDLIWQDPLPQPLYQ-PTQEDIINLKAAIAAS--
KATG_ENT38        ARAWYKLTHRDMGPKARYIGPEVP-KEDLIWQDPLPQAVFN-PSQEDIASLKAEIVAS--
KATG_CROS8        ARAWYKLTHRDMGPKARYIGPEVP-KEDLIWQDPLPAAIYQ-PTQADIDSLKAEIASA--
KATG_ERWT9        ARAWFKLTHRDMGPKARYLGPEVP-KEDLIWQDPLPAPVHQ-PSPGEINDVKAQIAQS--
KATG_KLEP7        ARAWFKLTHRDMGPKSRYLGPEVP-KEDLIWQDPLPAATHQ-PSAEDIASLKTAIAGA--
KATG_ACIBC        ARAWFKLTHRDMGPKARYLGPEVP-AEDLIWQDPLPAASAT-PSSASIADAKAKIVAL--
KATG_PSEMY        ARAWYKLTHRDMGPKARYLGPEVP-KEDLIWQDPLPAAIHN-PSAADIADLKARIAAS--
KATG_METPP        ARAWFKLTHRDMGPKVRYLGPEVP-KEELLWQDPLPPATLPAPNAADVAELKAKIAAS--
KATG_JANMA        ARAWFKLTHRDMGPRSRYLGPEVP-KEELIWQDPIPEVDYKLVDAADVTALKAKLLTS--
KATG_AZOC5        ARAWFKLTHRDLGPRSRYLGPEVP-REVLLWQDPVPAVDHPLIDDADAAALKAKVLAS--
KATG_RALPJ        ARAWFKLTHRDLGPKSRYLGPEVP-REDLIWQDPLPTATHKP-TEADIADLKAKIAAS--
KATG_ACIAC        ARAWFKLTHRDMGPRARYLGPEVP-KEELVWQDPIPAVTHDLVDAADVAALKARVLAS--
KATG_PARPJ        ARAWFKLTHRDMGPRARYLGPEVP-AEELIWQDPIPAVNHPLVDEQDIASLKQKILAS--
KATG_PARXL        ARAWFKLTHRDMGPRARYLGPEVP-AEELNWQDPIPALDHPLVNEQDIASLKQKILAS--
KATG_CUPNH        ARAWFKLIHRDMGPRARYLGPEVP-AEELLWQDPIPAVDHPLVNEQDVAALKQKILAS--
KATG2_BURCJ       ARAWFKLTHRDMGPRARYLGPDVP-TEELIWQDPIPAVDHVLVDDTDVAPLKETILAS--
KATG_BORA1        ARAWFKLTHRDMGPRVRYLGPEVP-AEDLIWQDPIPKVNHPLVDDQDVAALKQKVLAS--
KATG_HERSE        ARAWFKLTHRDLGPRSRYLGPEVP-AEELIWQDPLPQAEGAQIDAADVAALKAKVLGS--
KATG_XANCP        ARAWFKLTHRDMGPRARYLGADVP-AEELLWQDPIPALNHALIDAQDAAALKQTVLSS--
KATG_XANC5        ARAWFKLTHRDMGPRSRYLGADVP-AEELVWQDPVPAVDHPLVDAQDAAALKQTILAS--
KATG_XYLFA        ARAWFKLMHRDMGPRVRYLGPEVP-VEELIWQDPVPKVSHVLVDAQDLLALKQKISAS--
KATG1_MAGO7       ARAWFKLLHRDMGPRSRWLGPEVP-KETLLWEDPIPTPDHPIIDGSDVDSLKKAILAT--
KATG_NEUCR        ARAWFKLLHRDMGPRTRWIGPEVP-SEILPWEDYIPPVDYQIIDDNDIAALKKEILAT--
C7ZHZ3_NECH7      AKAWFKLTHRDMGPVSRYLGPEVP-KESFLWQDPVPEVDFKLVDEGDVAAIKNEILKS--
KATG2_MAGO7       AKAWFKLLHRDLGPTTRYLGPEVP-KESFIWQDPLPAREGDLIDDADVDKLKAAILSTD-
C7ZIK0_NECH7      GRAWFKLLHRDLGPVSRYQGPEVP-KEKFTWQDPLPERKGDVIGDDDIATLKAELLAAK-
KATG_FLAJ1        SRAWFKLTHRDMGPRARYLGPDVP-QEVLLWQDPIPEVNHKLIDENDIKQLKEKILNS--
KATG_METI4        ARAWFKLTHRDMGPRSRYLGPEVP-KEDLLWQDPIPPVDHPLIETDDMNSLKAKILES--
KATG_PSEE4        ARAWYKLIHRDMGPLARYLGPEMP-NEELLWQDPLPKAG-PQPSEADIAAHKAKVLAS--
KATG_PSEPF        ARAWYKLIHRDMGPLSRYLGPELP-QEELLWQDPIPEATHPLVDDSDIRALKGKILAS--
KATG_PSESM        ARAWFKLTHRDMGPLARYLGPETP-TEELLWQDPIPDVTHPLVDDQDVAALKGKILDS--
KATG2_BURCC       ARAWFKLTHRDMGPRVRYLGPEVP-SEELLWQDPIPMPDHPQVDEQDVSALKAKVLAS--
KATG2_CUPPJ       ARAWFKLTHRDMGPRSRYLGPEVP-AEELIWQDPIPAVDHVLIDEQDVAALKGKILAT--
KATG_CUPMC        ARAWFKLTHRDMGPRARYLGPEVP-KEELLWQDPIPPVDHPLIDAKDVAALKAKVQAS--
KATG_PSEF5        SRAWFKLTHRDMGPRARYLGPEVP-AEELIWQDPIPAVNHPLIDAQDIQQLKGQILNS--
KATG_BURL3        ARAWFKLTHRDMGPRARYLGPDVP-AEHLLWQDPIPAVDHKLIDDADVAALKAKVLAS--
KATG1_BURVG       ARAWFKLTHRDMGPRSRYLGPEVP-AEELLWQDPIPAVDHPLIDDADAAALKAKILAT--
KATG_BURM1        ARAWFKLTHRDMGPRSRYLGPDVP-AEELLWQDPVPAVDHPLIDEADIAALKAKVLAS--
KATG_BURPS        ARAWFKLTHRDMGPRARYLGPEVP-AEVLLWQDPIPAVDHPLIDAADAAELKAKVLAS--
KATG_SERP5        SRAWYKLTHRDMGPRARYLGPEVP-AEELIWQDPIPAVDHQLINDQDIADLKTSILTS--
KATG_RALSO        ARAWFKLTHRDMGPRARYLGPEVP-AEALIWQDPIPAVDHKLIDTQDIAALKARILAS--
KATG_HAHCH        ARAWFKLTHRDMGPRARYLGPEVP-AEELIWQDPIPAVDHPLINDQDISALKSKILTS--
KATG_SHEB8        AKAWYKLTHRDMGPCTRYLGPEVP-AEAFLWQDPIPAVDHPLVDEQDVTDLKLKIIGS--
KATG_METB6        ARAWFKLTHRDMGPRTRYLGPEVP-KEALIWQDPIPAVNHTLIGPREITFLKRKILAS--
KATG_METAC        ARAWFKLTHRDMGPRARYLGPEVP-AEELIWQDPIPAVNHELIDEKDIAFLKDRILAS--
KATG_METHJ        ARAWFKLTHRDMGPKTRYLGPEVP-DEDLIWQDPIPAINHPLIDDQDIALLKSRILAS--
KATG_CHLCH        ARAWFKLTHRDMGPRSRYRGAEVP-VEELIWQDTIPALDHELIGADEIAALKATILAS--
KATG_SYMTH        ARAWFKLTHRDLGPRSRYLGPEVP-EEEFIWQDPLPKRDYDLIDEGDIAELKKRIQAS--
KATG_FLAPJ        ARAWFKLTHRDMGPVARYLGSDVP-KEVLIWQDPIPAVNHQLIDDNDITILKAKILDA--
KATG_GRAFK        SRAWFKLTHRDMGPIERYLGPEVP-KEELLWQDPIPKVDHEIINDSDIASLKNKILNT--
KATG_ACAM1        ARAWFKLTHRDMGPRSRYLGPEVP-EEELIWQDPVPAVNHELINEQDIATLKSQILAT--
KATG_POLSJ        ARAWFKLTHRDMGPLSRYLGPLVP-KEQLLWQDPIPAVDHKLVDEQDIAALKTRILAS--
KATG_BRASO        ARAWFKLTHRDMGPKARYLGPLVP-KEELIWQDPVPALDHPVVDDKDVAALKAKIL----
KATG_RHILO        ARAWYKLTHRDMGPVARYLGPLVP-KEELPWQDVIPVVDHVLIDEQDAEALKAEIL----
KATG_BEII9        ARAWFKLTHRDMGPRARYLGPLVP-EEELIWQDPVPAVDHPLVDEADVVALKEKIL----
KATG_CAUVC        ARAWFKLTHRDMGPIGRYLGPLVP-KEELIWQDPIPAVDHPLADDKDIAALKAKIL----
KATG_PSEU5        ARAWFKLTHRDMGPIARYLGPLVP-KEQLIWQDPIPERDHPVIDDADIASLKQKIL----
KATG_RHOP5        ARAWYKLTHRDMGPVPRYLGPEVP-KEVLLWQDPVPAVDHELVSEQDIAALKAKIL----
KATG_RHOPT        ARAWFKLTHRDMGPRERYLGPEVP-KEELIWQDPIPAVNHELVGEADIEALKAKIL----
KATG_RHOPS        ARAWFKLTHRDMGPKVRYRGKLVP-KEDLIWQDPIPPVDHELVSAKDIADLKARIL----
KATG_RHOPB        ARAWFKLTHRDMGPVARYLGPEVP-KETLLWQDPIPPVDHELINDADVEALKAKIL----
KATG_SOLUE        ARAWFKLTHRDMGPIARYLGPLVP-KETLLWQDPIPPVDHPLIDENDASALKAKIL----
KATG_CHESB        ARAWFKLTHRDMGPKVRYLGPLVP-KETLIWQDPIPEVDHVLVDDQDIAGLKAKIL----
KATG_NITHX        ARAWYKLTHRDMGPRERYLGPLVP-KETLIWQDPIPAVDHALVDDKDIAELKAKVL----
KATG_NITWN        ARAWFKLTHRDMGPRDRYLGPLVP-KEVMIWQDPIPAVDHELVDDNDIADLKAKIL----
KATG_RHIL3        ARAWFKLTHRDMGPKVRYLGPEVP-AEDLIWQDVIPAVDHPLVDDKDIADLKEKVL----
KATG_SINMW        ARAWFKLTHRDMGPKVRYLGPEVP-AEDLIWQDVIPPVDHELVDDADVAGLKAKIL----
KATG_ACICJ        ARAWFKLTHRDMGPVSRYLGKLVP-AEHLIWQDPVPAVDHKLIDAADIAALKAKLL----
KATG2_SHEFN       AKAWYKLTHRDMGPSRNFLGKEVP-KESLIWQDPIDDKTQSNIDADGVQELKAQIL----
KATG_SHELP        AKAWYKLTHRDMGPARNFLGKEVP-QGNFIWQDPIDDKTQSRLSAGDIKQLKKAIS----
KATG_ALTMD        AKAWFKLTHRDMGPKERYLGNDIP-RENFIWQDPVPKADYKTISDKDVKKLKADIL----
KATG_COLP3        AKAWFKLTHRDMGPRARYVGAEVP-SEVLMWQDPIPAINYQLITDKDIKQLKKQIT----
KATG_SHEWM        AKAWFKLNHRDLGPRSRYLGNEVP-KEVLVWQDPIPELNHPVVNDADIAKLKSEIL----
KATG2_SHEAM       AKAWFKLTHRDMGPKTRYLGSDVP-AEALIWQDPIPALDHAVIDTNDIAALKSAIL----
KATG2_SHEON       AKAWFKLTHRDLGPKARYLGADVP-AEALIWQDPIPALDHPLIDNADIKALGNKIL----
KATG2_CELJU       AKAWFKLTHRDMGPRVRYLGNEVP-GEILLWQDPVPEVDHPLIDAADITKLKSSLL----
KATG2_IDILO       AKAWFKLTHRDMGPKQSYLGDMAP-QEDLLWQDPIPAVDFELINENDVEQLKVAIL----
KATG_PSEA6        SKAWFKLTHRDMGPRARYVGDESP-TDDFLWQDPIPSVDYSLIDKRDIQHLKTKLL----
KATG_LEPBP        AKAWFKLTHRDMGPLTRYIGKDLP-KEPLIWQDPVPAVNHKLVGPKEIESLKGKIL----
KATG_NOVAD        ARAWFKLTHRDMGPRWRYLGAMVP-AEELIWQDPVPKATYAMIDAADVSALKGRIL----
KATG2_BURVG       AKAWFKLTHRDLGPKARYLGKDVP-KVDLIWQDPLPVAGYQTIGAADIADLKSRIL----
KATG_GRABC        ARAWFKLVHRDMGPRSRYFGPEVP-KEDLLWQDPLPAITYKAVDEADITDLKQKIL----
KATG_ECOLX        ARAWFKLTHRDMGPAARYLGNEVP-AESFIWQDPLPAADYTMIDGKDIKSLKEQVM----
KATG_YERPE        ARAWFKLTHRDMGPAARYLGDEVP-KETFIWQDPLPAANYKMIDSADISELKDKIL----
KATG_FRATT        AKAWFKLTHRDMGPKSRYIGPWIP-EQNFIWQDPVPAADYKQVSTQDIAQLEQDII----
KATG_SACD2        ARAWFKLTHRDMGPVSRYKGELVP-SDTFVWQDPVPVADYKQIGERDVKKLKAAIL----
KATG2_LEGPA       ARAWFKLIHRDMGPRSRYLGSLVP-KEIMIWQDPVPPVDYKLVDANDIANLKGKIL----
KATG2_HALMA       AKAWYKLTHRDMGPPERFLGPEVP-DEEMIWQDPLPDADYDLIGDEEIAELKEEIL----
KATG1_HALMA       ARAWYKLIHRDMGPPERFLGPDAP-DEEMIWQDPVPDVDHDLIGDEEVAELKTDIL----
KATG_HALSA        SKAWYKLIHRDMGPSERFLGPEVP-EETMIWQDPLPDADYDLVDDEAVAALKSELL----
KATG_NATPD        AKAWYKLIHRDMGPPERFLGPEVP-EETLIWQDPLPDADYDSIGDEEVAELKEALL----
KATG_SALRD        ARAWFKLLHRDMGPKERYLGPEVP-EEDLIWQDPVPDADHDLIGDEEIAELKEAIL----
KATG_METRJ        SKAWYKLTHRDMGPKHRYLGPEAVIEDGLLWQDPLPERDYALVGEAEIAALKQAIA----
KATG_PSELT        AWAWFKLTHRDMGPKSCYIGPYVP-REEFIWQDPLPKRDYELIDEEDIEYLKKQIL----
KATG_ARCFU        AIAWYKLTHRDMGPKDCYIGKYVP-EETFVWQDPLPRRDYELVDEKDVEELKRRIL----
B5Y4Y9_PHATC      AKAWYKLLHRDMGPVSRCLG-SDVP-EPQLWQDPIPSLDHELIDDEDVAKLKKQILGSTG
B8CF21_THAPS      KRAWYKLCHRDMGPLQRHLG-QWLPTEDLIWLDPIPSSNGNTINVNDVSILKSKI-----
KATG3_MYCS2       ARAWFKLTHIDMGPIQRYLGPLVP-TERMIWQDPVPHVDHELADADDVAALKREIL----
KATG_MYCGI        AKAWFKLMHRDMGPVSRYLGPWVP-AEQEIWQDPVPAVDHALIDESDIAALKSQVL----
KATG1_MYCVP       AKAWYKLMHRDMGPVSRYLGPWV--AEPQLWQDPVPAVDHELIDESDIAALKAAVL----
KATG_MYCSS        AKAWYKLMHRDMGPISRYLGPWV--AEPEIWQDPVPDVDHELVDESDIASLKSKVL----
KATG1_MYCFO       AKAWYKLLHRDMGPISRYLGPWI--PEPQLWQDPVPDVDHPLVDEQDIAALKEKLL----
KATG_MYCIT        AKAWYKLLHRDMGPISRYLGPWV--AEPQLWQDPVPAVDHELVDDNDVAALKKKVL----
KATG_MYCUA        AKAWYKLLHRDMGPVSRYLGPWV--AEPQLWQDPVPDVDHELVDAKDVAALKSKVL----
KATG2_MYCS2       AKAWYKLLHRDMGPISRYLGPWV--AEPQLWQDPVPAVDHPLVDDQDIAALKSTVL----
KATG_RHOJR        AKAWYKLLHRDMGPVTRYLGPWV--PEAQLWQDPVPAVDHQLIGDSEIAALKGKIL----
KATG_NOCSJ        AKAWYKLLHRDLGPIARYLGPLV--GETQIWQDPVPAVDHELVSDDDVAALKAKVL----
KATG_SALTO        AKAWYKLLHRDMGPVSRFLGPWV--PQTQLWQDPVPAVDHELVGAADIAALKAKVL----
KATG1_CUPPJ       AKAWFKLLHRDMGPRSRYLGPWI--PEAQLWQDPIPPVDHELVSEQDIDALKRTIL----
KATG_FRACC        ARAWFKLTHRDLGPVARYLGPEVP-TETLLWQDPLPAVAHELIDAADVATLKGQIL----
KATG_FRASN        ARAWFKLTHRDMGPVARYLGPEVP-AETLLWQDPVPAVDHELVDAADVAALKVRVL----
KATG_STRCO        ARAWFKLTHRDMGPKSLYLGPEVP-EETLIWQDPLPEPEGEVIDAEDVATLKTKLL----
KATG_STRRE        ARAWYKLTHRDMGPKSLYLGPEVP-EETLLWQDPLPEREGELIDDADIAILKTKLL----
KATG_STRGG        ARAWYKLTHRDMGPVQRYLGPEVP-SEVLLWQDPLPARTGEPLDAAEIAALKEQVL----
KATG_SACEN        ARAWFKLTHRDMGPADRYLGPEVP-SEELIWQDPIPKPDHELVGPAEIAELKGRIA----
KATG2_MYCFO       AKAWFKLIHRDMGPVTRYLGPLVP-KQTWLWQDIIPA-GKQLSDAD-VATLKAAIA----
KATG2_MYCVP       AKAWFKLLHRDMGPVQRYLGPLVP-TQTWLWQDIVPA-GKPLSDAD-VATLKGAIA----
KATG1_MYCS2       AKAWFKLLHRDMGPVTRYLGPEVP-KDTWLWQDNIPA-GNDLSDDE-VAKLKELIA----
KATG_MYCA9        AKAWYKLIHRDLGPLSRYLGPLVP-KETLPWQDVIPV-SETNVGADDVAELKKQVL----
KATG_MYCTU        AKAWYKLIHRDMGPVARYLGPLVP-KQTLLWQDPVPAVSHDLVGEAEIASLKSQIR----
KATG_NOCFA        ARAWFKLTHRDLGPVTRYLGPEVP-SEVQLWQDPIPAVDHELVDAADIAALKEQIL----
KATG_GLOVI        AEAWYKLTHRDMGPYARLLGPEVP-SEPRIWQDPVPASDHPLIDDADIAELKAQIL----
KATG_KORVE        AKAWYKLTHRDMGPLPRYLGKLVP-KEPQVWQDPVPAVDHELVNDSDVAALKAKLL----
KATG_CAUSK        ARAWFKLTHRDMGPKARYLGPLVP-QEELLWQDPLPEPQGPPIDANDIRELKAKVLAT--
KATG_MARMS        ARAWFKLTHRDMGPVARYLGPLVP-QEELVWQDPIPAVTYVTVNDQDILDLKAKIQAS--
KATG1_ALKMQ       GRAWFKLTHRDMGPRTRFLGPEVP-TEELIWQDPVPAVDFELIDEDDITGLKGKIIDS--
KATG_DESHY        ARAWFKLTHRDMGPRSRYLGPEVP-EEELIWQDPVPPVDHELIDEQDIADLKAKLLAS--
KATG_PELCD        ARAWFKLTHRDMGPRSRYLGSEVP-AEELIWQDPVPAVDHELIDAADIADLKVKILAS--
KATG_PELPD        ARAWFKLTHRDMGPRSRYLGAEVP-AEELIWQDPVPTVDHQLIDGQDIAALKDTILAS--
KATG_GEOLS        ARAWFKLTHRDMGPRSRYLGPEVP-AEELIWQDPVPAATHELINNSDVADLKVTILAT--
KATG_GEOSL        ARAWFKLTHRDMGPRSRYLGPDVP-AEELIWQDPVPAVTHQLIDRQDIAALKGTILAS--
KATG_DESOH        ARAWFKLTHRDMGPRSRYLGPEVP-KKELIWQDPVPAVNHKLIGARDIAALKREILAS--
KATG_CLOBB        ASAWFKLTHRDMGPISRYLGPEVP-KESFIWQDPIPLVKHKLITKKDITHIKKKILDS--
KATG_PROA2        ARAWFKLTHRDMGPHSRYLGAEVP-AEELIWQDPVPALDHDLIDAEEIAELKKRLLAS--
KATG_AZOSB        ARAWFKLTHRDMGPKSRYLGPEVP-AEDLIWQDPIPRLDHPLIDAADIATLKAMVLAS--
KATG_DECAR        ARAWFKLTHRDLGPKARYLGPEVP-AEDLVWQDPIPAVDHPLIEVTDVASLKAKLLAS--
KATG_SYNSC        ARAWFKLTHRDLGPRALYLGADVP-EEIQIWQDPVPALDHPLIGAVEIKALKQKLLAT--
KATG_SYNPW        ARAWFKLTHRDLGPRALYLGPDVP-EEVQIWQDPVPPVTHPLIDEAEISTLKQQILAS--
KATG_SYNR3        AQAWFKLTHRDLGPRSCYLGADVP-EAVMSWQDPLPTTSHPTIDAPAVDALKQELLNT--
KATG_PSYIN        ARAWFKLTHRDMGPKVRYIGPDVP-QEEQIWQDPVPAGS----TDYDIQAVKDKIAAS--
KATG_SYNP2        ARAWFKLTHRDMGPKSRYIGPDVP-QEDLLWQDPIPAGK----TDYDPQAVKDKIAAS--
KATG_SYNP6        ARAWFKLTHRDMGPKARYIGPDVP-QEDLIWQDPIPAGN----RNYDVQAVKDRIAAS--
KATG1_VIBPA       ARAWFKLTHRDMGPKARYIGPDVP-QEDLIWQDPVPNGN----ANYDIDAVKAKIAAS--
KATG_SHEDO        SRAWFKLTHRDMGPKVRYLGPDVP-VEDLLWQDPVPTGP----KDFNVAVVKKAIKET--
KATG_SHEHH        ARTWFKLTHRDMGPKTRYIGPDVP-AVDLLWQDPVPKGR----SDYDVEAVKAQIAAS--
KATG_AERS4        ARAWFKLTHRDLGPKTRYVGPYVP-AEDLIWQDPVPAGR----TDYDVAAVKASIAAS--
KATG_ALKEH        ARAWFKLIHRDMGPKTRYIGPEAP-DEDLIWQDPVPAGN----TGYDVDAVKAKIADS--
KATG_HALHL        ARAWFKLTHRDLGPRTRYIGPEAP-QEDLIWQDPVPAGR----TDYDVEALKAKIADS--
KATG_PECAS        ARAWFKLTHRDMGPKARYVGPDVP-QEDLLWQDPVPAGR----TDYDVDLVKARIAES--
KATG_RHOS5        ARAWFKLTHRDMGPKARYLGPDVP-QEDLIWQDPVPAGR----TDYDVAAVKARIAAS--
KATG1_LEGPL       ARAWFKLTHRDMGPKTRYIGPDVP-KEDLIWQDPVPAGN----RAYDIAAAKAKIAAS--
KATG_EDWTA        ARAWFKLTHRDLGPKSRYFGPDVP-QEALIWQDPVPAGR----SEYDVAAVKAKIAAS--
KATG_LEPCP        ARAWFKLTHRDLGPKSRYIGPEIP-AEDLLWQDPVPVGP----TAYDVGAVKSRIATS--
KATG_VIBCH        ARAWFKLTHRDMGPKARYFGPDVP-AEDLIWQDPVPAGR----KDYDVNAVKAKIAAS--
KATG_VIBVY        ARAWFKLTHRDMGPKARYFGPDVP-VEELIWQDPVPTGR----KDYDVDAVKAKIIAS--
KATG_POLAQ        AKAWFKLTHRDMGPKARYFGPDVP-KEELIWQDPIPSGP----KSYDIDAVKAKIKAS--
KATG2_VIBPA       ARAWFKLTHRDMGPKSCYLGPDVP-SEDLIWQDPTPAGK----TDYNVDLVKGKIEAS--
KATG1_SHEAM       ARAWFKLTHRDMGPKSRYFGPDVP-AEDLIWQDPVPKGN----SQYDPEAVKARIAGT--
KATG_AGRFC        ARAWFKLTHRDMGPKSRYVGPDVP-AEDLIWQDPIPAGS----TSYDVAAVKAKIAAS--
KATG_PARDP        ARAWFKLTHRDMGPKARYLGPDVP-AEDLVWQDPIPAGR----SDYDVAAVKARIAAS--
KATG_CHRSD        AKAWFKLTHRDLGPKARYIGPDVP-ADDLIWQDPIPAGS----IAYCEEVVKQKIAES--
KATG_MARHV        ARAWFKLTHRDLGPKARYIGPEAP-AEDLIWQDPVPAGS----TDYCEEVVKEKVADS--
KATG_HYPNA        ARAWFKLTHRDLGPRVRYIGPDAP-QEDLIWQDPVPAGS----KSYDVAAVKAKIADS--
KATG_MARMM        ARAWFKLTHRDMGPKDCYFGPDVP-SEELVWQDPVPAGP----TGYDVARVKSAIAAS--
KATG_PARL1        ARAWFKLTHRDMGPKVRYVGPEVP-AEDLIWQDPIPAGN----TSYDVGAVKAKIAAS--
KATG_DINSH        ARAWFKLTHRDMGPKANYYGPFVP-QEDLIWQDPIPEGP----TGYDVDALKAKIAES--
KATG_ROSDO        GRAWFKLTHRDMGPKACYIGPDVP-AEDLIWQDPIPAGS----TEYDVAAVKARIADS--
F2I1Y2_PELSM      ARAWFKLTHRTMGNKQNYIGPWAP-KEDLLWQGNVSTTK----KKYSVEKVKKMIAGS--
KATG1_SHEON       ARAWFKLTHRDLGPKSRYLGPEVP-SEELIWQDPIPSVDYRL-VASEIVELKAKLLAS--
KATG_SHESW        ARAWFKLTHRDLGPKSRYLGPEVP-AEDLIWQDPIPQVDYRL-SDDDITALKAKILAS--
KATG1_SHEFN       ARAWFKLTHRDLGPKSRYLGTDVP-AEELIWQDPIPQVDYSL-TEQEVTDIKAKILAS--
KATG1_CELJU       ARAWFKLTHRDLGPKARYLGADVP-AEDLIWQDPVPTVDYTL-SDADIADLKAKILAS--
KATG_SYNY3        AKAWFKLTHRDLGPKSRYLGPDVP-QEDLIWQDPIPPVDYTL-SEGEIKELEQQILAS--
KATG1_IDILO       ARAWFKLTHRDLGPKDRYLGADVP-EEDLIWQDPIPKVDYSL-SEQEIADLKEKLLNT--
KATG_VIBCB        ARAWFKLTHRDLGPKSRYLGPDVP-AEDLIWQDPVPPVSYYL-SEDNIDALKMAILNS--
KATG_BACHD        ARAWFKLLHRDMGPKARYLGPEVP-AEDFIWQDPVPTVDYEL-TDAEVEELKAKILDS--
KATG_GEOKA        ARAWFKLTHRDMGPKTRYLGPEVP-KEDFIWQDPIPTVDYEL-SDAEIEEIKAKILNS--
KATG_ERYLH        ARAWFKLCHRDMGPKVRYQGPEVP-SEDLIWQDPVPSGTAP--SDSDVSSFKSAVLDS--
KATG_SPHAL        ARAWFKLTHRDMGPKVRYLGPEVP-DEDLIWQDPIPAGTKP--SDAEVQAVKDKIAAS--
KATG_PHEZH        ARAWFKLCHRDMGPKSRYLGPEVP-AEDLIWQDPIPPVDHPLAEAADIASLKAKLLDS--
KATG_ARCB4        ARAWFKLTHRDLGPKSKYIGPEIP-KEDLIWQDPIPPINYEIIDEKDIEILKEKLLSS--
KATG_RUEPO        ARAWFKLTHRDMGPRARYLGKEVP-AEELIWQDPIPAGTQ--IDADDAAALKAQILAS--
KATG_RUEST        KRAWFKLTHRDMGPKACYLGADVP-DEDLIWQDPLPAVDHALIEEADIASLKADILAS--
KATG_JANSC        ARAWYKLTHRDMGPIQRYLGNDVP-SEELLWQDPVPMPQGPQVNDDEQAELKAAVAAT--
                    :*:** *  :*      *          * .                     :     

KATG_ECOLI        ---------GLSVSELVSVAWASASTFRGGDKRGGANGARLALMPQRDWDVNAAA---VR
KATG_SALTY        ---------GLSISEMVSVAWASASTFRGGDKRGGANGARLALAPQRDWDVNAVA---AR
KATG_ENT38        ---------GLSVSELVSVAWASASTFRGGDKRGGANGARLALAPQRDWDVNAAA---VR
KATG_CROS8        ---------GLTVSELISVAWASASTFRGGDKRGGANGARLALAPQRDWDVNASA---AR
KATG_ERWT9        ---------GLSVSELVSVAWASASTFRGGDKRGGANGARLALAPQKEWPVNAIA---SR
KATG_KLEP7        ---------GLSVSELVSVAWASASTFRGGDKRGGANGARLALAPQKDWPVNAIA---SR
KATG_ACIBC        ---------GLSTGELVSLAWASASTFRGGDKRGGANGARIALSPQREWEVNKKA---VE
KATG_PSEMY        ---------GLSVGDLVSVAWASASTFRGGDKRGGANGARLALAPQKDWEANQRA---IK
KATG_METPP        ---------GLTVAQLVATAWASASTFRGGDKRGGANGARLRLAPQKDWEANTPG-ELAK
KATG_JANMA        ---------GLSVSELVGTAWASASTFRGSDKRGGANGARIRLAPMKDWEVNQPE-QLAK
KATG_AZOC5        ---------GLTVSELVGTAWASASTFRGGDKRGGANGARIRLAPQKDWAVNQPE-QIDK
KATG_RALPJ        ---------GLSASELVAVAWASASTFRGSDKRGGANGARIRLAPQKDWAVNQP---VAG
KATG_ACIAC        ---------GLTVQELVGTAWASASTFRGSDKRGGANGARIRLAPQKDWAVNQPE-QLAR
KATG_PARPJ        ---------GLSVSQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAVNQPE-QLSK
KATG_PARXL        ---------GLSVSQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWPVNQPE-QLAK
KATG_CUPNH        ---------GLPVSQLVQTAWASASTFRGSDKRGGANGARIRLAPQKDWAANEPE-QLAK
KATG2_BURCJ       ---------GLSVAELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAVNEPA-RLAK
KATG_BORA1        ---------GLSVSELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAVNQPE-QLAK
KATG_HERSE        ---------GLSVPELVATAWASASTFRGGDMRGGANGARIRLAPQKDWAANQPA-QLAK
KATG_XANCP        ---------GLSVAQLVATAWASASSFRGSDKRGGANGARIRLAPQKDWASNEPA-QLAQ
KATG_XANC5        ---------GLSVAHLVSTAWASATTFRGSDKRGGANGARIRLAPQKDWQANQPE-QLAK
KATG_XYLFA        ---------GLGISQLVSTAWASASTFRGSDKRGGANGGRLCLAPQSQWEVNQPQ-QLSV
KATG1_MAGO7       ---------GVAPSKLIQTAWASASTFRGGDKRGGANGARIRLEPQNKWEVNNPQ-QLAE
KATG_NEUCR        ---------GVAPKKLIFVAWSSASSFRGSDKRGGANGARIRLAPQNEWKVNDPS-TLRE
C7ZHZ3_NECH7      ---------GLSATQLASTAWASASTFRGSDLRGGANGARIRLEPQKDWEVNNPA-QLSK
KATG2_MAGO7       ---------GLDVSKLASTAMACATTYRNSDKRGGCNGARIALEPQRNWVSNNPT-QLSA
C7ZIK0_NECH7      ---------GLGVSKLVSTAWNAASTFRNSDKRGGANGARIALKPQRSWASNNPE-QLEQ
KATG_FLAJ1        ---------GLSISQLVAAAWASASTFRGSDKRGGANGARVRLAPQKDWEVNNPA-KLAQ
KATG_METI4        ---------GLTVRELVFTAWSSASTFRGSDKRGGANGARIRLSPQKDWPANEPT-QLAR
KATG_PSEE4        ---------GLSVAELVSTAWASASTFRGSDKRGGANGARLRLAPQKDWAANQ---GLDK
KATG_PSEPF        ---------GLSVSELVSTAWAAASTFRGSDKRGGANGGRLRLAPQKFWQANQPE-QLDK
KATG_PSESM        ---------GLSVSQLVSTAWAAASTFRGSDKRGGANGGRLRLAPQKDWAVNQPA-QLAN
KATG2_BURCC       ---------GLSVSELVSTAWASASTFRGSDKRGGANGARVRLAPQKDWEVNQPA-QLAT
KATG2_CUPPJ       ---------GVPVSQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-VLAQ
KATG_CUPMC        ---------GLTVPQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWDVNQPA-ELAK
KATG_PSEF5        ---------GLSVAQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPQ-QLAQ
KATG_BURL3        ---------GLSVSQLVSTAWASAATFRGSDKRGGANGARIRLAPQKDWEVNRPA-ELAK
KATG1_BURVG       ---------GLTVAQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAVNQPA-ALAA
KATG_BURM1        ---------GLSVSQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNRPA-ELAA
KATG_BURPS        ---------GLTVSQLVSTAWAAASTFRGSDKRGGANGARIRLAPQKDWEANQPE-QLAA
KATG_SERP5        ---------GLPISVLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAINQPA-QLAQ
KATG_RALSO        ---------GLSVSQLVSTAWASASTFRGSDMRGGANGARIRLAPQKDWEANQPA-QLAK
KATG_HAHCH        ---------GLSVAQMVSTAWASASTFRGSDMRGGANGARIRLAPQNEWEVNQPD-QLAQ
KATG_SHEB8        ---------GLTISEVVATAWASASTYRGSDMRGGANGARIRLAPQKDWPVNQPE-QLAK
KATG_METB6        ---------GLSIPELVLTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNEPA-RLRK
KATG_METAC        ---------GLSISQLVSTAWVSASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-ELAK
KATG_METHJ        ---------GLSISRLVYTAWAAASTFRGSDKRGGANGARIRLDPQKNWEVNEPE-ELAN
KATG_CHLCH        ---------ELSIAQLISTAWASAATFRNSDKRGGANGARLRLAPQKDWEVNQPD-ELQK
KATG_SYMTH        ---------GMSIREMVMTAWASASTFRGSDKRGGANGARIRLAPQIGWEVNEPE-QLRP
KATG_FLAPJ        ---------GFSVSEMVSTAWASASTFRGSDKRGGANGARICLAPQKDWKVNNPI-QLSK
KATG_GRAFK        ---------GLSVQELVTTAWGSASTFRGSDKRGGANGGRIRLAPQNGWEVNNPK-QLGK
KATG_ACAM1        ---------NLTVSQLVSTAWASAVTYRNSDKRGGANGARIRLAPQRDWEVNQPA-QLAT
KATG_POLSJ        ---------GLSISQLVTTAWASAATFRGSDKRGGANGARIRLAPQKNWEVNQPA-ELAK
KATG_BRASO        -------AAGLSVSQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAINNPA-ELSK
KATG_RHILO        -------ASGLSVSQLVSTAWASASTFRGSDKRGGANGARIRLSPQKDWAVNQPA-ELAK
KATG_BEII9        -------SSGLTVAELVSTAWASASTFRGSDKRGGANGARILLAPQKDWAVNEPQ-KLDK
KATG_CAUVC        -------ATGLSASDLVSTAWASASTYRQSDKRGGANGARIRLAPQKDWAVNNPP-VLAK
KATG_PSEU5        -------GLGFSVSDLVSVAWASAATYRGSDKRGGANGARIRFAPQKDWEINNPP-LLAQ
KATG_RHOP5        -------ASGLSVAQLVSAAWASASTFRGSDKRGGANGGRIRLSPQKDWEVNHPA-ELAQ
KATG_RHOPT        -------ASGLSVAQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-ELAQ
KATG_RHOPS        -------ASGLSVSQLVSTAFASASTYRHSDKRGGANGARIRFAPQKDWEVNQPA-DLAQ
KATG_RHOPB        -------GSGLSVADLVSTAWNSASTFRGSDKRGGANGARIRLAPQKDWEVNQPE-QLAT
KATG_SOLUE        -------ASGLSTSDLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPK-QLAK
KATG_CHESB        -------ASGLSVSELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNDPA-QLAK
KATG_NITHX        -------ASGLTVPQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-QLKT
KATG_NITWN        -------ASGCTVAQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPI-QLKA
KATG_RHIL3        -------ATGLTVQELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-QLAK
KATG_SINMW        -------ASSLSVQELVSTAWDSASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-QLAR
KATG_ACICJ        -------ATGIAPTRLALTAWASAATFRGSDKRGGANGARIRLAPQKDWAANEPA-ELAK
KATG2_SHEFN       -------KSNLTVSELVRVAWASAASYRHSDMRGGANGARIALSPQKDWSVNNPA-ETAK
KATG_SHELP        -------KSGLSVAERVRLAWASAASYRQSDMRGGANGARIALAPQKDWTVNNPA-ETAK
KATG_ALTMD        -------DSGLTVQQLVKTAWAGASSFRASDLRGGANGARIALEPQMSWEANEPE-TVKA
KATG_COLP3        -------NSGLTTSELVRTAWAAASSHRVTDMRGGANGARINLEPQNSWAVNNPK-ELGK
KATG_SHEWM        -------KSGLSVQDLVLTAWASASSYRGTDMRGGANGARINLSPQNEWQVNNPK-QLAK
KATG2_SHEAM       -------ASGIAVPELVRTAWASAASFRGTDMRGGANGARLRLEPQRSWEVNNPE-ELAK
KATG2_SHEON       -------ASGLTVPELVRTAWASASSFRGTDMRGGANGARIRLEPMMNWQANNPK-ELAK
KATG2_CELJU       -------SSGLSSAELVRTAWAAAASFRGTDLRGGANGARIRLAPQNTWAVNNPR-ELNR
KATG2_IDILO       -------DSGLSVPQLVRTAWASASSFRGTDMRGGANGARIALEPQMNWEANNPA-ELKK
KATG_PSEA6        -------DGDVTPAQLVKTAWAAAASFRATDMRGGVNGARIQLAPQKNWEVNNPD-ELNT
KATG_LEPBP        -------KSGLSVPQLVRTAWASAASFRSTDMRGGANGARIRLSPQKNWPVNDPD-ELSK
KATG_NOVAD        -------ATGLTGPELVRAAWASAASFRGTDMRGGTDGGRIRLAPQKDWAANNPA-ELAR
KATG2_BURVG       -------ASGLPKSELIKTAWASAASFRGTDYRGGANGARIRLAPENGWAVNDPA-SVAK
KATG_GRABC        -------ASGLTVPELVRTAWGSAASFRGTDKRGGANGARIRLAPEKDWPVNDPQ-ELKK
KATG_ECOLX        -------DLGIPASELIKTAWASASTFRVTDYRGGNNGARIRLQPEINWEVNEPE-KLKK
KATG_YERPE        -------KTGLSDTKLIKTAWASASTFRGTDFRGGDNGARIRLAPQKDWPVNDPA-ELHS
KATG_FRATT        -------NSGLTNQQLIKTAWDSASTYRKTDYRGGSNGARIALAPEKDWQMNEPA-KLEV
KATG_SACD2        -------DSGLSTSDLVKTAWASAASFRTTDMRGGANGARIRLAPQKDWAVNQPQ-DLQR
KATG2_LEGPA       -------NSGLSTSELVKTAWASASTFRGTDMRGGANGARIRLSPQKDWPANDPQ-ELAK
KATG2_HALMA       -------DSDLSVSQLVKTAWASASTYRDSDKRGGANGARLRLEPQKNWEVNEPE-QLET
KATG1_HALMA       -------ETDLTVSQLVKTAWASASTYRDSDKRGGANGARIRLEPQKNWEVNEPA-QLET
KATG_HALSA        -------ESELSIPQLVKTAWASASTYRDSDKRGGANGARIRLEPQRSWEVNEPE-QLEA
KATG_NATPD        -------DSELSVAQLVKTAWASASTYRDSDKRGGANGARIRLEPQRSWEVNEPA-ALAD
KATG_SALRD        -------ETDLSVSRLVKTAWASASTYRDSDKRGGANGARIRLEPHRNWEANEPP-QLAH
KATG_METRJ        -------ATGLSVSDLAFTAFSAASTYRDSDKRGGANGGRLALAPQKDWAVNRRA---AP
KATG_PSELT        -------NSGINISQLVYTAWSSASTYRDSDRRGGANGARIRLRPMNLWEVNHPD-DLIK
KATG_ARCFU        -------ASGLSLSQLVYFAWASASTYRNSDRRGGANGARIRLKPMSVWEVNHPE-ELKK
B5Y4Y9_PHATC      IAGKILGSSGPCVSELVKVAWGSACTYRGTDHRGGANGARIRLAPQNTWKVNDPE-ELKR
B8CF21_THAPS      --SDLINSSTLSVSDLVKAAWASASTYRCTDHRGGANGGRIRLNPQKSWDVNDPS-SLGK
KATG3_MYCS2       -------GSGLSVSQLVTTAWASASTFRNSDKRGGANGARIRLEPQRSWAVNEPE-KLAI
KATG_MYCGI        -------QSGLSVPQLVKTAWASAASFRGTDKRGGANGARLRLEPQRNWEANEPA-ELDK
KATG1_MYCVP       -------QSGLSVPQLVKTAWASASSFRGTDKRGGANGARLRLEPQRSWEANEPS-ELDK
KATG_MYCSS        -------ESGLTVQQLVKTAWASASSFRGTDKRGGANGARVRLEPQRSWEGNEPA-ELAK
KATG1_MYCFO       -------DSGLSVQQLVKTAWSAAASFRGTDKRGGANGGRLRLQPQRNWEVNEPS-ELDK
KATG_MYCIT        -------DSGLSIPQLVKTAWSAAASYRNTDKRGGANGGRLRLQPQRSWEVNEPS-ELDK
KATG_MYCUA        -------ASGLTVAQLVKTAWSAASSFRRTDKRGGANGGRLRLEPQKSWESNEPA-DLDQ
KATG2_MYCS2       -------DSGLSTGQLIKTAWASAASYRNTDKRGGANGARVRLEPQKNWDVNEPA-ELAT
KATG_RHOJR        -------DSGLSIPQLVSTAWASAATHRSTDMRGGANGARIRLAPQKDWEINSPA-ELST
KATG_NOCSJ        -------DSGLSVAELVSTAWASAASFRSTDKRGGANGARIRLEPQRSWAVNQPE-QLAG
KATG_SALTO        -------ESGLTTTQLVSTAWASAASFRHTDKRGGANGARIRLEPQRSWEVNQPE-QLAT
KATG1_CUPPJ       -------GSGLSVPELISTAWGAAASFRGTDKRGGANGARIRLAPQKDWESNEPS-RLAK
KATG_FRACC        -------ASGLSVSQLVSTAWASASTFRGGDKRGGANGARIRLEPQRGWEVNEPD-QLAA
KATG_FRASN        -------ASGLSVSELVATAWASASTFRGGDKRGGANGARIRLEPQRGWEVNEPD-RLAA
KATG_STRCO        -------ESGLSVSQLVTTAWASASTFRGSDKRGGANGARIRLEPQRGWEVNEPD-ELAQ
KATG_STRRE        -------ESGLSVSQLVTTAWASASTFRASDKRGGANGARIRLAPQRGWEVNDPD-QLAQ
KATG_STRGG        -------ATDLTVAQLVSAAWASAASFRGSDKRGGANGARVRLEPQRGWEANDPD-ELAQ
KATG_SACEN        -------ESGLTVRQLVSTAWAAASTFRGSDKRGGANGGRIRLEPQRSWEVNEPD-QLAT
KATG2_MYCFO       -------DSGLSIQQLVNTAWKAAASYRSSDMRGG-NGGRIRLQPQLGWEVNEPE-ELAP
KATG2_MYCVP       -------DSGLTVQQLVSTAWKAASSFRISDMRGGANGGRIRLQPQLGWESNEPD-ELAQ
KATG1_MYCS2       -------DSGLTVSQLVSTAWKAASTFRSSDLRGGANGGRIRLQPQLGWEANEPD-ELAQ
KATG_MYCA9        -------ASGLTVPQLVSTAWKAAASYRNSDKRGGANGGRIRLQPQAGWESNEPD-ELAQ
KATG_MYCTU        -------ASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQPQVGWEVNDPDGDLRK
KATG_NOCFA        -------ASELSISQLVKTAWAAASSFRGSDYRGGANGGRIRLQPQLGWEVNEPD-ELAR
KATG_GLOVI        -------AAGLSIARLVTTAWASASTFRGTDKRGGANGARIRLVPQKDWAVNEPT-ELAT
KATG_KORVE        -------ASGLTVSQLVTTAWAAASSFRGSDKRGGANGARIRLTPQKDWEVNQPK-ELAK
KATG_CAUSK        ---------GLSVPQLVATAWASASTFRGSDKRGGANGARIRLSPQKDWAVNQPA-QLAN
KATG_MARMS        ---------GLTVAQLVSTAWASASTYRGSDMRGGANGARIRLAPQKDWAVNQPE-QLAK
KATG1_ALKMQ       ---------GLSLSELVSTAWASASSFRGSDKRGGANGARIRLAPQKDWEVNQPE-QLQT
KATG_DESHY        ---------GLSVSQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEINQPA-QLAE
KATG_PELCD        ---------GLSIPQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPA-QLKT
KATG_PELPD        ---------GLSVSQLVSTAWASASTFRGSDKRGGANGGRIRLAPQKDWEVNQPA-QLKT
KATG_GEOLS        ---------GLSISQLVTTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPG-QLAK
KATG_GEOSL        ---------GLSIADLVATAWASASTFRGSDKRGGANGARIRLAPQKDWAVNQPA-RLAT
KATG_DESOH        ---------GLSVSQLVYTAWSSAVTFRGSDKRGGANGARIRLAPQKEWEVNQPA-QLKK
KATG_CLOBB        ---------GLSISDLVATAWASASTFRGSDKRGGANGGRIRLEPQKNWEVNEPK-KLNN
KATG_PROA2        ---------GLSIPELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPE-QLQR
KATG_AZOSB        ---------GVSIAELVSTAWASASTFRGSDMRGGANGARIRLAPQKDWDVNQPA-QLAK
KATG_DECAR        ---------GLSTAELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWAANQPA-QLAK
KATG_SYNSC        ---------GCSVGALVATAWGAASTFRGSDRRGGANGGRIRFQPQNTWEVNDPE-QLRS
KATG_SYNPW        ---------GQSVSALVAAAWGSASTFRGSDRRGGANGGRIRLLPQRTWEVNDPE-QLNG
KATG_SYNR3        ---------GLSHGELISTAWASAASFRQSDRRGGANGARLRLQPQCNWELNNPE-QLKR
KATG_PSYIN        ---------DLSVSEMVSTAWDSARTFRGSDKRGGANGARIRLAPQKDWKGNEPA-RLSK
KATG_SYNP2        ---------GLSVSEMVCTAWDSARTFRGSDKRGGANGARIRLAPQKDWAGNEPA-RLAK
KATG_SYNP6        ---------GLSISELVSTAWDSARTYRNSDKRGGANGARIRLAPQKDWEGNEPD-RLAK
KATG1_VIBPA       ---------GLSVSDMVTTAWDSARTFRQSDKRGGANGARVRLAPQKDWQGNEPE-RLAR
KATG_SHEDO        ---------GLSISDMVTTAWDSARTFRGSDKRGGANGARIRLALQKQWAGNEPK-RLAS
KATG_SHEHH        ---------SLSVSDMVTTAWDSARTFRGSDLRGGANGARIRLAPQRDWQANEPE-RLNR
KATG_AERS4        ---------GLSISDMVSTAWDSARTFRGSDLRGGANGARIRLAPQNEWEGNEPA-RLAR
KATG_ALKEH        ---------GLSISEMVATAWDSARTFRGSDYRGGANGARIRLAPQKDWEGNEPE-RLSK
KATG_HALHL        ---------GLSIGEMVSTAWDSARTFRGSDNRGGANGARIRLAPQKDWEGNEPE-RLSK
KATG_PECAS        ---------SLSISELVATAWDSARTFRGSDMRGGANGARIRLAPQKDWVGNEPA-RLAR
KATG_RHOS5        ---------GLSVAELVSTAWDSARTFRGSDMRGGANGARIRLAPQKDWEGNEPA-RLAT
KATG1_LEGPL       ---------NLTIGEMVSTAWDSARTFRGSDKRGGANGARIRLKPQKDWEGNEPQ-RLTK
KATG_EDWTA        ---------GLSIADMVSTAWDSARTFRGSDKRGGANGARIRLAPQNTWEGNEPA-RLAK
KATG_LEPCP        ---------GLSVGELVATAWDSARTWRGSDYRGGANGARIRLAPQKDWAGNEPE-RLAR
KATG_VIBCH        ---------GLSISEMVSTAWDSARTFRGSDKRGGANGARIRLAPQKDWEGNEPA-RLGK
KATG_VIBVY        ---------GLSTGELVSTAWDSARTFRNSDKRGGANGARIRLAPQKDWLGNEPE-KLAK
KATG_POLAQ        ---------GLSMSDMVTTAWDSARTFRGSDKRGGANGARIRLAPQKDWMGNEPE-RLAR
KATG2_VIBPA       ---------GLSIADLVATAWDSARTYRGSDRRGGANGARIRLAPQKDWQGNEPE-RLSR
KATG1_SHEAM       ---------GLGAAELVATAWDSARTYRNSDKRGGANGARIRLLPQKDWVANEPA-RLAR
KATG_AGRFC        ---------GLSVADLVSTAWDSARTFRGSDKRGGANGARIRLAPQKDWEGNEPA-RLSR
KATG_PARDP        ---------GLSASDLVATAWDSARTYRGSDHRGGANGARIRLAPQKDWEGNEPQ-RLAR
KATG_CHRSD        ---------GLSIGEMVSTAWDSARTYRGSDMRGGANGARIRLAPQKTWPGNEPE-RLAK
KATG_MARHV        ---------GLSISEMVSTAWDSARTFRGSDMRGGANGARIRLAPQKDWEGNEPA-RLSK
KATG_HYPNA        ---------GLSLSEMVSTAWDSARTFRGSDLRGGANGARIRLAPQKDWAGNEPA-RLQK
KATG_MARMM        ---------GLSIAEMVATAWDSARTFRGSDKRGGANGARIRLAPQKDWDGNEPD-RLAK
KATG_PARL1        ---------GLSVSELVSTAWDSARTYRGSDMRGGANGARIRLAPQKDWVGNEPE-RLKK
KATG_DINSH        ---------GLSAAEMIATAWDSARTFRGSDMRGGANGARIRLVPQKDWAGNEPE-RLAK
KATG_ROSDO        ---------GLSAADMIATAWDSARTFRGSDKRGGANGARIRLAPQKDWAGNEPE-RLAK
F2I1Y2_PELSM      ---------SLSASDLITTAWDSARTYRRTDKRGGANGARIRLTPMKNWKGNEPK-KLSK
KATG1_SHEON       ---------GLSVSELVATAWDSARTFRGSDFRGGANGARIRLAPQKDWSGNEPE-RLQK
KATG_SHESW        ---------GLSIAELVTTAWDSARTFRGSDYRGGANGARIRLAPQKDWEGNEPV-RLQK
KATG1_SHEFN       ---------GLSIAQLVATAWDSARTFRGSDFRGGANGARIRLAPQKDWQGNEPA-RLQK
KATG1_CELJU       ---------GLSVAELVATAWDSARTFRGSDFRGGANGARIRLAPQKDWEGNEPA-RLQK
KATG_SYNY3        ---------GLTVSELVCTAWDSARTFRSSDYRGGANGARIRLEPQKNWPGNEPT-RLAK
KATG1_IDILO       ---------ELTSYELISTAWDSARNFRCSDFRGGANGARIRLAPQKDWHGNEPE-KLHK
KATG_VIBCB        ---------ELSIAELVSTAWDSARTYRGSDRRGGANGARIRLAPQKDWVGNEPE-RLQK
KATG_BACHD        ---------GLTVSELVTTAWASASTFRNSDKRGGANGARIRLAPQKDWEVNQPE-QLEK
KATG_GEOKA        ---------GLTVSELVKTAWASASTFRNSDKRGGANGARIRLAPQKDWEVNEPE-RLAK
KATG_ERYLH        ---------GLTVSELVKAAWASASTYRNSDHRGGANGARVRLAPQKDWAANDPE-ELGK
KATG_SPHAL        ---------GLTVSQLIKTAWASASTFRKSDFRGGANGARVRLAPQKDWEVNEPA-MLAR
KATG_PHEZH        ---------GLSVADLVRTAWASAATYRGSDHRGGANGARIRLAPQKDWEVNEPE-KLAR
KATG_ARCB4        ---------SLGVSKLVSLAWASASTYRDSDKRGGANGARIALEPQRSWESNSYL-NLDE
KATG_RUEPO        ---------GLSVSDMVSTAWASASTFRGSDMRGGANGARIRLAPQKDWEVNEPA-KLAR
KATG_RUEST        ---------GLSVQDLVYVAWSSASTFRGSDKRGGANGARIRLAPQKDWEVNEPA-KLEK
KATG_JANSC        ---------GLTAAELVRVAWGSAASYRDSDKRGGANGARIRLQPARGWTVNNPE-ELDK
                                     *   * . *  * *** :*.*: :     *  *        

KATG_ECOLI        ALPVLEKIQKESGK--------ASLADIIVLAGVVGVEKAASAAGL-SIHVPFAPGRVDA
KATG_SALTY        VLPVLEEIQKTTNK--------ASLADIIVLAGVVGIEQAAAAAGV-SISVPFAPGRVDA
KATG_ENT38        ALPTLEAIQRTTNK--------ASLADIIVLAGVVGVEQAAKAAGV-YITVPFTPGRVDA
KATG_CROS8        ALATLEAIQRTANK--------ASLADIIVLAGVVGVEQAAKAAGV-EITVPFAPGRVDA
KATG_ERWT9        ALPQLQAIQQASGK--------ISLADTLVLAGVVGIEQAAAAAGV-SIDVPFTPGRVDA
KATG_KLEP7        VLPTLQAIQRASGK--------ASLADIIVLAGVVGVEQAAAAAGV-SVNVPFTPGRVDA
KATG_ACIBC        TLTKIEEL-KASTQ--------LSLADLIVLAGNVGVEQAAQAAGF-NITVPFAPGRVDA
KATG_PSEMY        VLPKLVEIQQASGK--------ASLADVIVLAGNVGVEQAAKAAGV-AVDVPFAAGRVDA
KATG_METPP        VLATLETLQKASGK--------FSLADVIVLAGGVGVEQAAKAAGV-GIEVPFAPGRVDA
KATG_JANMA        VLKTLEGIQADFNQSAS-GGKQVSLADLIVLAGSVGVEQAAKAAGV-NVSVPFAAGRNDA
KATG_AZOC5        VLKALTRIQGEFNLNAS-DGKKVSLADVIVLAGNAGVEEAAKAAGH-DVSVPFAPGRTDA
KATG_RALPJ        TLARLEEIQ-------R-ASGKASLADVIVLAGSVGIELAAKAAGT-TITVPFTPGRVDA
KATG_ACIAC        VLQVLEGIQREFNKGAD-GDKRISLADLIVLAGAAGVEQAARAAGV-AVTVPFHPGRADA
KATG_PARPJ        VLKTLEGIQSEFNGAQS-GGKKVSLADLIVLAGSAGIEQAAKSAGH-QVTVPFAPGRMDA
KATG_PARXL        VLKVLEGIQSEFNGVQS-GGKKISLADLIVLGGAAAIEQAAKSAGQ-QVSVPFSPGRMDA
KATG_CUPNH        VLKVLEGIQAEFNGAQS-GGKKISLADLIVLAGGAGIEQAAQKAGH-RVTVPFTPGRMDA
KATG2_BURCJ       VLKVLERIQGEFNSTQP-GGKKISLADLIVLAGGAGIEQAAKRAGH-DVVVPFAPGRMDA
KATG_BORA1        VLKVLEGIQADFNGKQS-GGKKVSLADLIVLAGCAAIEQAAGQAGH-KVTVPFTAGRMDA
KATG_HERSE        VLKTLEGIQSAFN---Q-GGKKVSLADLIVLAGSAAVEKAAQDAGV-AVAVPFRAGRVDA
KATG_XANCP        VLATLERIQADFNARQS-GGKQISLADLIVLGGNAAVEQAAHAAGH-AVTVPFAPGRMDA
KATG_XANC5        VLATLERIQADFNAAQS-GGKKISLADLIVLAGNAAVEHAAQAAGH-QVTVPFAPGRTDA
KATG_XYLFA        VLETLRRVQTEFNA-QA-GDKRISLADLIVLAGGVGVEQAAKRAGI-VVEVPFVPGRTDA
KATG1_MAGO7       VLKALEGVKADFE---K-SGKKVSIADLIVLAGVAAVEQAAG------VPVPFTPGRGDA
KATG_NEUCR        VLAALESVQQKFNDS-S-SGKKVSLADLIVLGGVAALEQASG------LVVPFTPGRNDA
C7ZHZ3_NECH7      VLSVLEGIQQKFNNAQP-NGKRISLADVIVLAGSAGVEKAAKDAGF-FVSVPFTPGRTDA
KATG2_MAGO7       VLDALKKVQSDFNGS-N-GNKKVSLADLIVLGGTAAVEKAAKDAGV-DIKVPFSAGRVDA
C7ZIK0_NECH7      VLSALKAIQKKFNSG-Y-KTKQVSLADLIVLGGVAAVEKAAHDAGFKDIKVPFTPGRVDA
KATG_FLAJ1        VLSKLETIQTEFNASQN-DGKKVSLADLIVLAGSAGVEKAAKDAGS-SVTVSFNPGRMDA
KATG_METI4        VLAVLEQIQKEFNAR---SPKKVSMADLIVLGGCAGVEQAARNGGR-SVVVPFIPGRSDA
KATG_PSEE4        VLAALEKIRDE-------GGNKISLADLIVLAGSAAVEKAAKDAGH-AISVPFHPGRVDA
KATG_PSEPF        VLKVLEGIQNEFNAG-A-AGKQVSLADLIVLAGNAGVEQAAQNAGH-TVTVPFNPGRTDA
KATG_PSESM        VLSTLESIQSEFNAAQS-NGKKVSIADLIVLAGSAGVEQAAKNAGQ-QVTVPFTAGRADA
KATG2_BURCC       VLEVLGALQVEFNRAAT-GGKQVSLADLIVIAGNAGVEQAAAAAGV-EITVPFTPGRGDA
KATG2_CUPPJ       VLETLEGIRNEFNSSQS-GGKKVSLADLIVLAGCAGIEQAAKKGGH-DVKVPFTPGRMDA
KATG_CUPMC        VLVKLESIQSEFNKAQS-GGKKVSMADLIVLAGCAGVEQAAKSAGQ-DVTVPFSPGRMDT
KATG_PSEF5        VLQGLEALQSAFNSAQS-TGKRVSLADLIVLGGCAAVELAAKNAGY-SISVPFAPGRMDA
KATG_BURL3        VLATLEGVQKAFNDAQT-GGKKVSLADLIVLAGAAGVEQAAKNAGV-AVTVPFAPGRADA
KATG1_BURVG       VLETLEGVQKAFNDAQT-GGKKVSLADLIVLAGAAGVEQAAKQAGV-AVTVPFAAGRMDA
KATG_BURM1        VLETLEGVRKAFNDAQT-GGKRVSLADLIVLAGAAGVEQAAKNAGV-AVTVPFAPGRTDA
KATG_BURPS        VLETLEAIRTAFNGAQR-GGKQVSLADLIVLAGCAGVEQAAKNAGH-AVTVPFAPGRADA
KATG_SERP5        TLAKLEDIQQAFNNAQS-GNKRVSLADLIVLAGAAAVEQAAANAGH-PVSVPFTPGRMDA
KATG_RALSO        VLETLESIQGAFNGAQS-GGKKVSLADLIVLAGCAGVEQAAKNAGH-AVEVPFTPGRMDA
KATG_HAHCH        VLKTLEGVQAEFNSAQS-DGKKVSLADIIVLAGCAGVEKAAQNAGH-TIKVPFSPGRMDA
KATG_SHEB8        VLKVLESIQSEFNKS----GKKISLADLIVLAGCVGIDQAARNAGV-EVTIPFTPGRMDA
KATG_METB6        VLAVLEGIQQEFNKTAT-GGKKVSLADLIVLAGCAGVWKAAKNGGH-KVTVPFTPGRMDA
KATG_METAC        VLNTLEGIQSEFNSAAS-GGKKVSLADLIVLAGCAGVEQAAKNAGY-DVTVPFLPGRMDA
KATG_METHJ        VLKILEGIQHEFNQNAP-GGKRVSLADLIVLGGCAGIEQAAKNAGY-SVTVPFTPGRMDA
KATG_CHLCH        VLQVLETIQTEFNASRN-DGKKVSLADLIVLGGCAAIEAAAEKAGY-KVTVPFTPGRMDA
KATG_SYMTH        VLETLEGIQQEFNRSQT-GRKRVSLADLIVLAGCVGIEQAARNAGF-EITVPFTPGRVDA
KATG_FLAPJ        VLDALKEIQVTFNNAQS-IGKQVSIADLIVLTGCVGIEKAAKN-----IKVPFTPGRTDA
KATG_GRAFK        VIDTLEKIQQDFNESQS-GSKKVSIADLIVLAGCVGVEKAAKTAG-HELKVPFSPGRADA
KATG_ACAM1        VLQTLEAVQTTFNHSQI-GGKRVSLADLIVLGGCAGVEQAAKNAGWYDVKVPFKPGRTDA
KATG_POLSJ        VLQKLETIQKDFNSAQS-GGKKVSLADLIVLGGCAAVEAAAKKAG-QDVKVPFSPGRMDA
KATG_BRASO        VLAKLEGIQKEFNGSAT-GGKKVSLADLIVLAGNAGVEAAAKKAGV-EVTVPFAPGRTDA
KATG_RHILO        VLDKLQAIAKDFNAAQT-GSKKVSLADLIVLGGNAGIEKAAKAAGH-SVDVPFWPGRMDA
KATG_BEII9        VLKALEVIQADFNAALS-GGKKISLADLIILAGGAAIEKAASEAGQ-KITVPFAPGRTDA
KATG_CAUVC        VLAALEGVQKDFNASAG-GGKKISLADLIVLGGAAAIEKAAKDAGT-SVTVPFAPGRMDA
KATG_PSEU5        VLQKLGEIQSDFNGSAT-GGKKVSMADLIVLAGCAAIEKAAQDGGV-NVAVPFTPGRMDA
KATG_RHOP5        VLSKLEAIQSEFN-AQG-GGKKVSIADLIVLGGAAAIEKAAQEAGT-AVTVPFTPGRTDA
KATG_RHOPT        VLSKLEAIQGEFNGAQK-DGKKVSLADLIVLGGAAAIEKAAKDAGT-AVKVPFTPGRMDA
KATG_RHOPS        VLGKLEAIQKAFNDAQS-GGKKVSLADLIVLGGSAAVEKAAKDAGT-EVEVPFTPGRMDA
KATG_RHOPB        VLQKLEAIGKEFG-------KKVSLADLIVLGGVAAIEKAAKDAGV-AVKVPFSPGRMDA
KATG_SOLUE        VLEKLETIGKEFG-------KKVSLADLIVLGGDAAIEKAAKDAGV-EVKIPFTPGRMDA
KATG_CHESB        VLQRLEAIQGEFNAAQA-GGKKISLADLIVLGGCAAVEKAARDAGV-DVKVPFTPGRMDA
KATG_NITHX        VLARLEAIQSEFNGAQT-GGKKVSLADLIVLAGCFAVEKAANDVGI-DLKVPFTPGRMDA
KATG_NITWN        VLAKLEEIQAEFNDAQT-GGKKVSLADLIVLGGSAAVEKAARDAGI-DLKVPFTPGRMDA
KATG_RHIL3        VLGVLEGIQKNFNAAQT-GAKKISLADLIVLGGAAGVEKAAAAGGH-AVSVPFTPGRMDA
KATG_SINMW        VLSVLEGIQRDFNASQA-GGKKISLADLIVLAGNAGVEKAARAAGQ-EIIVPFTPGRMDA
KATG_ACICJ        VLAALEKVQAEFNAAAT-GGKKVSLADLIVLGGCAAIEAAAKAAGH-DVTVPFTPGRTDA
KATG2_SHEFN       VIKTLKAIQEDYNDSLF-SKSKVSLADLIVLGGTAAIEKAAKDAGF-TVSVPFNAGRGDA
KATG_SHELP        VLKTLEAIRADFNKGAG--KRQVSLADLIVLAGASALEQAAKQAGF-EVAVPFTPGRGDA
KATG_ALTMD        VVAKLKELQEDYNSRMF-SKKKVSLADLIVIGGAAAIEKAAADAGV-EVSVPVVPGRTDA
KATG_COLP3        VLAKLEGIQARFNKKSA--KTKVSLADVIVLGGATAIENAAAKAGN-RITVPFSPGRADA
KATG_SHEWM        VLNKLEKIKDKFNKKSK--KAKISLADLIVLGGAAAIEKSVKEAGF-NNKVPFTPGRMDA
KATG2_SHEAM       VLPKLEKIQKDFNKSLK-GGKKVSLADVIVLAGGTAIEQAARSAGY-SVTVPFTPGRMDA
KATG2_SHEON       VLAKLEKVQKDFNGSLK-GSKKVSLADVIVLGGSVAVEKAAKEAGV-VISVPFTPGRMDA
KATG2_CELJU       ALTRLEKVQGDFNKAST-GGKKVSLADVIVLGGVAAVEQAAKKAGY-AVEVPFIPGRTDA
KATG2_IDILO       VLDTLKGVQEDFNDELS-GDKYVSLADVIVLGGAAAIEKAGKDAGY-DVTVPFEPGRTDA
KATG_PSEA6        VLMFLNKVKKDFNDGQS-GNKQVSLADLIVLGGAAAIEHAASKNDF-DVEVPFIPGRSDA
KATG_LEPBP        VLKKLEQIQEEFNKS----GNKISLADLIVLAGNAAIEEAAKKAGV-KVTVPFTPGRTDA
KATG_NOVAD        VLKALEGVATEFNRAAK-DGKKVSVANLVVLGGNAAIEQAAAKAGV-TVEVPFTPGRTDA
KATG2_BURVG       VLKSLEAIQSGFNKGRT-DGKQVSLADLIVLGGSAAVEDAARKAGY-DITVPFAPGRVDA
KATG_GRABC        VLDKLESIQTAFNDGNH-DGKKISLADLIVLGGNVGVEEAAKKAGY-PVTVPFAPGRVDA
KATG_ECOLX        VLASLTSLQREFNKKQS-DGKKVSLADLIVLSGNAAIEDAARKAGV-ELEIPFTPGRTDA
KATG_YERPE        VLAALMEVQNNFNKDRS-DGKKVSLSDLIVLGGNAAIEDAAKKAGY-SISIPFTPGRTDA
KATG_FRATT        VLTKLKEIQTNFNNSKT-DGTKVSLADLIVLGGNVGVEQAAKQAGY-NIQMPFVPGRTDA
KATG_SACD2        VLKVLEGVQREFNKKSR--KTKVSLADVIVLGGAAAIEQAAKKAGH-KVEVPFFPGRTDA
KATG2_LEGPA       VLKTLESIQNNFNNAQA-DGKKISLADLIVLGGNAAIEQAAKQAGY-DIIVPFMPGRTDA
KATG2_HALMA       VLGTLENIQTEFNDSRS-DGTQVSLADLIVLGGNAAVEQAAANAGY-DVEIPFEPGRVDA
KATG1_HALMA       VLATLEEIQAEFNSART-DDTRVSLADLIVLGGNAAVEQAAADAGY-DVTVPFEPGRTDA
KATG_HALSA        ALSTYEDIQAEFNDARS-DDMRVSLADLIVLGGNAAIEQAAADAGY-DVDVPFEPGRTDA
KATG_NATPD        ALETYEAIQEEFNSARS-DAVRVSLADLIVLGGNAAVEQAAADAGY-DVTVPFEPGRTDA
KATG_SALRD        ALEVLTGIQKNFNDART-DDVRVSLADLIVLGGSAAIEKAAADAGH-DVEVPFTPGRTDA
KATG_METRJ        VVEALRGVMATFNDGRS-DGKKISLADLIVLGGCVAVERAARDAGV-ETPVPFTPGRVDT
KATG_PSELT        IIKVYEKIQKNFNEEQK-NNKKVSIADLIVLGGCAAIESAAKKAGF-DIRVPFIPGRVDA
KATG_ARCFU        VIAAYEKIQQEFNEGAKGSEKRISIADLIVLGGIAAVEEAARRAGF-SVKVPFIPGRVDA
B5Y4Y9_PHATC      VLEHLEQIQLDFNEQQKGSNKRVSLADLIVLGGCAAIEYAAKNAGN-DINIPFSPGRTDA
B8CF21_THAPS      VIVTLESIQQNFNAMN---SNQVSFADLVVLGGNVAIEEAARRAGHYNVRVTFVPGRMDA
KATG3_MYCS2       VLDRLERIRRRFNDSHR-GGKQISAADLIMLGGCAAVEHAAAEAGH-PIEVPCRLGRTDA
KATG_MYCGI        VLPVLEKIQQDFNSTAT-GGKKVSLADVIVLAGSAAVEKAAKDGGY-EITVHFAPGRTDA
KATG1_MYCVP       VLPVLERIQQDFNASAT-GGKKVSLADLIVLAGSAAVEKAAKDGGY-EISVHFAPGRTDA
KATG_MYCSS        VLPTLEQIQQDFNASAS-GGKKISLADLIVLAGSAAVEKAAKDAGY-EIDVHFAPGRTDA
KATG1_MYCFO       ALPVLERIAQDFNASAS-DGKKISLADLIVLGGSAAIEKAARDGGY-EVKVHFVAGRTDA
KATG_MYCIT        VLPVLEKIQQDFNASAS-GGKKISLADLIVLAGSAAVEKAAKDAGY-EISVHFAPGRTDA
KATG_MYCUA        VLSVLEGIQQDFNSSAA-GGKKISLADLIVLAGSAAVEKAAKDGGH-EVSVPFSPGRTDA
KATG2_MYCS2       VLPVLERIQQDFNASAS-GGKKVSLADLIVLAGSAAIEKAAKDGGY-NVTVPFAPGRTDA
KATG_RHOJR        ILQTLEQIQQDFNSSQS-GGVKVSLADVIVLAGAAAVEKAAKNAGH-DVTVPFTPGRTDA
KATG_NOCSJ        VLDRLEGIQREFN--EA-GGAKISLADLIVLAGSAAVEKAAKDGGV-DVTVPFRAGRTDA
KATG_SALTO        VLPALEEIQREFN--AA-GGAKISLADLIVLAGSAAVEKAARDAGV-EVTVPFRPGRTDA
KATG1_CUPPJ       VLTALERIQNDFNGSQS-GGKKVSLADLIVLGGCAAVEEAARKAGF-NISVPFAPGRTDA
KATG_FRACC        VLRTLTRIQEVFNAAQT-GGKQVSLADLIVLAGGVAVEQAAANAGF-DVEVPFAPGRTDA
KATG_FRASN        VLGTLTGIQEEFHAART-DGRRVSLADLIVLAGGAAVEQAAREAGF-DVEVPFTPGRTDA
KATG_STRCO        VLRVLEGVQREFNSGS--GAKKVSLADLIVLGGSAAVEKAAKEAGF-PVEVPFAAGRVDA
KATG_STRRE        VLRTLENVQQEFNASS--GAKKVSLADLIVLGGAAGVEKAAKEAGF-EIQVPFTPGRVDA
KATG_STRGG        VLRALEGVKESFDAK---GGKQVSLADLIVLAGGAAVEQAAKDAGV-EVEVPFTPGRVDA
KATG_SACEN        VISTLEGIQESFNAGS--GAKKVSFADLVVLAGGVGVEQAAQAAGF-DVEVPFTPGRGDA
KATG2_MYCFO       VIAKLEEIQAASDSG-------VSFADLVVLGGVVGLEKAIKAAGF-DVAVPFTSGPRDA
KATG2_MYCVP       VISKLEEIQGSSGID-------VSFADLVVLGGNVGIETAAKAAGF-DIEVPFSSGRGDA
KATG1_MYCS2       VVRKYEEIQKASGIN-------VSFADLVVLGGNVGVEKAAKAAGF-DVTVPFTPGRGDA
KATG_MYCA9        VIRILEGVQESFNAGDK----KISFADLVVLGGAAAVEKAARDAGF-DITVPFTPGRGDA
KATG_MYCTU        VIRTLEEIQESFNSAAP-GNIKVSFADLVVLGGCAAIEKAAKAAGH-NITVPFTPGRTDA
KATG_NOCFA        VIAVLEGIQEQFNAAQT-GNKKVSFADLVVLGGVAAVEQAARNAGV-AVEVPFTPGRADT
KATG_GLOVI        ALAKLEAIQQDFNAGQT-GGKQVSLADLIVLGGCAAVEQAAKKAGH-DITVPFTPGRTDA
KATG_KORVE        VLPVLEKIQHDFNA-QG-GKKKISLADLIILGGCAAVEEAAKKGGH-SVKVPFTPGRTDA
KATG_CAUSK        VLATLEGVQSAFNGG-QTDGKTVSLADLIVLAGCAAVEQAAKAAGH-DVEVPFTPGRVDA
KATG_MARMS        VLSVLESIQAEFNR--QDSTKQVSLADLIVLGGSVGVEQAAKASGH-SVTVPFTAGRADA
KATG1_ALKMQ       VLQALEKIQDTFNSAQS-GKKRISLADLIVLAGCAGVEQAAKNAGF-DVCVPFTPGRTDA
KATG_DESHY        VLAALEGIQTEFNSSQS-GTKKVSLADLIVLGGAAAIEQAARNAGH-TLVLPFTPGRTDA
KATG_PELCD        VLQTLEGIQQAFNGAQA-GGKKVSLADLIVLGGCAAVEQAAGNAGH-DVTVPFTPGRTDA
KATG_PELPD        VLQTLERIQKEYNDAQS-GGKRVSLADLIVLGGCAGIEQAAKNAGQ-AVSVPFTPGRTDA
KATG_GEOLS        VLETLAAVQQEFNAAQS-GNKRVSLADLIVLGGCAAVEQAARNAGQ-TVAVPFTPGRTDA
KATG_GEOSL        VLQALEGIRQEFNNAQS-GGKQVSLADLIVLGGCAAVEQAAKKAGH-DVTVPFTPGRADA
KATG_DESOH        VLAKLEKIRRAFNSAQS-DGKKVSLADLIVLGGCAAIEQAARNAGY-KGTVPFKPGRMDA
KATG_CLOBB        VLNTLKQIKENFNSSHS-KDKKVSLADIIILGGCVGIEQAAKRAGY-NINVPFIPGRTDA
KATG_PROA2        VLHKLEEIRNTFNGEQS-GNKQVSLADMIVLGGCAAVEEAAGKAGT-GVTVPFTPGRTDA
KATG_AZOSB        VLSVLGDIQAGFNAAAP-GGKKVSLADLIVLGGCAAVEAAARAAGH-VVEVPFTPGRMDA
KATG_DECAR        VLGVLEGIQQAFNSAQT-GGKKVSLADLIVLGGCAAVEAAAKAAGF-AVAVPFTPGRTDA
KATG_SYNSC        VLQTLETVQQQFNAEAT-GGQRVSMADLIVLAGSAAVEQAAAAGGH-SVTVPFLPGRMDA
KATG_SYNPW        VLTALETIQSQFNSSSS-NGKSVSIADLIVLGGCAAVEKAAADGGH-TVVVPFRPGRSDA
KATG_SYNR3        VLSVLEAVQMRFNQQHQ-GGMQVSLADLIVLSGSAAVEQAMAATGQ-RCRVRFTPGRVDA
KATG_PSYIN        VLAVLEGIAA---------GSKASVADVIVLAGNVGIEQAAKAAGF-DLTVPFSSGRGDA
KATG_SYNP2        VLPVLEAIAT---------ESGASVADVIVLAGNVGIEQAAQAAGV-EITVPFAPGRGDA
KATG_SYNP6        VLAVLEGIAA---------ATGASVADVIVLAGNVGVEQAARAAGV-EIVLPFAPGRGDA
KATG1_VIBPA       VLPVLENIAK---------DTGASVADVVVLAGNVGIEQAASAAGV-NVTVPFLPGRGDA
KATG_SHEDO        VLSVLEPIAA---------SHGVSVADVIVLAGNLGIELAAKKAGF-DVTVPFISGRGDA
KATG_SHEHH        VLAVLEPIAA---------KSGVSVADVIVLAGNLAVEQAAKAAGF-AIKVPFSPGRGDA
KATG_AERS4        VLKVLEPIAA---------ASQISVADVIVLAGNLGVELAARAAGV-EVTVPFSPGRGDA
KATG_ALKEH        VLGVLEGIAA---------DTGASVADTIVLAGNVGIEQAAKAAGH-DITVPFAPGRGDA
KATG_HALHL        VLGVLEGIAA---------DAGASLADTIVLAGNVGIEQAARAAGH-DITVPFAPGRGDA
KATG_PECAS        VLVVLESIAA---------ATGASVADTIVLAGNVGIEKAAKAAGV-QVTVPFAPGRGDT
KATG_RHOS5        VLGVLEGIAA---------ETGASVADVIVLGGNVGVEQAARAAGF-EITVPFAPGRGDA
KATG1_LEGPL       VLRILESIAA---------DTGASVADVIVLAGNVGIEKAAKAAGF-DIIVPFAPGRGDA
KATG_EDWTA        VLAVLEPIAA---------EFNVSVADVIVLAGNLGIEQAAKAAGV-AIEVPFAPGRGDA
KATG_LEPCP        VLAVLEPIAA---------AAGASVADVIVLAGNVGVELAAKAAGF-DVTVPFAPGRGDA
KATG_VIBCH        VLAVLEKIAA---------ESGISIADTIVLAGNVGIEQAAKAAGV-NVTVPFAPGRGDA
KATG_VIBVY        VLNVLEAIAS---------EFNISVADTIVLAGNVGVEQAAKAAGI-AITVPFAAGRGDA
KATG_POLAQ        VLAVYEKIGK---------ECGISIADTIILGGNIGIEQAAKAGGF-DVKVPFTSGRGDA
KATG2_VIBPA       VLAVLESIAA---------EEGCSVADAIVLAGNVGIELAARAAGH-DVSVPFAPGRGDA
KATG1_SHEAM       VLELLTPIAS---------DMGVSIADTLVLGGNLGVELAAKAAGF-NIKVPFIPGRGDA
KATG_AGRFC        VLSVLEPIAR---------ETGASIADVIVLAGNYGVEQAAKAAGF-DIAVPFAAGRGDA
KATG_PARDP        VLSVLEPIAA---------ETGASLADVIVLGGNLGVEQAAKAAGF-DIEVPFAPGRGDS
KATG_CHRSD        VLDVYERISA---------ETGASIADVIVLGGSVGIERAAKAAGH-DVHVPFLKGRGDA
KATG_MARHV        VLKVYEQISA---------ETGASVADVIVLAGSVGIEKAAKAAGY-EVRVPFLKGRGDA
KATG_HYPNA        VLSVLEPIAS---------ATGASVADVIVLAGNVGVEQAAKAAGF-DISVPFSPGRGDA
KATG_MARMM        VLGVLEPIAR---------DAGASLADVIVLAGNVGIEQAARAAGH-DVAVPFSPGRGDA
KATG_PARL1        VLSMLEPIAK---------ATGASLADVIVLAGNVGVEQAAKAAGF-DIAVPFAPGRGDA
KATG_DINSH        VLGILEPLAA---------AAGASIADTIVLAGNVGIEMAIKAAGQ-DVPVPFAPGRGDA
KATG_ROSDO        VLGILEPIAA---------ETGASVADVIVLAGNVGLEQSIKAAGY-DVDVPFAQGRGDA
F2I1Y2_PELSM      VLKVLEKIAK---------KTGSSVADTIILGGNVGLEKAIKKAGS-KTKVPFRPGRGDS
KATG1_SHEON       VLKVLSALQASL-------SKKVSIADLIVLGGAAAIEKAAHAAGV-NITVPFMPGRGDA
KATG_SHESW        VLKVLTDIQTGL-------SQKVSIADLIVLGGTAAVEKAAQDAGV-NIRVPFASGRGDA
KATG1_SHEFN       VLAVLATIQAGL-------TKSVSIADLIVLGGTAAVEKAAHAAGV-HVKVPFAAGRGDS
KATG1_CELJU       VLGVFAGIQSGL-------SKKVSIADLIVVGGAAAVEKAARDAGV-NITVPFAPGRGDA
KATG_SYNY3        VLAVLENIQANF-------AKPVSLADLIVLGGGAAIAKAALDGGI-EVNVPFLPGRGDA
KATG1_IDILO       VLRVLEDLQSTL-------DKKVSLADLIVLGGTAAVEKAAKDAGY-NVTVPFAPGRGDA
KATG_VIBCB        VLNVLDEIRTMH-------HSPISMADLIVLAGGVGIEKAASNAGM-NISVPFSQGRGDA
KATG_BACHD        VLSVLENIQSQL-------DKKVSIADLIVLGGSAAVEKAAKEAGF-DVTVPFAPGRGDA
KATG_GEOKA        VLSVYEDIQREL-------PKKVSIADLIVLGGSAAVEKAARDAGF-DVKVPFIPGRGDA
KATG_ERYLH        VLSKLDELRGN-----------LSMADAIVLAGSAAIEKAARDAGH-SVSVDVTTGRGDA
KATG_SPHAL        VLDTLDGLRGS-----------LSMADAIVLGGVVGLEKAIRDAGF-NVAVPFTGGRGDA
KATG_PHEZH        VLGVLEKVKADFDASAG-GGKKISLADLIVLGGCAGIEKAARDAGH-AIEVPFAPGRTDA
KATG_ARCB4        SLKILETIKGEFNSSNS--NKKVSLADLIVLGGCAAVEKAAKDAGF-NIKVPFTAGRADA
KATG_RUEPO        VLGVLEGIQAGFS---S-GGKSVSMADLIVLAGCAGVEQAAKAGGH-QIEVPFTSGRGDA
KATG_RUEST        VLNALEGIQSSFNAAAS-GGKKVSLADLIVLAGSAAVEKAAKDAGF-DVTVPFTPGRTDA
KATG_JANSC        VLPVLDSIADAFNG--R-GGTQITMADMIVLAGGVGVEMAAREAGH-NIHVPFTPGRGDA
                   :     :               : :: ::: *  .:  :          :    *  *:

KATG_ECOLI        RQDQTDIEMFELLEPIADGFRNYRAR-------LDVSTTESLLIDKAQQLTLTAPEMTAL
KATG_SALTY        RQDQTDIEMFSLLEPIADGFRNYRAR-------LDVSTTESLLIDKAQQLTLTAPEMTVL
KATG_ENT38        RQDQTDIEMFNLLEPIADGFRNYRAQ-------VDVSTTESLLIDKAQQLTLTAPELTAL
KATG_CROS8        RQDQTDVALFEFLKPKADGFRNYRGV-------RSSTPTESLLIDKAQQLTLTAPELTVL
KATG_ERWT9        RQEQTDIDSFDLLQPLADGFRNYRRV-------TGGPSTETLLIDKAQQLTLSTPELTVL
KATG_KLEP7        LPEQTDVESFDLLQPLADGFRNYRRI-------EGGVSTETLLIDKAQQLTLTAPEMTVL
KATG_ACIBC        LQSQTDVESFQLLLGLADGFRNWKKQ-------GVNTPAEVLLIDKAQQLTLTAPELTAL
KATG_PSEMY        RQDQTDVESFDVLESAADGFRNYSKG-------NLGVPTETMLVDKAQLLTLTAPELTAL
KATG_METPP        TQEQTDVESFAFLEPVADGFRNYFKG-------PGSVPVEHLLVDKAQLLTLTAPEMTVL
KATG_JANMA        RQDQTDVESFAALEPRTDGFRNYVGK-------KNGVPAEVALIDKAQLLCLSVPELTVL
KATG_AZOC5        SQAETDADSFKWLEPAADGFRNYQKD-------GLAVPAEVALIDKAQLLTLTAPELTVL
KATG_RALPJ        TAEQTDATSFSVLEPVADGFRNYQKT-------QFAVPGEVLLLDRAQLLTLTAPELTVL
KATG_ACIAC        RQDQTDVESFSVLEPSADGFRNYTKA-------RYSVPAEVLLLDKAQLLTLTAPEMTVL
KATG_PARPJ        SQDQTDVESVGALEPVADGFRNYVRS-------DIKVPPEALLIDKAQLLTLTAPEMTVL
KATG_PARXL        SQEQTDVQSVAALEPLADGFRNYLKG-------KYRAPAEALLIDKAQLLTLTAPEMTVL
KATG_CUPNH        SQEQTDVQSVGALEPIADGFRNFLKG-------KYNIRAEDLLIDKAQLLTLTAPEMTVL
KATG2_BURCJ       SQEQTDAHSFAVLEPVADGFRNFVKG-------KFAVPAEALLIDKAQLLTLTAPQMTAL
KATG_BORA1        SQEQTDVASFAPLEPVHDGFRNFLKS-------RYDVPAEHLLIDRAQLLTLTAPEMTVL
KATG_HERSE        SQEQTDAASFAPLEPIVDGFRNFQKQ-------RYAVRGEDMLIDKAQQLTLSAPEMTVL
KATG_XANCP        SQAQTDVESFAVLEPVADGFRNYAKA-------RYAVSAEALLIDKAQLLTLTAPEMTVL
KATG_XANC5        SQQQTDVESFAVLEPVADGFRNFAKR-------RYAVPAEALLIDKAQLLTLTAPELTVL
KATG_XYLFA        LQEQTDVSSFAPLEPFADGFRNYVKG-------DEVVPSEHLLIDRAQLLTLTAPEMTVL
KATG1_MAGO7       TQEQTDVESFTHLEPAADAFRNYGKG-------TSRVTTEQIMVDRAQQLTLTAPELTVL
KATG_NEUCR        TQEHTDVHSFTHLEPHADGFRSYGKG-------TKRVRTEQFLIDRASLLTLSAPELTAL
C7ZHZ3_NECH7      TQEQTDVQSANYLKPSVDGFRNYGQS-------TPRVKLEHLLIDRAQLLTLSLPELTAL
KATG2_MAGO7       TQEQTDVTQFSYLEPQADGFRNYGRG-------TARARTEEIMVDKASQLTLTPPELTVL
C7ZIK0_NECH7      TQDQTDVRSFGFLEPIADGFRNYGHG-------TARARTEELLVDKAALLTLTPPELTVL
KATG_FLAJ1        SAEETDVESFGYLEPKADGFRNYRKT-------KSAVSTEELLIDKANLLTLTAPELTVL
KATG_METI4        LEEQTDVESFAFLEPWADGFRNFYKK-------GCSVPQEALLVDKAQLLTLTAPEMTVL
KATG_PSEE4        SQAQTDVESFAVLEPLADGFRNFSKA-------RYSVKAEKLLLDKAQLLTLTAPELTVL
KATG_PSEPF        TQEQTDVESFGFLEPHTDGFRNYAAS-------TYRVPAEALLIDKAQLLTLSAPEMTVL
KATG_PSESM        SQEQTDVESFSFLEPIADGFRNYQKG-------RYKVSAESLLVDKAQLLTLTAPEMTVL
KATG2_BURCC       SAEQTDVDSMAVLEPIADGFRNYLKG-------AYTIPAEKLLIDKAQLLSLSAPEMTVL
KATG2_CUPPJ       TQEQTDVESFSVMEPIADGFRNYLKG-------TYAVTAETLLVDKAQLLTLTVPEVTAL
KATG_CUPMC        TQEKTDLDAMVVLEPIADGFRNYLQG-------KFSVRAEALLVDKAQLLKLTVPEMTAL
KATG_PSEF5        SQEQTDVESFAVLEPVADGFRNYLKP-------VSGITAEALLVDRAQLLTLTAPQLTVL
KATG_BURL3        TQEETDIEAMAVLEPVADGFRNFLKH-------AYQTPAEALLVDKAQLLTLTAPEMTAL
KATG1_BURVG       SQEQTDVDAMAVLEPVADGFRNYLKA-------AYKTPAEALLVDKAQLLTLTAPEMTVL
KATG_BURM1        SQEQTDVHAMAVLEPVADGFRNYLKR-------KFKTPAEALLVDKAQLLTLTAPEMTVL
KATG_BURPS        SQEQTDVESMAVLEPVADGFRNYLKG-------KYRVPAEVLLVDKAQLLTLSAPEMTVL
KATG_SERP5        TQEQTDVDSFEAMEPVADGFRNYLER-------QFNIPAEALLVDKAQLLTLTAPEMTVL
KATG_RALSO        AQAQTDVESFAVLEPIADGFRNYQKG-------KYTLPAEALLVDKAQLLTLTAPEMTVL
KATG_HAHCH        SQEQTDIEAFEVLEPIADGFRNYMKG-------KYAVSPEELLVDRAQLLTLTAPEMTVL
KATG_SHEB8        TQAQTDVESFAVLEPVADGFRNYHPT-------QFSVSAEELLVDRAQLLTLTAPEMTVL
KATG_METB6        TQEQTDVNSFAVLEPKADGFRNYLKG-------PYAVSAEELLVDKAQLLTLSAPEMTVL
KATG_METAC        LQEQTDVVSFALLEPIADGFRNYLKA-------QYPLPAEELLVDKAQLLTLTAPEMTVL
KATG_METHJ        VQEQTDAASFAVLEPMADGFRNYAKR-------HLPMKPEAMLIDKAQLLMLTAPEMTVL
KATG_CHLCH        TQEETDAHSFAVLEPVADGFRNYLKA-------KYSFSVEEMLIDKAQLLTLTAPEMTVL
KATG_SYMTH        TQEQTDVESFSYLEPVHDGFRNYLKR-------KFSVPAEHLLIDRANLLTLTAPEMTVL
KATG_FLAPJ        LQEQTDVASFAVLEPEADGFRNYMKT-------QYTVSAEEMLIDKAQLLTLTAPELTVL
KATG_GRAFK        SQEQTDVEAFEPLEPNADGFRNYFRNRD-----HVSASAEELLVDRAQLLTLTVPQMTVL
KATG_ACAM1        TQAQTDVTSFAVLEPRADGFRNYLKG-------HYPVSAEELLVDKAQLLTLTAPEMTVL
KATG_POLSJ        SQEQTDVDSFAVLEPAADGFRNYARK-------GLEGSAAELLVDKAQLMTLTAPEMTVL
KATG_BRASO        SQEQTDVESFAVLEPTHDGFRNYLSGK-------QWLSGEELLVDKAQLLTLTAPETTVL
KATG_RHILO        SQEQTDIHSFAPLEPTVDGFRNYVSGK-------QRLTVEEALVDRAQLLTLTAPELTVL
KATG_BEII9        SQEQTDVHSFAPLEPPADGFRNDVPAK-------LAEISGHLLVDRAQLLTLTAPEMTVL
KATG_CAUVC        SAEQTDAHSFEALEPRSDGFRNYRGPGK------HYMAPEEALVDRAQLLGLSGPELTVL
KATG_PSEU5        LEEWTDAQSFEALRPVADGFRNYYHES-------HFMAPEEALVDKAHLLRLSAPEMTVL
KATG_RHOP5        SQEQTDVESFKPLEPRADGFRNYVSSIR-----HQFMKPEEALVDKAQLLKLTGPELTVL
KATG_RHOPT        SAEQTDVESFKVLEPRADGFRNYINTKR-----HQFMHPEEALVDKAQLLTLTGPELTVL
KATG_RHOPS        LEEQTDGDSFKVLEPRADGFRNFIG-KR-----HQFMQPEEALVDRAQLLNLTAPEMTVL
KATG_RHOPB        SQEQTDAPSFAPLEPRADGFRNYINSKK-----HQFMKPEEALVDRAQLLTLTAPEMTVL
KATG_SOLUE        SQEQTDVASFAPLEPKADGFRNYI-GRK-----TQFLQPEEALVDRAQLLRLTGPEMTVL
KATG_CHESB        SQEQTDIDSFRALEPRADGFRNYLS--G-----RQFMMPEEALVDRAQLLRLTAPEMTVL
KATG_NITHX        SQDQTDVDSFAPLEPRADGFRNYIG-SR-----HQFMTPEEALVDRAQLLNLTGPEMTVL
KATG_NITWN        SLDQTDVESFAPLEPRADGFRNYIS-DR-----HQFMAPEEALVDRAQLLNLTGPEMTVL
KATG_RHIL3        SEAQTDAHSFAALKPRADGFRNYIGGR-------QFMKPEEALVDRAQLLTLTGPEMTVL
KATG_SINMW        SEAQTDAASFAALEPRADGFRNYVNSSR-----LQFMKPEEALVDRAQLLTLTAPEMTVL
KATG_ACICJ        TEAQTDVASFAVLEPKADGFRNYLGKG-------DPRAPEEQLIDRAQLMTLTAPEMTAL
KATG2_SHEFN       TQAMTDINAFSLLELTSDGFRNYFDA------QQSYKSPVDMLVDKADQLNLSVPEMTVL
KATG_SHELP        TQAQTDENSFSLLELHADGFRNYFDV------NHSYKSPTEMLVDKADQLDLTVPEMTVL
KATG_ALTMD        TQEQTDVNSFSLLEPTADAFRNYYNA------EASYRSPTDMLVDKADQLNLTVPEMTVL
KATG_COLP3        SQAQTNVKSFNYLKPKADGFRNFYT-------DDSYSSPAEMLVDKANSLGLNVPEMTVL
KATG_SHEWM        SQAMTDVASFGVLESTADGFRNYYS-------DESNLSPAQMLIDKADLLTLTVPEMTAL
KATG2_SHEAM       TTAQTDVSSFAVLEPKADAFRNFFS-------EESYLPPAEALVEKATQLTLSVPEMTAL
KATG2_SHEON       TQVQTDVNSFAVLEPAADGFRNYYS-------KDSSLSPAEMLIERANMLNLTVPEMTVL
KATG2_CELJU       SQAQTDVTSFAVLEPTADGFRNYYA-------KDNTLPPTDMLVERANLLTLTVPEMTVL
KATG2_IDILO       SQEMTDVNSFSFLEPKADAFRNYYA-------EGNRVSPAQHMVDKADQLTLTVPEMTVL
KATG_PSEA6        TQAQTEVESFAVLEPKADGFRNYYA-------QGNTLSPVEMLVDKANTLDLSVPEMSVL
KATG_LEPBP        TIEQTDEYSFSVLEPKADAFRNYYG-------PGNLMSPTEMLVDRANMLSLSIPEMTVL
KATG_NOVAD        SQAQTDVASFEFLKPAADGFRNYYDA------SANRLSPSEMLVERANLLTLSVPEMTVL
KATG2_BURVG       TQAQTDVASFAVLEPTADGFRNYYQK------G-NERSPAELLVDRASKLDLTVPEMTVL
KATG_GRABC        VQAQTDVKSFAVLEPTADGFRNYYAS------S-NQLSPAEMLVTRASMLNLTVPEMTVL
KATG_ECOLX        SQEQTDVASFSVLEPTADGFRNYYSK------SRSHISPVESLIDKASQLDLTVPEMTAL
KATG_YERPE        SQEETDVSSFAVLEPTADGFRNYYDA------KRNTLSPIASLIDRANKLELTVPEMTVL
KATG_FRATT        TQAQTDIESFNYLKTKSDGFINYTDG------SVSADKLPQTLVEKASMLDLNIPEMTVL
KATG_SACD2        SQEMTDVSTFAWLEPKSDGFRNFHA-------EGYKRNPAEALVERAALLGLTAPEMTAL
KATG2_LEGPA       TQGMTDVKSFEVLEPKADGFRNYFD-------KSNNMSPPEMLVEKASLLKLSVPQMTVL
KATG2_HALMA       GPEHTDAPSFDALKPKVDGVRNYIQD-----DITRP--AEEVLVDNADLLNLTASELTAL
KATG1_HALMA       TPEQTDVDSFEALKPRADGFRNYARD-----DVDVP--AEELLVDRADLLDLTPEEMTVL
KATG_HALSA        TPEQTDVESFEALKPKADGFRNYLGD-----DAERE--PEELLVDKAELLNLTADDMTVL
KATG_NATPD        TPEQTDVESFEALKPKADGFRNYLSD-----EAERK--PEELLVDKADLLNLTPPEMTVL
KATG_SALRD        TQEQTDVEAFEYLEPKADGFRNYIAD-----DPWQDWTPEEFLVDKADLLNLTPAETTVL
KATG_METRJ        TQALTDLEMFEWLKPVVDGFRNYVDDG--FGQMTRSVSPEEMFLDKANLLTLTAPEWTVL
KATG_PSELT        LQDQVEEEFYREIEPFADGFRNYFKDPYKIDESDISTTPEYFLIDKAQLLKLTVPELVVI
KATG_ARCFU        QQEHVDEEFYRVIEPFADGFRNYFRYPERINERDVYTTPEYFLVDKANLLTLTVPEMVVL
B5Y4Y9_PHATC      SSEQTVAESFDALEPSADGFRNYLKEG-------QSAKPEELLLNHAHLLTLTSPEMTVL
B8CF21_THAPS      FQSQTDVVSFNALQPMVDGFRNYEGNSS-----TSALRPEEALIDRAHLLTLSAPETVVL
KATG3_MYCS2       PQEWTDIEWFSALEPTADAFRNYVGE-------GNRPPPEHLLVDRASQLTLTAPQMTVL
KATG_MYCGI        TQESTDVESFAVLEPRTDGFRNFFRP-------GDKNPLEQQLVERAYLLDLTAPELTAL
KATG1_MYCVP       SQEQTDVDSFAVLEPRADGFRNFARP-------GEKTPLEQLLVDKAYFLDLTAPEMTAL
KATG_MYCSS        SQEQTDVESFAVLETKADGFRNYIRP-------GQKTSVEKLLVEKAYLLDLTAPEMTAL
KATG1_MYCFO       SQENTDVDSFAVLEPRADGFRNFVRP-------GDKAPLEQLLVDKAYFLNLTAPEMTVL
KATG_MYCIT        SQESTDVESFAVLEPRADGFRNYIRP-------GEKAPLEQLLIERAYLLGVTGPEMTVL
KATG_MYCUA        SQENTDVESFAVLEPRADGFRNYVRV-------GEKAPLEHLLIERAYRLGVTAPEMTVL
KATG2_MYCS2       SQENTDVESFAVLEPRADGFRNYVRP-------GEKVQLEKMLLERAYFLGVTAPQLTAL
KATG_RHOJR        TQEQTDVESFAVLEPKADGFRNYLRA-------GEKLPAEALLVDRAYMLNLTAPEMTVL
KATG_NOCSJ        SQEQTDVDSFAVLEPRADGFRNYLLE-------NEKAQPEVLLVERAYLLGLTAPEMTVL
KATG_SALTO        TQEQTDVDSFRVLEPRADAFRNYLRP-------GEKTQPEVLLVDRAYLLNLTAPEMTVL
KATG1_CUPPJ       SQEQTDESIFDVLEPIGDAFRNYFRA-------EDPLSPETRLLDRANLLKLTAPQMTVL
KATG_FRACC        SQEQTDVESFAVLEPTADGFRNYLGK-------GHRLPAEYLLLDRANQLTLSAPELTVL
KATG_FRASN        SQELTDVESFAALEPAADGFRNYLGK-------GQRLPAEYLLLDRANLLTLSAPELTVL
KATG_STRCO        TEEHTDAESFEALEPTADGFRNYLGK-------GNRLPAEFLLLDRANLLTLSAPEMTVL
KATG_STRRE        TEEHTDVESFEALEPTADGFRNYLGK-------GNRLPAEYLLLDKANLLNLSAPEMTVL
KATG_STRGG        AQDQTDVESFAALEPAYDGFRNYVGK-------AARLPAEYLLLDRANLLTLSAPETTVL
KATG_SACEN        TAEQTDVESFSHLEPSSDGFRNYLGK-------GHPLPAEYQLVDKANLLTLSAPEMTVL
KATG2_MYCFO       LQEQTDVDSFAYLEPKGDGFRNFVAK-------GDSVPAEYRLIDRANLLGLSAPQMTVL
KATG2_MYCVP       TQEQTDVEAFSYLEPKADGFRNYVGK-------GLNLPAEYQLIDQANLLNLSAPQMTVL
KATG1_MYCS2       TQEETDVDSFAYLEPKADGFRNYLGK-------GSDLPAEFKLIDRANLLGLSAPEMTTL
KATG_MYCA9        TQEQTDVESFSYLEPTADGFRNYLGK-------GAQIPAEYKLIDRANLLALSPPELAVL
KATG_MYCTU        SQEQTDVESFAVLEPKADGFRNYLGK-------GNPLPAEYMLLDKANLLTLSAPEMTVL
KATG_NOCFA        TQELTDPEGFAVLEPKADGFRNYLGK-------ANPLPAEYLLVDKANLLTLTAPEMTVL
KATG_GLOVI        SPDQTDVESFAPLEPKIDGFRNYVGE-------KSVYSAEEMLVDRAHLLTLSAPEMTVL
KATG_KORVE        SQEHTDVKSFSVMEPKADGFRNYHQK-------GQPRPAEEMLVDKAQLLRLTAPEMTAL
KATG_CAUSK        SQNQTDVASFGVLEPKADGFRNYLNT-------DLPLTAEELLVDKAQLLTLSAPEMTVL
KATG_MARMS        SQEQTDVESFAFLEPAADGFRNYLKG-------KYTVSAEEMLVDRAQLLTLSAPEMTAL
KATG1_ALKMQ       SQEQTEVESFSVLEPMADGFRNYSKG-------KYTISAEKLLVDRTQLLGLTAPEMTVL
KATG_DESHY        TQEQTEIYSFAVMEPKADGFRNYLKG-------KSSAPAEEMLVDRAQLLTLTAPEMTVL
KATG_PELCD        TSEQTDVASFSVLEPVADGFRNYQKA-------KFAVRAEELLVDRAQLLTLTAPEMTVL
KATG_PELPD        TQEQTDVASFAVLEPAADGFRNYLKT-------RYTVSAEELLVDRAQLLTLTAPEMTVL
KATG_GEOLS        SQEQTDTASFEVLEPKADGFRNYQKE-------KYAVSAEELLVDRAQLLTLTAPEMTVL
KATG_GEOSL        SQEHTDAASFTVLEPVADGFRNYQKA-------KYAVTAEELLIDRAQLLTLTAPEMTVL
KATG_DESOH        TQKQTDAASFAVLEPLADGFRNYLKA-------KFTVSAEELLIDKARLLTLTAPEMTVL
KATG_CLOBB        IQEQTDVKSFAVLEPKEDGFRNYLKT-------KYVVKPEDMLIDRAQLLTLTAPEMTVL
KATG_PROA2        LQEQTDTESFSVLEPLADGFRNYMKK-------KYSVSAEEMLVDRSQLLTLTAPEMTVL
KATG_AZOSB        SQEQTDVESFAVLEPIADGFRNYQKQ-------VYAVSAEELLVDKAQLLTLSAPEMTVL
KATG_DECAR        SQEQTDAESIAVLEPEADGFRNYQKK-------TYSVSAEEMLVDKAQLLTLSAPEMTVL
KATG_SYNSC        SADQTDTASFNLLKPIADGFRNWQRS-------GLPLRAEECLVDRAQQLGLSAPEMTVL
KATG_SYNPW        GPEQTDTASFNVLKPLADGFRNWQRS-------GLPLRAEELLVDRAQLLTLSAPEMTVL
KATG_SYNR3        SAEQTDNASFNALKPIADGFRNYLRS-------DLPLKAEQLLVDRAQQLHLSAPEMTAL
KATG_PSYIN        TDEMTDLDSFDVLEPIHDGYRNWL-------KQDYAVSAEELMLDRTQLMGLTAHEMTVL
KATG_SYNP2        TAEMTDVEGFAVLEPLHDGYRNWL-------QKDYVVSPEELMLDRTQLMGLTAPEMTVL
KATG_SYNP6        TAEQTDTESFAVLEPIHDGYRNWL-------KQDYAATPEELLLDRTQLLGLTAPEMTVL
KATG1_VIBPA       TQEMTDVESFEVLEPLHDGYRNWL-------KQNYVVTPEEMLLDRTQLMGLTAAEMTVL
KATG_SHEDO        TDEMTDNESFAVLEPLHDGYRNWL-------KQDFAVSAEELMLDRTQLMGLTAHEMTVL
KATG_SHEHH        TADMTDVESFHVLEPLHDGYRNWL-------KKDYAVSAEELMLDQTQLLGLTAQEMTVL
KATG_AERS4        SQARTDVASFDVLEPLADGYRNWL-------KKDYAVTAEELMLDRTQLMGLTAHEMTVL
KATG_ALKEH        SQEMTDEESFEYLEPLSDGYRNWL-------KKDYAVAPEEMMLDRTQLLGLTAPEMTVL
KATG_HALHL        SQEMTDVDSFQYLEPLADGYRNWV-------KKEYAVQPEEMMLDRTQLMGLTAPEMTVL
KATG_PECAS        TDALTDVESFDVLEPIHDGYRNWL-------KKDYAVSVEELMLDRTQLMGLTANEMTVL
KATG_RHOS5        TDDMTDAASFDVLEPIHDAFRNWL-------KKDYTVSPEELMLDRAQLMGLTAHEMTVL
KATG1_LEGPL       TDDMTDAESFDVLEPLHDGYRNWL-------KKAYDVRPEELMLDRTQLMGLTAHEMTVL
KATG_EDWTA        TQAMTDEASFEVLEPLADGFRNWL-------KKDYVVTAEELLLDRAQLMRLTACEMTVL
KATG_LEPCP        TQAQTDVESFEVLEPVADGFRNWQ-------QRSFAVQPEEMLLDRAQLMGLSAPEMTVL
KATG_VIBCH        TIEQTDVESFEVLEPLADGFRNWQ-------KKHYVVTPEEMLLDKAQLLRLTAPEMTVL
KATG_VIBVY        TIEQTDVESFEVLEPIADGFRNWQ-------KQHYAVNPEELLLDRAQLLGLSAPEMTVL
KATG_POLAQ        IQAMTDVESFEVLEPLADGFRNWL-------KESYVVTPEELLLDRTQLMGLTAQEMTVL
KATG2_VIBPA       SQDMTDVESFEVLEPVADGFRNWL-------KKDYVVKPEELLLDRAQLMGLTAPEMTVL
KATG1_SHEAM       SQAQTDIDSFEVLEPLADGFRNWQ-------KQDFVVTPEEMLLDRAQLMGLSAPEMTVL
KATG_AGRFC        SAEQTDADSFAPLEPLADGFRNWV-------KKDYVVSPEELLLDRAQLLGLTAPELTVL
KATG_PARDP        TAEQTDAASFDVLEPLADGFRNWQ-------KQDYVVSPEEMLLDRAQLMGLTAPEMTTL
KATG_CHRSD        TDEMTDAASFAPLEPLADGFRNWQ-------KQDYVVKPEEMLLDRAQLMGLTGPEMTVL
KATG_MARHV        TDEMTDAPSFEYLEPVADGFRNWQ-------KKDYIVKPEELLLDRAQLMGLTAPEMTVL
KATG_HYPNA        TAEMTDADSFESLEPYADGFRNWQ-------KEDYVVKPEELLLDRAQLLGLTGPEMTVL
KATG_MARMM        TDAMTDAESFDVLEPLADGYRNWQ-------KADYVVSAEEMLLDRTQLLGLTAPEMTVL
KATG_PARL1        SAEQTDAESFEALEPLADAYRNFL-------KRDYELPPEELMLDRTQLMGLTGPEMTVL
KATG_DINSH        TDAMTDAESFEVMEPFADGFRNWS-------KERYSVSPEELMLDRAQLLGLTAAEMAVL
KATG_ROSDO        TADQTDAASFDVLEPLADGFRNWQ-------KADYAVSAEEMMLDKAQLLGLTAAEMTVL
F2I1Y2_PELSM      TQEQTEEKSFKWLEPYHDGFRNFV-------KADYSVMPEELLLERASLMGLTAKEMTCL
KATG1_SHEON       TKEMTDVESFVVLEPLHDAYRNWL-------KQDYVVQPEEMMLDRSQLMGLTAHEMTVL
KATG_SHESW        SQEMTDIESFAVLEPLHDAYRNWQ-------KKDYVVQPEELMLDRTQLMGLTAHEMTVL
KATG1_SHEFN       TLAQTDVESFDVLEPLHDAFRNWQ-------KKDYVVQPEEMMLDRTQLMGLTAHEMTVL
KATG1_CELJU       TDAQTDAESFAPLEPVHDGFRNWV-------KKDYAVQPEEMLLDRAQLMGLTAPEMTVL
KATG_SYNY3        TQAMTDAESFTPLEPIHDGYRNWL-------KQDYAVSPEELLLERTQLMGLTAPEMTVL
KATG1_IDILO       TDEQTDVESFEPLEPLHDGYRNYL-------KKDYAVPAEELMLDRTHLMGLTAPEMTVL
KATG_VIBCB        TDVMTDAESFDVLEPIHDGFRNWL-------KSDYVVTAEELLLERSQLMQLTAVEMTVL
KATG_BACHD        TQEQTDVEGFAVLEPVSDGFRNYQ-------KKEYSVSPEELLIDKAQLLDLTAPEMTAL
KATG_GEOKA        TQEQTDVESFSVLEPFADGFRNYQ-------KKEYSVGPEELLIDKAQLLGLTAPEMTVL
KATG_ERYLH        TDEHTDAESFEPLEPFADGFRNYL-------KTKASVKTEEMLIDKAHLLGLSIPEMTAL
KATG_SPHAL        TQEQTDVESFEVMEPEADAFRNYVG------KKKLAVKVEEMMLDKASLLGLSVPEMTVL
KATG_PHEZH        SPEQTDVESFEVLEPKADGFRNYL-------QVRFSVPTEELLIDRSQLLGLSAPEMTVL
KATG_ARCB4        TQEQTHVESFSHLEPIADGFRNYS-------KAKYTLSTEELLIDKAQLLSLTIPEMIVL
KATG_RUEPO        SAEQTDAESFAVMEPVMDGFRNYQ-------ARELSTSPEEMLVDRAQLLGLSAPEMTVL
KATG_RUEST        TDEQTDVESFDVMEPQIDGFRNYA-------PKKFSVSTEEMLVDKAQLLTLSAPEMTVL
KATG_JANSC        TQEQTDVDSYDVLEPTSDGFRNYH-------ATFSLREPAEMLVDKAALLGLTAPEMTVL
                      .       :    *.  .                    :: .:  : :.  :   :

KATG_ECOLI        VGGMRVLGANFD--GSK--NGVFTDRVGVLSNDFFVNLLDMRYEWKATDESKE---LFEG
KATG_SALTY        VGGMRVLGTNFD--GSQ--NGVFTDRPGVLSTDFFANLLDMRYEWKPTDDANE---LFEG
KATG_ENT38        VGGMRVLGANFD--GSQ--NGVFTDRVGVLTTDFFVNLLDMGTQWKATDESNE---LFAG
KATG_CROS8        VGGMRALGANYD--ASA--HGVFTDRVGVLSTDFFVNLLDMRYEWKATDATAE---VFEG
KATG_ERWT9        VGGLRVLGTNFD--GGK--HGVLTEHAGVLSNDFFVNLLDMRTAWRAADDSAE---LFEG
KATG_KLEP7        VGGLRVLGANYD--GSK--HGVFTDRVGVLSNDFFVNLLDMATVWKAADDNAE---LFTG
KATG_ACIBC        IGGLRVLGTNWD--GSQ--HGVFTQQVGVLSTDFFTNLLDMSNVWAPVDSTSE---VFEG
KATG_PSEMY        VGGLRVLGANYD--GSQ--HGVFTDKVGVLSNDFFVNLLDMNTVWKAVDDSNE---VFEG
KATG_METPP        VGGLRVLGANAG--GSR--HGVFTDRPGVLTPDFFVNLLDMRTTWQPANG------VYEG
KATG_JANMA        ISGLRAININVG--GVK--HGVLTRTPGVLNNEVLLNLLDMGTQWKPVESDAN---VFEG
KATG_AZOC5        IGGLRAININVD--GAK--HGVFTDKPGALTTDFFTNLLDMSTQWKAAGESND---VYEG
KATG_RALPJ        IGGLRAININAD--GSQ--HGVFTSTPGALTNDFFVNLLDMNTEWKPAG---D---IYEG
KATG_ACIAC        VGGLRAININVG--GAT--HGVFTATPGALTNDFFANLLDMSTEWKPAG---D---LFEG
KATG_PARPJ        IGGLRALNVGTG--QNP--QGAFTDKPETLTNDFFRNLLDMGTEWKPTSPARH---AFEG
KATG_PARXL        LGGLRALNVHAG--QDS--HGVFTHRPQTLSNDFFRNLLDMGTEWKPLSPARD---VFEG
KATG_CUPNH        IGGLRVLNVHTG--QDA--HGVFTDRPETLSNDFFRNLLDMRTEWKPLSEARD---VFEG
KATG2_BURCJ       VGGLRVLNVQTG--DEK--HGVFTDQPETLTVDFFRNLLDMATEWKPIA-GED---TYEG
KATG_BORA1        IGGLRVLDVHTD--KEK--HGVFTDRPGVLTNDFFRNLIDMGTEWKPSSPARE---SFTG
KATG_HERSE        VGGLRVLGNNVG--GST--KGMFTDRVGVLSNDFFVNLLDMATEWKSTSPAQE---EFEG
KATG_XANCP        VGGLRVLGANTG--QSH--NGVFTTRPGVLSNDFFANLLDMRTEWKATSETKE---TYEG
KATG_XANC5        VGGLRVLGANVG--DSK--HGVFTSRPGVLSNDFFANLLDMRTEWKATSEAKD---EYEG
KATG_XYLFA        IGGLRVLGANVG--GVK--HGVFTDRLGTLSNDFFINLLDMGTEWAPVSKERH---VFEG
KATG1_MAGO7       VGGLRVLGANYD--GSS--HGVWTDKPGKLTNDFFVTLLDPYTSWKSVD--GE---VFEG
KATG_NEUCR        IGGLRVLEANYD--GSS--YGVLTKTPGKLTNDYFVNLLDTNTAWKAADNEGE---VFIG
C7ZHZ3_NECH7      IGGLRALNANWD--GSS--HGIFTDRPGALTNDFFVNLLDMGTVWKPVG-DGD---IFEG
KATG2_MAGO7       VGGMRALGANYD--GSD--VGVFTANKGKLTPDFFVNLVDMNIAWTASGADGE---SWVG
C7ZIK0_NECH7      VGGLRALNANFD--GSS--KGILTTKKGQLTNDFFVNLLDAATVWTKQDSQGE---LWTG
KATG_FLAJ1        LGGLRVLDINAD--GSK--NGVFTHRPGQLTNDFFVNLLDMNTQWQAVSNDKE---LYAG
KATG_METI4        VGGMRVLDANVG--RSR--HGVFTDRPGALTNDFFVNLLDMDTEWKPVDEREE---LFEG
KATG_PSEE4        VGGLRVLGANHG--GSK--EGVFTDKPGVLTNDFFRNLLDMGVEWKPTSADNE---HFEG
KATG_PSEPF        IGGLRVLDTNVG--KTQ--HGVFTDRPGTLTNDFFRNLLDMGVEWKPTS--KT---EFEG
KATG_PSESM        LGGLRVLNINVG--QSK--HGVFTDKPETLTNDFFKNLLDMAVEWKATSGAND---TFEA
KATG2_BURCC       IGGLRVLGTNVG--DSK--HGVFTDRREVLTNDFFRNLLDMGTEWKPTSEANE---AYEG
KATG2_CUPPJ       VGGMRVLNANFG--QTQ--HGVFTDRPETLTNDFFVNVLDMGTEWKPTADNKD---LFEG
KATG_CUPMC        VGGLRVLGANFG--NSQ--HGVFTKRPGTLTNDFFVNLLDMGTEWKPVSEERE---VFEG
KATG_PSEF5        LGGLRVLGANVG--QSP--HGVFTSRPGTLSNDFFVNLLDMGTQWKPQSEARD---LYEG
KATG_BURL3        VGGLRVLGANAG--DAK--QGVFTDRPEALTNDFFVNLLDMGTEWKPVSAAND---VFEG
KATG1_BURVG       IGGLRVLGANAG--GAQ--HGVFTDRPGTLSNDFFVNLLDMGTEWKPASAAND---VFEG
KATG_BURM1        VGGMRVLGTNVG--DPK--HGVFTERPGTLTNDFFVNLLDMRTEWKPASADND---VFEG
KATG_BURPS        LGGLRVLGANVG--QSR--HGVFTAREQALTNDFFVNLLDMGTEWKPTAADAD---VFEG
KATG_SERP5        VGGLRVLNANVG--QSQ--HGVLTQRPQALSNDFFVNLLDMGTTWKAAGEDG----VFEG
KATG_RALSO        VGGLRVLDTNIG--QTR--HGVFTQRPESLTNDFFVNLLDMGTEWKATDGRD----VFEG
KATG_HAHCH        IGGMRVLNANVG--QSK--HGVFTQRPESLTNDFFVNLLDMGTVWKATSKEED---LFEG
KATG_SHEB8        IGGLRVLDTNAD--QSK--TGVLTARPEFLTNDFFVNLLDMGTTWKPTSKAED---RFEG
KATG_METB6        IGGLRVIGATYG--QAT--HGVFTTLPGALTNDFFTHLLDMGTEWKPVAGNPD---VFEG
KATG_METAC        VGGMRVLNTNFG--HTQ--HGVFTQKPEALTNDFFVNLLDMGTEWKAVSDVKD---IFEG
KATG_METHJ        IGGMRVLNTNFG--QTK--HGVFTDKPETLTNDYFVHLLDMGTEWTPVSETED---LYEG
KATG_CHLCH        IGGMRVLNTNAG--HTT--HGVFTKRPETLSNDFFVNLLDMGTVWKATSEASD---IFEG
KATG_SYMTH        IGGLRVLDCNWG--RTK--HGVLTDRPGALTNDFFVNLLDMRWKWNATDD-EN---VFEG
KATG_FLAPJ        IGGLRVLDVNFN--QSK--NGLFTNRSGELTNDFFVNLLDFGTTWKASSESQD---IFEG
KATG_GRAFK        LGGMRAMGANYD--GSK--KGVFTDRPGQLTNDFFKNILEMGLTWKSSSDSET---EFDG
KATG_ACAM1        VGGLRVLNANVG--QAQ--HGVFTHRPESLTNDFFLNLLDMSVTWAATSEAEE---VFEG
KATG_POLSJ        IGGLRALNANVG--QSK--HGVFTKQPETLTNDFFVNLLDMSTKWQKSATSEG---VLEG
KATG_BRASO        VGGLRVLGANAA--GSK--HGVFTTQPEVLSNDFFVNLLDMGIAWTPVDQGEH---TFEG
KATG_RHILO        VGGLRVLGANAG--QSK--HGVFTKQPETLSNDFFVNLLDMGTEWKATSDAKD---VFEG
KATG_BEII9        IGGLRVLGANTG--GSK--HGVFTTRPGVLSNDFFTNLLDMGTEWKPAAE-DG---VYEG
KATG_CAUVC        VGGLRVLGANAD--GSK--DGVFTNRPGALSNDFFVNLLSMETTWSPTA--AN---AFAG
KATG_PSEU5        VGGMRVLGANAG--GSQ--DGVFTHRVGVLSNDFFVNLLDMKNEWTATEH-KN---RFQG
KATG_RHOP5        VGGLRVLGANYG--HTT--HGVLTDRPERLSNDFFVNLLDMKYAWAPSPTTTG---IYEA
KATG_RHOPT        VGGLRVLGANYA--HST--HGVLTERPEKLTNDFFVNLLDMGTKWTKANGEVE---IYEG
KATG_RHOPS        LGGLRVLGGNVG--HDS--HGVFTDRPEKLTNDFFVNLLDMKTAWSLSATAEG---VYEG
KATG_RHOPB        VGGLRVLGANAG--DSK--HGVFTTKPGTLSNDFFVNLLTMATSWQPSG-TEG---IYEG
KATG_SOLUE        VGGLRVLGANTA--GSK--HGVFTATPGVLTNDFFVNLLDMRTHWQPAGGEEG---VYEG
KATG_CHESB        LGGLRVLGANSG--GSE--HGVLTKQVGKLTNDFFVNLLTMNTQWQPIA--DG---TYEG
KATG_NITHX        VGGLRVLGANAA--DSR--HGVFTKQPGTLTNDFFANLLTMDTVWQPVAGQDD---VYEG
KATG_NITWN        VGGLRVLGANAA--DSR--HGVFTTRPGKLTNDFFVNLLTMDTEWQPVAGQDG---VYES
KATG_RHIL3        VGGLRVLKAGA----PE--HGVFTSRPETLTNDFFVNLLDMGTQWSPAAGRDG---VYEG
KATG_SINMW        VGGLRVLKAGQ----PE--HGVFTSRPEALTNDFFVNLLDMGTQWSPVEGKEG---VYEG
KATG_ACICJ        IGGMRALGANVG--GAK--HGVFTTRPGALTNDFFVNLLDMNMSWHPAAE-PG---VYEL
KATG2_SHEFN       VGGLRALDANYK--GLK--HGVLTSTPGTLNNDFFVNLLDMSTVWKK-SSTDG---IYEG
KATG_SHELP        VGGLRALDANYQ--GAK--HGVLTQRPGTLNNDFFVNLLDMSTLWQK-SDVDG---IYQG
KATG_ALTMD        LGGLRSLGANTG--GTN--HGVFTDNVGTLNNDFFVTLLDMGVKWRK-TDDAS---VYEG
KATG_COLP3        IGGMRALDANYD--ASS--YGVLTNNPGVLTNDFFVNLLDMKTVWSKDKSNAG---IYIG
KATG_SHEWM        VGGMRALSANAD--GSN--HGVFTDQPGVLSNDFFVNLLDMSVKWSKKPKSEA---LYEG
KATG2_SHEAM       VGGLRVLDANSN--KAK--HGVFTDKPGNLSNDFFVNLLDMSTRWEKSPREAG---LYQG
KATG2_SHEON       VGGLRALDANSA--GVK--HGVFTDKPGVLSNDFFVNLLDMSTKWRKSDKQEG---IYEG
KATG2_CELJU       VGGLRVLGANSD--AAK--NGIFTDKPGTLSNDFFINLLDMSTQWRKSAKTGG---LYEG
KATG2_IDILO       VGGLRSLDANYN--DSD--HGVFTDQPGTLNNDFFVNLLSMDNEWKKSSDNEA---IYEG
KATG_PSEA6        VAGLRVMNINAD--GSD--RGVLTDNPGTLNNDFFVNLLDMSTRWEKAKDQQD---LYLG
KATG_LEPBP        LGGMRSLDANAG--KSK--HGILTTKPGVLSNDFFVNLLDMSTKWQKSEQTEG---LYEG
KATG_NOVAD        VGGLRALDANAG--GAR--HGVFTDRPGTLSNDFFVNLLGMETKWQKAA-TDG---VYEG
KATG2_BURVG       VGGLRALDANTG--HSK--LGVLTNHPGTLSNEFFVNLLDMSTEWKKSPSADG---TYEG
KATG_GRABC        VGGMRVLDANEG--HSQ--LGVLTDHPGVLSNDFFVNLLDMSTKWSKAADTAG---VYEG
KATG_ECOLX        LGGLRVMDINTN--NSS--LGVFTDTPGVLDNKFFVNLLDMSTRWSKADK-ED---TYNG
KATG_YERPE        IGGLRVLDVNSG--GSK--AGVLTNTPGQLNNNFFVNLLDMSTKWTKSPKAEG---YFDG
KATG_FRATT        VGGMRALDVNYD--NSQ--EGVLTTTPGQLNNSFFVNLLDMSTQWKKSDKKDG---EYIG
KATG_SACD2        VGGLRVLQANAD--GSQ--HGVFTDNPGSLTNDFFVNLVDMSTVWKKSDTEAG---LYKG
KATG2_LEGPA       VGGMRVLNANTG--QNQ--YGVFTDKPGTLNNDFFVNLLSMSTEWKKSSETEG---IYEG
KATG2_HALMA       IGGMRSIGANYQ--DTD--LGVFTDEPETLTNDFFVNLLDMGTEWEPAADSEH---RYKG
KATG1_HALMA       VGGLRSLGATYQ--DSD--LGVFTDEPGTLTNDFFEVVLGMDTEWEPVSESKD---VFEG
KATG_HALSA        VGGLRALGVTHG--DSE--LGIFTDQPGTLTNDFFTTLLDMDYEWEAASEDRE---VFEL
KATG_NATPD        VGGMRALGATYQ--DTD--RGVFTDEPGTLTNDFFVNILDMDYEWEPVSEDRE---VFEL
KATG_SALRD        VGGMRALDATHE--QADG-YGVFTDRPETLNNDYFVNLLDMGHEWDPVSEDKQ---HFKI
KATG_METRJ        TGGLRALNANHD--GSN--RGVLTDRVGVLTTDFFRNLTDVDLVWEKADADGM---TFAL
KATG_PSELT        VGGLRVLGAVYS--YKN--YGVLTHTVGTLTNDFFVNLLDMNIEWKQIDEHRY---LFEG
KATG_ARCFU        IGGMRALGANYS--HSD--YGVLTERPGVLSNDFFVNLLDMSVEWRAADDYRY---TFEG
B5Y4Y9_PHATC      LGGLRVLKANTG--NSE--MGVFTKNPETLTNDFFVNLLDINTTWSSVEQDKN---LFDG
B8CF21_THAPS      LGGMRVLNANTD--NSN--IGVLTERPGALTNDFFVHLLDENTNWTSMNDGK----LFRG
KATG3_MYCS2       LGGLRVLGANHG--GSP--LGVFTASPGALSNDFFVNLLDVNIEWTPRADTADWTAAYEG
KATG_MYCGI        IGGLRALGANHG--GSK--HGVFTDKPGVLSNDFFLNLLDMRTEWKPSELSEN---VFDG
KATG1_MYCVP       IGGLRTLNANHG--GSK--HGVFTERPGVLSNDFFVNLLDMGTEWKPSELTEN---VYDG
KATG_MYCSS        LGGLRVLNVNHG--GSK--HGVFTNSPGALSNDFFVNLLDMNTAWKPSENTEN---VFEG
KATG1_MYCFO       VGGLRALNTNHG--GSK--HGVFTANPGALSNDFFVNLLDMSTEWKPSETAEN---VYEG
KATG_MYCIT        VGGLRALGANHG--SSK--HGVFTDRPGALTNDFFVNLLDMGTEWKASETAEN---VYEG
KATG_MYCUA        VGGLRALGANHG--GSE--HGVFTDKPGVLSNDFFVNLLDMGTEWKASDAAEN---VYEG
KATG2_MYCS2       VGGLRALDVNHG--GTK--HGVFTDRPGALTNDFFVNLLDMGTEWKTSETTEN---VYEG
KATG_RHOJR        VGGLRALNANFG--QTK--HGVFTDRPEALTNDFFVNLLDMGTEWKGASSAEN---VYEG
KATG_NOCSJ        VGGLRALGNNVG--GSG--HGVLTDRPGVLTNDFFANLLAPGAQWKASESEAN---VYEI
KATG_SALTO        IGGLRALEANAG--GSR--HGVLTDRPGVLTNDFFTNLLASGARWKASESTEH---AYEI
KATG1_CUPPJ       VGGMRMLDANHG--QSR--HGVFTDKPGTLSNEFFVNLLDIGTAWRPSVADKS---VYEG
KATG_FRACC        VGGLRVLGANYQ--QSP--LGVFTATPGSLTNDFFVNLLELGTTWKTTSEDAN---TFEG
KATG_FRASN        VGGLRVLGANFR--QSS--LGVLTATPGVLTNDFFANLLDLGTTWRPSGEDDN---VFEG
KATG_STRCO        VGGLRVLGAGHQ--QSQ--LGVFTRTPGSLTNDFFVNLLDLGTTWKSTSEDRT---TFEG
KATG_STRRE        VGGLRVLGANHQ--QSQ--LGVFTKTPGVLTNDFFVNLLDMGTTWKATSEDQT---TFEG
KATG_STRGG        VGGLRVLGANTG--GSK--HGVLTDRPGTLTNDFFVNLLDLGITWKSTSSAQD---EFEA
KATG_SACEN        VGGLRVLGANYQ--QSE--QGVFTEKPGTLTNDFFVNLLQMGNTWKATDETSE---TFEA
KATG2_MYCFO       IGGLRVLGANHG--GSE--LGVLTDKVGQLTNDYFVNLTDMGTKWAPAPADDG---TYVG
KATG2_MYCVP       IGGLRALGITHG--DSK--LGVLTDTPGQLTNDYFVNLTDMGVKWAPAPADDG---TYVG
KATG1_MYCS2       VGGLRVLDVNHG--GTK--HGVLTDKPGALTTDFFVNLLDMSTAWKPSPADDG---TYIG
KATG_MYCA9        VGGLRVLGANYQ--GSE--LGVLTDRPGTLTNDFFVNLVDMGTEWTPSPADDG---TYVG
KATG_MYCTU        VGGLRVLGANYK--RLP--LGVFTEASESLTNDFFVNLLDMGITWEPSPADDG---TYQG
KATG_NOCFA        VGGLRVLNANYQ--RSP--LGVLTETPESLTNDFFVNLLDMGVVWEPSPADDG---TYVG
KATG_GLOVI        VGGLRVLGANYG--GSK--LGVFTERPETLTNDFFVNLLKTSTSMKWEASPDAD--VFEA
KATG_KORVE        VGGLRVLGANYG--HSK--HGVFTSHPETLTNDFFVNLLDMNN--RWQPSGADG--VYEA
KATG_CAUSK        VGGLRALNANTD--QSS--HGVFTTRPGSLTNDFFVNLLDMRTVWTATSEDEA---QFEG
KATG_MARMS        LGGLRVLNANVG--QSQ--HGVFTDKPETLSNDFFVNLLDMGTKWFATSEEEE---EFQG
KATG1_ALKMQ       VGGMRVLNANYN--KSQ--QGVLTKRPENLTNDFFVNLLDMDTAWKVTAEGGD---MFEG
KATG_DESHY        LGGLRVLNANYG--QSK--HGVFTQRPETLTNDFFVNLLDMGTEWKAVSEEKA---LYEG
KATG_PELCD        VGGMRVLNTNHG--GTP--HGVFTDRPETLTNDFFVNLLDMGTTWQPTAEDAD---IFEG
KATG_PELPD        LGGMRVLNANYG--QSR--HGVFTKRPETLTNDFFLNLLDMGTVWKATSEAGD---LFEG
KATG_GEOLS        IGGMRVLNANFG--NAR--HGVFTKRPEALTNDFFVNLLDMATIWKATSEDQD---LFEG
KATG_GEOSL        IGGMRVLNANYG--QSK--HGVFTRQPETLTNDFFVNLLDMGTVWQPTAADKD---LFEG
KATG_DESOH        IGGMRVLNANYG--QSP--HGVFTKRPETLTNDFFVNLLDMGTVWNPAKADDC---VFEG
KATG_CLOBB        IGGMRVLNCNYN--KSK--DGVFTNRPECLTNDFFVNLLDMNTVWKPKSEDKD---RFEG
KATG_PROA2        LGGLRVLGANFQ--QSP--HGVFTTQPETLTNDYFVNLLDMGTEWKPLSKEQD---TFEG
KATG_AZOSB        VGGLRVLGANAG--GSP--HGVFTRRPQTLSNDFFVNLLDMSTAWKPAGDS------FEG
KATG_DECAR        VGGLRVLGGNVG--GSS--DGVFTTTPGTLSNDFFVNLLDMGTVWKPAAESAG---RYEG
KATG_SYNSC        LAGLRVLGANNG--GNR--QGVLTDRVGVLSNDFCVNLLDMSIRWSPTSEAME---GYIG
KATG_SYNPW        LAGLRVMGANTA--GNR--QGVFTQNVGVLSNDFCVNLLDMTTRWTPTSEAQD---AYIG
KATG_SYNR3        IGGFRVLGLNWD--GSD--IGVFTSRPGQFSNDFFVNLLDMSTQWSPVEGHSN---LYQG
KATG_PSYIN        IGGMRVIGTNQG--GTKH--GVLTEHEGTLSNDFFVNLTDMNYTWKPTG-----NNLYEI
KATG_SYNP2        VGGMRVLGTNYG--GTKH--GVLTDREGALTNDFFVNLTDMKYTWKPAG-----KNLYEI
KATG_SYNP6        IGGLRVLGTNHG--GTKH--GVFTDREGVLTNDFFVNLTDMNYLWKPAG-----KNLYEI
KATG1_VIBPA       VGGMRVLGTNHG--GSKH--GVFTDRVGQLTNDFFINLTDMKYTWEPVG-----ENLYEI
KATG_SHEDO        VGGMRVIGTNYA--ETGH--GVFTERKGALTNDFFVNLTDMNYIWKPIG-----QNEYEI
KATG_SHEHH        LGGMRVLGTNYN--GESH--GAFTEHQGALTNDFFVNLTDMNNTWQPVS-----NNLYEI
KATG_AERS4        VGGMRVLGTNHG--GTRH--GVFTEREGALTNDYFVNLTDMANTWHPSG-----DRLYEV
KATG_ALKEH        IGGMRVLGTNHG--GTQH--GVFTDREGQLTNDFFVNLTDMNYAWEPVG-----NNLYEI
KATG_HALHL        VGGMRVLGTNHG--GTKH--GVLTDREGQLTNDFFVNLTDMAYTWKPVG-----SNRYEI
KATG_PECAS        VGGLRVLGTNYG--GTKH--GVFTDREGALTNDFFVNLTDMKYTWKPYR-----KDLYEI
KATG_RHOS5        LGGMRVLGTNHG--GTKH--GVLTDREGALTTDFFVNLTDMANVWKPAD-----ANLYEI
KATG1_LEGPL       VGGLRVLGTNHN--NTQH--GVFTDRVGALTNDFFVNLTDMANVWIPSK-----DNLYEI
KATG_EDWTA        IGGMRVLGANYG--GSKV--GVFTDRIGVLSNDFFVNLTDMSYTWKPTA-----SNLYEI
KATG_LEPCP        VGGLRVLGANHG--GSKH--GVFTDRVGALTNDFFVTLTDMAHAWVPTG-----RNSYEI
KATG_VIBCH        IGGMRVLGTNYG--GSQH--GVFTDRVGALTNDFFVNLTDMSYTWKPTG-----RNSYEI
KATG_VIBVY        IGGLRVIGTNHG--DNKH--GVFTDNVGALSNDFFVNLTDMRYTWKPTG-----RNSYDI
KATG_POLAQ        IGGMRVLGTNYG--GSKQ--GVFTEKEGVLSNDFFVNLTDMNYLWKPTG-----QNSYDI
KATG2_VIBPA       IGGLRVLGSNYG--GSKD--GVFTDRVGTLSNDFFVNLTDMAYTWKPAG-----ENQYEI
KATG1_SHEAM       IGGMRAMAVNHG--GTTH--GVLTDNPGSLSNDFFVNLTDMSYRWKPVA-----NNLYEI
KATG_AGRFC        IGGLRVIGANYG--GAAH--GVFTDKPGALTTDFFTTLTDMAYSWVPTG-----NNLYEI
KATG_PARDP        IGGLRVIGTNHG--GTKH--GVFTQRKGALTNDFFVTLTDMANNWVPVG-----NNLYEI
KATG_CHRSD        IGGMRVLGTNHG--GTRH--GVFTDREGQLTNDFFVNLTDMGNTWKPAG-----NNVYEI
KATG_MARHV        IGGMRVLGTNHG--GTKY--GVFTDREGQLTNDFFVNLTDMAYSWKPVG-----NGTYEI
KATG_HYPNA        LGGMRVMGTNHG--GTKH--GVFTDKVGALTNDFFVNLTDMANKWVPRG-----KNAYDI
KATG_MARMM        VGGMRVLGTNYG--GTKH--GVFTDREGALTTDFFVNLTDMAYSWVPVD-----RRTYEI
KATG_PARL1        VGGMRVMGTNHG--GTRH--GVFTDREGALTNDFFVNLTDMGNSWVKNG------GHYDV
KATG_DINSH        VGGLRVLGANHG--GSAH--GVFTDRVGTLTTDFFQTITDMAYKWVPLD-----DGTYEI
KATG_ROSDO        VGGMRVLGVNHG--NSKH--GVFTDRAGQLTPDFFVNLTDMAYSWHPVDG----ENTYEI
F2I1Y2_PELSM      VGGMRVLGTNHA--SAKNK-GVLTNKIGTLTNDFFVNLVDMKYSWNPTG-----KNSYDI
KATG1_SHEON       IGGMRVLGTNHG--GTRH--GVFTDKVGVLSNDFFVNLTDMAYSWKPVG-----TNLYEV
KATG_SHESW        IGGMRVLGANYA--GSAH--GVFTDRVGVLSNDFFVNLTDMSYNWKPAG-----NNLYQI
KATG1_SHEFN       VGGMRVLGANYD--NSKH--GVFTDNVGVLSNDFFVNLTDMSYNWKPAG-----KNLYHI
KATG1_CELJU       VGGMRVLGANYG--GSKN--GVFTDKVGVLSNDFFVNLTDMAYQWKPTG-----KNSYNI
KATG_SYNY3        IGGMRVLGTNHG--GTKH--GVFTDRVGVLSNDFFVNLTDMAYQWRPAG-----NNLYEI
KATG1_IDILO       VGGMRALGANYG--ESEH--GVFTDRVGTLTNDFFVNLTDMNNVWKKAD-----DH-YEV
KATG_VIBCB        IGGMRVLGTNYG--GTSQ--GVFTDNVGALTNDFFVHLTDMSYTWHPAG-----DNQYEI
KATG_BACHD        IGGMRALGANYG--GTQH--GVFTDCVGTLTNDFFVNLLDMGIEWKPVD-----YNLYEG
KATG_GEOKA        VGGLRVLGANYR--DLPH--GVFTDRIGVLTNDFFVNLVDMNYEWVPTE-----GGIYEI
KATG_ERYLH        VGGMRALGAVSRHADHGDRIGVLTDRPGQLTNDFFVNLLDMGTKWEVVDES-G-DEEFVG
KATG_SPHAL        IGGLRVLGANHGERGHGH----FTRRSGQLTNDFFVNLLDMTNVWKAVEGS-N-DQEYVA
KATG_PHEZH        VGGLRVLGVNHGGSKNGV----FTDRPGQLTNDFFVNLLDMGTAWKQVDDK-A-DDLFVG
KATG_ARCB4        VGGMRVLGANYA--NSDL--GVFTSNVGVLSNDFFVNLLDMKTAWYPTTQE---EDSFVG
KATG_RUEPO        VAGLRVLGANHG--GSAH--GVLTNRPGVLSSDFLTNLLDMGTEWKPSGKG-----VYEG
KATG_RUEST        VGGLRAIGANYG--DSAH--GVLTSRKGQLTNDFFVNVLDLGTKWTATDDSG---EIFEG
KATG_JANSC        VGGLRAIGATHG--GARH--GVLTETPGALNNAFFKNVLSMDTVWNQTDSA-----ILEG
                   .*:* :                *     :       :                      

KATG_ECOLI        RDRETGEVKFTASRADLVFGSNSVLRAVAEVYASSDAHEKFVKDFVAAWVKVMNLDRFDL
KATG_SALTY        RDRLTGEVKYTATRADLVFGSNSVLRALAEVYACSDAHEKFVKDFVAAWVKVMNLDRFDL
KATG_ENT38        SDRASGEVKYTATRADLVFGSNAVLRALAEVYASQDASEKFVKDFVAAWTKVMNLDRFDV
KATG_CROS8        RDRESGEVKYTATRADLVFGSNSVLRSFAEVYASQDAHEKFVKDFVAAWTKVMNLDRFDI
KATG_ERWT9        YDRKSGEVRYSATRADLVFGSNAILRASAEVYASADAQQKFITDFVAAWGKVMDLDRFDI
KATG_KLEP7        SDRKTGEAKYSATRVDLVFGSNSVLRALAEVYACADGQQKLVHDFVAAWTKVMNLDRFDL
KATG_ACIBC        KDRKSGTVKFTATRNDLVFGSNSILRALAEVYAQADGKEKFVQDFVAAWTKVMNLDRFDL
KATG_PSEMY        RGRKDGQVKYTATRNDLVFGSNSILRAYAEVYASSDGKEKLVKDFVAAWTKVMNLDRFDL
KATG_METPP        KDRQTGQQKWTATRVDLAFGSNAVLRALAEVYASADGQTKFVHDFVAAWTKVMNLDRYDL
KATG_JANMA        RDRKSGEVKWTATRADLVFGSNSILRSVAEVYAESDAKEKFVKDFVAAWVKVMNADRFDL
KATG_AZOC5        RDRQTGELKWTGTRVDLVFGSNSILRALAEVYAASDAKDKFVTDFVAAWTKVMNLDRFDL
KATG_RALPJ        YDRKTGERKWTGTRVDLVFGSNSILRALAEVFGSADGKERFISEFVAAWVKVMNLDRFDL
KATG_ACIAC        RDRKTGEKRWTGTRVDLVFGSNSVLRSLAEVYASADAKEKFVRDFVAAWAKVMDLDRFDL
KATG_PARPJ        RDAKTGSVKWTGSRVDLVFGSHAQLRALSEVYASEDGKEKFVRDFVAAWVKVMNLDRFDL
KATG_PARXL        RDRKTGELKWTGTRVDLVFGSHAQLRALCEVYASEDAQEKFVRDFVAAWAKVMDLDRFEI
KATG_CUPNH        RDAKTGAKKWTGTRVDLVFGSNSQLRALCEVYASEDGQEKFVRDFVAAWAKVMNLDRFDV
KATG2_BURCJ       RDRRTGELKWTGTRVDLVFGSNAVLRALSEVYASADGEAKFIRDFVAAWVKVMNLDRFDL
KATG_BORA1        HDRKTGKQKWTASRVDLVFGSNSQLRALSEVYASDDAQDKFVRDFIAAWTKVMNLDRFDL
KATG_HERSE        RDRKTGAVKWAGTRVDLVFGSNAVLRALAEVYASADAKEKFVKDFVAAWVKVMELDRFDL
KATG_XANCP        RDRATGEHKWTGTRVDLVFGSNSILRAVAEVYASADAQEKFVQDFVAAWTKVMQLDRFDL
KATG_XANC5        RDRSTGELRWTGTRVDLVFGSNSILRAVAEVYASADAQEKFVHDFVAAWTKVMQLDRFDL
KATG_XYLFA        RDRRTGVLKWTGTRVDLVFGSNALLRALAEFYAAVDAQEKFVRDFVAAWSKVMHLDRFDL
KATG1_MAGO7       TNSKS-GKKLTGTRADLVFGSHSELRALAEVYGSADGQQKFTKDFVAAWDKVMNLDRFDV
KATG_NEUCR        YDRKTHDKKWTATRADLIFGAHAELRALAEVYAAVDGEEKFKRDFVAAWHKVMNLDRFDL
C7ZHZ3_NECH7      SDRKTGAKKWTGTRVDLVFGSHAELRALSEVYAEAGGDEKLVKDFVAAWVKVMNLDRFDI
KATG2_MAGO7       TDRKSRSEKYKGSRADLVFGSHAELRAIAEVYAENGNQEKFVKDFVAAWTKVMNLDRFDL
C7ZIK0_NECH7      TDRKTKAKKWTATRADLVFGSHAELRAISEVYGSADAKEKFVKDFVATWDKVMNLDRFDV
KATG_FLAJ1        NDRSTGQPKWIATRADLVFGSNSELRAVAEVYASTDANEKFVNDFIKAWTKVMNLDRFDL
KATG_METI4        RDRKTGTLLWTATRVDLIFGSNSELRAISEVYGAADAQDKFVKDFISAWNKVMNLDRFDL
KATG_PSEE4        RDRKTGAVKWTGSRVDLVFGSHAQLRALSEVYGSGDAAAKFVKDFVAAWVKVMELDRFDL
KATG_PSEPF        RDRKTGSVKWTATRVDLVFGSNSVLRALAEVYASSDAKEQFVTDFVAAWAKVMDLDRFDL
KATG_PSESM        RDRKTGEVKWTGSRVDLVFGSHAQLRAISEVYGSADAQERFVKDFVAVWTKVMNLDRFDL
KATG2_BURCC       RDRATGELKWLASRVDLVFGSHSQLRALSEVYGSEDSQQKFVRDFVAAWTKVMNADRFDI
KATG2_CUPPJ       YDRATGKLKWTGTRVDLIFGSNSELRAVAEVYGCADAKEKFVQDFVAAWNKVMNLDRFEA
KATG_CUPMC        SDRATGTPRWTGTRVDLVFGSNSELRAVAEVYGAADAQEKFVQDFVAAWSKVMNLDRFDL
KATG_PSEF5        SDRATGQYKWSGTRVDLLLGSNSQLRALAEVYAAADAGEQFVKDFVAAWDKVMNLDRFDL
KATG_BURL3        RDRATGQVKWTGSRVDLIFGSHAQLRALAEVYGSADAKEKFAHDFVAAWNKVMNLDRFDL
KATG1_BURVG       RDRASGQLKWTGTRVDLIFGSHSQLRALAEVYGSADANEKFVRDFVAAWNKVMNLDRFDL
KATG_BURM1        RDRATGELKWTGTRVDLVFGSHSQLRALAEVYGSADAQQKFVHDFVAAWNKVMNLDRFDL
KATG_BURPS        RDRATGELKWTGTRVDLVFGSHSQLRALAEVYGSADAQEKFVRDFVAVWNKVMNLDRFDL
KATG_SERP5        QDSQTGALKWTATRADLIFGSHSQLRALAEVYGSSDAQASFVYDFVAAWNKVMNLDRFDL
KATG_RALSO        RDRATGALKWTGTRVDLVFGSHSQLRALAEVYGSADAQAKFVRDFVAAWDKVMNLDRFDL
KATG_HAHCH        RDRVTGDLKWTGTRIDLVFGSNSQLRALAEVYASSDAQERFLKDFVAAWTKVMNLDRFDL
KATG_SHEB8        VDRVSGQPKWTASRVDLIFGSNSQLRALAEVYASSDAQLRFIDDFIAAWTKVMNLDRFDL
KATG_METB6        SDRKTGEPKWTGTRVDLIFGANAQLRAIAEVYASADGEEKFAQDFVAAWAKVMNLDRFDL
KATG_METAC        CDRKTGEVKWTGTRVDLIFGSNSQLRALAEVYGSADAQEKFVQDFVAAWTKVMNLDRFDL
KATG_METHJ        RDRRTGEIRWTGTRVDLIFGSNSQLRALAEVYACSDGKDKFIQDFVAAWAKVMNLDRFDR
KATG_CHLCH        RNRSTGELQWTATRVDLVFGSNSQLRALVEVYGCKDSQEKFLNDFIAAWNKVMNLDRFDL
KATG_SYMTH        RDRATGELKWTATRVDLIFGSNAQLRAIAEVYASNDGQEKFVQDFVKAWTKVMNLDRFDL
KATG_FLAPJ        RNRKTGELKWTGTRVDLIFGSNSELRALAEVYGCTDSQEKFVKDFVKAWDKVMNLDRFDL
KATG_GRAFK        SDRKTGDVKWTGSRADLIFGSNSELRAIAEVYGTDDVEAKFVKDFVKAWDKVMNLDRYDL
KATG_ACAM1        RDRKTGALKWTGTRVDLIFGSNSQLRALAEVYGCEDSQQRFVQDFVAAWDKVMNLDRFDL
KATG_POLSJ        RDRATGELKWTGTIVDLVFGSNSQLRALAEVYACSDSQKSFVRDFVAAWNKVMNLDRFDL
KATG_BRASO        RDRKSGAVKWTATRADLIFGSHSQLRALAEVYASSDAKQKFVKDFVAAWTKVMNLDRFEL
KATG_RHILO        RDRKTGEVKWTGTRADLIFGSHSQLRALAEVYATADAKAKFAKDFVVAWTKVMNADRFDI
KATG_BEII9        HDRKTKAVKWTATRVDLLFGSHAQLRALAEVYGCADAQTKFVTDFVAAWTKVMNADRFDL
KATG_CAUVC        HDRKSSEPRWTATRVDLIFGSHAELRAFAEVYACADSQEKFVCDFVTAWNKVMNADRLDL
KATG_PSEU5        LDRKTRQPTWTATRVDLIFGSQSELRAQAEVYGMADGNEKFVRDFAKAWDKVMNADRMDI
KATG_RHOP5        RDRKSGELKWTGTRVDLIFGSHSQLRAFAEVYAQADAKEKFVHDFVAAWTKVMNADRFDI
KATG_RHOPT        RDRKNGELKWTGTRVDLVFGSHSQLRAFAEVYACSDAQEKFVSDFVAAWSKVMNADRFDI
KATG_RHOPS        RDRKTGDLRWTGTRVDLIFGSHSQLRALAEVYGQSDAQTKFAQDFVAAWTKVMNADRFDL
KATG_RHOPB        RDRKSGEVKWTATRVDLIFGSHSQLRALAEVYAQADSKEKFVNDFVAAWTKVMNADRFDL
KATG_SOLUE        RDRKTNALKWTGTRVDLIFGSHSQLRAFAEVYAWAGSKEKFVKDFAAAWNKVMNLDRYDV
KATG_CHESB        RDRKTNELKWRATRVDLIFGAHSQLRALAEVYACGDSQEKFVQDFVAAWTKVMNADRFDL
KATG_NITHX        RDRKTNAVQWTGTRVDLIFGSHSQLRAFAEVYACTDAKEKFARDFVAAWTKVMNADRFDL
KATG_NITWN        RDRKTGTLKWTGTRVDLIFGSHSQLRAFAEVYACADSGEKFANDFAAAWAKVMNADRFDL
KATG_RHIL3        RDRKTNDVKWTGTRVDLIFGSHSQLRAFAEVYGQADTKEKFVRDFVAAWTKVMNADRFDL
KATG_SINMW        RDRKTGAARWTGTRVDLIFGSHSQLRAFAEVYAQTDAREKFVKDFVAAWTKVMNADRFDL
KATG_ACICJ        RDRKSGAVKWTATRVDLVFGSNSQLRALAEVYGTQDGEAAFVKDFVAAWTKVMELDRFDL
KATG2_SHEFN       FDRQSGHKKWTATSVDLVFGSNSELRAVSEVYAFDTSKQKFVEDFAAAWTKVMNLDR---
KATG_SHELP        LDRSSGKPKWTATSVDLIFGSNSELRAVAEVYAFDTSKQKFVDDFVAAWVKVMNLDR---
KATG_ALTMD        VNRSTGEVMYTGTPVDLVFGSNSELRAVAEVYAYDNAKTRFVEDFVDAWTKVMTLDRFDL
KATG_COLP3        HDRASGTEKWQATPVDLIFGSSSELRAIAEVYASDDADKKFINDFTKAWVKVMQLDRFDL
KATG_SHEWM        YDRKTGKLKWTATPVDLVFGSNTELRAISEFYASKNAEEQFITDFIAAWHKVMVNDRFDI
KATG2_SHEAM       FDRQSGKLRWTATPVDLIFGSHAELRAVAEVYGANDGKDRFVEDFIAAWTKVMNLDRFDI
KATG2_SHEON       QDRNSGKLKWTATPVDLIFGSHSELRAVSEVYGAQDGQDRFIQDFVKAWNKVMNADRFDI
KATG2_CELJU       LDRKTGKLKWTATPVDLIFGSHSELRAVAEVYAANDGQEKFVNDFVKAWHKVMMLDRFDW
KATG2_IDILO       FDRKTGEQKYTATTVDLIFGSNSELRAVAEVYAMSDADEKFVNDFVQAWTKVMQLDRFDL
KATG_PSEA6        IDRKSNKQRWSASSVDLIFGSNSELRAVAEVYASDDAHQQFVDDFVNAWTKVMTLDRFDL
KATG_LEPBP        LDRKTGSKRWTATSVDLIFGSHSELRAVAEVYASDDAKEKFVKDFVSAWNKVMMLDRFDV
KATG_NOVAD        LDRKTGKTRWTATPVDLVFGSNSELRAVSEVYGSADANAKFVNDFVAAWTKVMNLGRPS-
KATG2_BURVG       RDRKTGALRWTASPVDLVFGSSSELRAVAEVYASDDAHEKFVRDFVAAWTKVMNLDRFDL
KATG_GRABC        HDRKTDALRWKGSTVDLIFGSNSELRAVAEVYASDDAKEKFVRDFVAAWNKVMTLDRFDL
KATG_ECOLX        FDRKTGALKWKASSVDLIFSSNPELRAVAEVYASDDARNKFIHDFVKSWNKVMNSDRFDL
KATG_YERPE        YDRKTGKLKWTASSVDLVFGSNPELRAVAEVYASDDAKEKFVHDFTKVWEKVMNLDRFDI
KATG_FRATT        IDRKTGKQKWTASPVDLIFGSNSELKAVAQVYAENGNEQKFVNDFAKAWHKVMMLGRFDV
KATG_SACD2        LDRNSGKVKWTATSADLIFGSNSELRAIAEYYSQSDSQKTFVQDFINAWSKVMTADRFDL
KATG2_LEGPA       YDRKTGKLKWKATSVDLIFGANSELRAVAEAYATDDAKEKFIQDFVNAWVKVMTADRFDI
KATG2_HALMA       LDRDTGEVKWEATRIDLIFGSNDRLRAISEVYGSADAEKKLVHDFVDTWSKVMKLDRFDL
KATG1_HALMA       YDRETGEQTWAASRVDLIFGSHSRLRAIAEVYGADGAEAELVDDFVDAWHKVMRLDRFDL
KATG_HALSA        RDRETGDVEWTGSRVDLLFGSNTRLRAIAEVYGSDADEELFVQDFVDTWSEVMKLDRFDL
KATG_NATPD        RDRETGEVEWEGTRFDLIFGSDSRLRAISEVYGADDGEAEFVEDFVDTWSKVMKLDRFDL
KATG_SALRD        RDRDTGEVKWKATRVDLIFGSNSRFRALSQVYGSGDAEEKFVDDFVDAWTKVMNLDRFDL
KATG_METRJ        KDRASGQTKFEATRSDLVFGSNAQLRSIADAYAGSDGQRRFVADFVKAWDKVMMLDRFDV
KATG_PSELT        FNRKTKEPEFKATRVDLIFAHHDELRAVAEVYASDDEKEKFVSDFIKTWDKVMTLDRFDL
KATG_ARCFU        YDRKSGELRWRATRVDLILGHHDELRAVAEVYGCDDAKEKFVKDFAAVCAKVMHLDRFDL
B5Y4Y9_PHATC      LEYGTGKLNWKASRFDLIFGSNSELRAIAEYYGSDDSNEVFLKDFVKAWTKVMELDRFDL
B8CF21_THAPS      RTSRDK--NWIASRVDLLLGSNSQLRAIAESYACTDSTKFFVKDFLSVWSKVMMLDRFDM
KATG3_MYCS2       RDRRTGEVTWIASRVDLSFASDPVLRAISEVYASADAEEKFVRDFVSAWDKVMNLDLFDR
KATG_MYCGI        KDRATGETKWTATANDLVFGSNSVLRALAEVYAQDDNQGKFVEDFVAAWVKVMNNDRFDL
KATG1_MYCVP       KDRATGQPKWTATAADLVFGSNSVLRAVVEVYAQDDNQGKFVEDFVAAWVKVMNNDRFDL
KATG_MYCSS        RDRATGEIKWTATANDLVFGSNSVLRGIAEVYAQDDSKDKFVEDFVAAWVKVMNNDRFDL
KATG1_MYCFO       RDRRTGQTRWTATANDLVFGSNSVLRAVAEVYAQEDNKAKMIEDFVAAWVKVMNNDRFDL
KATG_MYCIT        RDRASGALKWTATANDLVFGSNSVLRGLVEVYAQDDAHGKFVEDFVAAWVKVMNSDRFDL
KATG_MYCUA        CDRSSGQLKWTATANDLVFGSNSVLRALAEVYAQSDAKQKFAEDFAAAWAKVMNNDRFDL
KATG2_MYCS2       VDRKTGQLKWTATANDLVFGSHSVLRAVAEVYAQSDNGERFVNDFVKAWVKVMNNDRFDL
KATG_RHOJR        TDRVTGAAKWTATAVDLVFGSNSQLRALAEVYAADDAQQKFVQDFVSAWNKVMNLDRFDL
KATG_NOCSJ        RDLASGELRWTATAVDLIFGSNSQLRSLAEVYASADAREKFVRDFVAAWVKVMDADRFDL
KATG_SALTO        RDVATDKVKWTASAVDLIFGSNSQLRALAEVYASEDAREKFVQDFVAAWTKVMELDRFDL
KATG1_CUPPJ       IDRTSGKTRWTATAADLVFGAHSQLRALAEVYACDDGKERFVRDFVAAWNKVMNLDRYDL
KATG_FRACC        RDAATGKVRWTGSRADLVFGSNSELRALAEVYASDDAREKFVHDFVAAWVKVMNLDRFDL
KATG_FRASN        RDAATGELTWTGSRVDLVFGSNSELRAFAEVYASDDAREKFVRDFVAAWAKVMNLDRYDL
KATG_STRCO        RDAATGEVKWAGSRADLVFGSNAELRALAEVYASDDAGEKFVHDFVAAWVKVMNLDRFDL
KATG_STRRE        RDAATGEVKWAGSRADLVFGSNSELRALAEVYASDDAKEKFVKDFVAAWHKVMDADRFDL
KATG_STRGG        RDA-SGKVKWTGTRADLVFGSNSELRALAEVYAGDDARQKFVTDFVAAWSKVMDLDRFDL
KATG_SACEN        TDA-SGQVKWTGTRFDLVFGSNSELRAVAEVYASDDAKEKFVRDFVAAWDKVMNLDRFDL
KATG2_MYCFO       TDRATGSPKWTASRVDLLFGSNSQLRALAEVYAEDDSKEKFVKDFVAAWTKVMNADRFDL
KATG2_MYCVP       TDRDTGEVKYTASRVDLLFGSNSQLRALAEVYAEDDSRDKFVKDFVAAWVNVMDADRYDI
KATG1_MYCS2       TDRATGSPKWTGTRVDLVFASNSQLRALAEVYAEDDSKEKFVKDFVAAWTKVMDADRFDV
KATG_MYCA9        TDRATGASKWTASRVDLVFGANSELRALAEVYAQDDAQEKFAKDFVAAWVKVSDADRFDV
KATG_MYCTU        KD-GSGKVKWTGSRVDLVFGSNSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDV
KATG_NOCFA        KDAATGAQKWTGSRVDLLFGSNSVLRSLAEVYATDDAKPKFVQDFVAAWNKVMNLDRFDL
KATG_GLOVI        SDRATGEKKWAGTRVDLIFGSNSQLRALSEAYATADAQQTFVDAFVAAWTKVMNLDRFDL
KATG_KORVE        RDRQGDHVKWTATRVDLIFGSHSQLRAFAEVYACNDAKEKFVHDFVAAWTKVMNLDRYDL
KATG_CAUSK        RDRTTGDLKWTATRVDLIFGSNSQLRALAEVFAQSDSQGAFVGAFVAAWTKVMNLDRFDL
KATG_MARMS        RDRTTGKIKWTATRADLVFGSNSQLRAIAEVYACSDSQERFVKDFIAAWTKVMELDRFDL
KATG1_ALKMQ       IDRKTGELKWTGTGVDLVFGSNSELRAIAEVYASDDAKQKFVEDFVTAWNKVMNADRFDL
KATG_DESHY        RDRATGELKWTGTRVDLVFGSNSQLRALAEVYACSDSQDKFLQDFVSAWNKVMNADRFDL
KATG_PELCD        CDRATGELKWTGTRIDLVFGSNSQLRAIAEVYGCADSGEKFVNDFVAVWSKIMNLDRFDL
KATG_PELPD        RDHTSGELKWTATRVDLIFGSNSQLRALAEVYGSGDSQEKFLHDFVAVWEKVMNLDRFDL
KATG_GEOLS        RDRTSGELKWTATRVDLIFGSNSQLRAIAEVYGCEDSQEKFLQDFAAAWDKVMQADRFEL
KATG_GEOSL        RDRVSGELKWTGTRVDLIFGSNSQLRAVAEVYGCADSQEKFLNDFVAAWNKVMNLDRFDL
KATG_DESOH        RDRQTGALRWTGTRVDLLFGSNSQLRAIAEVYACKDAGEKFVNDFVAVWNKVMNADRFDL
KATG_CLOBB        FDRETGELKWTATRVDLIFGSNSQLRAIAEVYACDDNKEKFIQDFIFAWNKIMNADRFEI
KATG_PROA2        RDRKTGEPRWTATRVDLIFGSNSRLRAIAEVYGSDDAQEKFVHDFVAAWDKVMNLDRFDL
KATG_AZOSB        RDRKSGELKWTATRVDLVFGSNSQLRALAEVYAQDDAKEKFVRDFVAAWNKVMNLDRFDV
KATG_DECAR        RDRQTGVAKWTASRVDLIFGSNSQLRALAEVYAQNDAQEKFVRDFIAAWSKVMELDRFDL
KATG_SYNSC        RD-AQGSERWTASRADLVFGSNSQLRAIVEVYAQDDGASRFVSDFVQAWVKVMNLDRFDV
KATG_SYNPW        RDSATGAERWSASRADLVFGSNSQLRAIVEVYAQNDGGSRFVADFVKAWVKVMELDRFDL
KATG_SYNR3        IDTETKQPRWRASRVDLVFGSHAQLRAIAEVYGQAGGSARLAADFSAAWSKVMELDRFDL
KATG_PSYIN        RDRKTDKVKWTATRVDLVFGSNSILRAYAEVYAQDDNKEKFVQDFVSAWTKVMNADRFDL
KATG_SYNP2        GDRHTGEVKWTATRVDLVFGCNSILRAYAEVYAQDDSNEKFIQDFVAAWTKVMNADRFDL
KATG_SYNP6        CDRKTNQVKWTATRVDLVFGSNSILRAYSELYAQDDNKEKFVRDFVAAWTKVMNADRFDL
KATG1_VIBPA       RSRRSKDVKWTATRVDLVFGSNSILRAYAELYAQDDNAGKFVEDFVAAWTKVMNADRF--
KATG_SHEDO        CERETGKRKWTASRVDLIFGSNSVLRSYAEVYAQDDNKQKFVNDFISAWTKMMNADRFDV
KATG_SHEHH        SDRETAKLKWTATRVDLVFGSNSILRAYAEVYAQDDNQQKFVEDFVTTWAKVMNSDRFDL
KATG_AERS4        RDRKSGKVKWTATRIDLVFGSNSVLRAYAEVYAQDDNKEKFVCDFISAWNKVMNADRFDL
KATG_ALKEH        RDRKTGETRWTATRVDLVFGSNSILRSYAEVYAQDDNKEKFVKDFVAAWNKVMNADRFDL
KATG_HALHL        RQRSSDAVKWTATRVDLVFGSNSILRSYAEVYAQDDNREKFVHDFVAAWTKVMNADRFDL
KATG_PECAS        RDRKTGEVKWTATRLDLVFGSNSILRAYAEVYAQDDSKEKFVNDFVAAWVKVMNADRFDL
KATG_RHOS5        RDRRTGAVKWTATRVDLVFGSNSVLRAYAEVYAQDDSREKFVQDFVAAWAKVMNADRFDI
KATG1_LEGPL       RDRKTGNIKWTATRVDLVFGSNSILRSYAEVYAQDDNKEKFVKDFVAAWTKIMNADRFDL
KATG_EDWTA        RERANGALKWTASRVDLVFGSNSILRAYAEVYAQDDNKEKFVRDFVAAWTKVMNADRYDL
KATG_LEPCP        RERASGVVKYTATRADLVFGSNSVLRAYAEVYAQDDSREKFVRDFVAAWVKVMNADRYEL
KATG_VIBCH        VERKSGKVKWTATRVDLVFGSNSILRAYAEVYAQDDNKEKFVKDFVAAWTKVMNADRFDL
KATG_VIBVY        VERNSGNVKWTATRVDLVFGSNSILRAYAEVYAQDDNKEKFVKDFVAAWTKVMNADRFDI
KATG_POLAQ        VERNTEKTKWTATRADLVFGSNSILRAYAEVYAQDDNKEKFVNDFIAAWTKVMNADLFN-
KATG2_VIBPA       RDRKTDQVKWTATRVDLVFGSNSILRSYAEVYAQDDNQEKFIHDFVAAWTKVMNADRFDL
KATG1_SHEAM       CDRASGQKKWTATRVDLVFGSNSVLRAYAEYYAQDDNKETFVKDFVTAWCKVMNADRFDA
KATG_AGRFC        RDRKTGAARYSATRVDLVIGSNSILRAYAEVYAQDDNREKFARDFIAAWTKVMNADRFDL
KATG_PARDP        RDRKTGATRYTATRVDLVFGSNSILRAYAEVYAQDDNAGKFVRDFVAAWTKVMNADRFDL
KATG_CHRSD        RDRETDAVKWTASRVDLVFGSNSLLRSYAEVYAQDDNEEKFVNDFVAAWTKVMNADRFDV
KATG_MARHV        RDRKTDQTKWTASRVDLVFGSNSILRSYAEVYAQDDNGEKFVKDFIAAWTKVMNNDRFDV
KATG_HYPNA        TDRKSGAVKFTATRADLVFGSNSILRAYAEIYAQDDAKEKFVKDFVAAWSKVMDADRFDL
KATG_MARMM        RDRKTGKARWTATRADLVFGSNSILRAYAEVYAQDDNAGKFVADFVAAWTKVMNADRFDL
KATG_PARL1        RDRKTGKTKWTATRVDLVFGSNSILRAYSEVYAQDDAKEKFVKDFVAAWTKVMNADRFDL
KATG_DINSH        RDRKSGDTVYTATSADLVFGSNSQLRAIAEVYAQDDNETKFVRDFVAAWTKVMNADRFDL
KATG_ROSDO        RDRATGAVKWTATSADLVFGSNSVLRAYAEVYAQDDNAEKFVRDFVAAWTKVMNADRFDL
F2I1Y2_PELSM      IDRKTKKIKYTASRADLVLGSNSILRSYAEVYAQDDNKEKFVKDFVAVWTKVMNADLPKL
KATG1_SHEON       VERKTGTVKWTATRVDLVFGSNSVLRVYAEVYAQDDAKEKFVHDFVAAWTKVMNADRFDL
KATG_SHESW        IERKTGTVKWTATRVDLVFGSNSVLRSYAEIYAQDDAKEKFVHDFVNAWTKVMNADRFDL
KATG1_SHEFN       VDRSTDKVKWTATRVDLVFGSNSILRSYAEIYAQDDAKEKFVNDFVKTWTKVMNADRFDL
KATG1_CELJU       VERNTGTVKWSATRVDLVFGSNSILRSYAEVYAQDDNREKFVRDFVKAWVKVMNADRFDL
KATG_SYNY3        GDRQTGEVKWTATKVDLVFGSNSILRSYAEVYAQDDNREKFVRDFVAAWTKVMNADRFDL
KATG1_IDILO       RDRKTDELKWTASRIDLVFGSNSILRSYSELYAQDDNQEKFVKDFVKAWTKVMNADRFDL
KATG_VIBCB        RERASGQTKWTASRVDLVFGSNSVLRSYAEVYAQDDNKEKFVQDFVAAWVKVMNNDRFDL
KATG_BACHD        RDRKTGEVVRTATRVDLVFGSNSILRAIAEVYAQDDNKGKFVEDFIAAWVKVMNADRFDL
KATG_GEOKA        RDRQTGEVRWTATRVDLIFGANSILRSYAEFYAQDDNREKFVRDFINAWVKVMNADRFDI
KATG_ERYLH        KDRKSGDEKWRATRTDLVFGSNSQLRAQAEVFAESGNEQLFLDTFVKAWTKVMDADRFDV
KATG_SPHAL        TDRTTGGETWRATRADLIFGSNSELRAVAEVYAENGHEEKFVRDFVKAWTKVMNADRFDL
KATG_PHEZH        TCRRTHEEKWTATRTDLVFGSNSQLRALSEVYASDDAGERFVKDFVRAWTKVMNADRFDL
KATG_ARCB4        KDRQSGSMKYSASRVDLLFGSNSQLRAVSEVYAQEDSKEKFVQDFINAWTKVMNLDRFDI
KATG_RUEPO        RDRASGAARWTATRVDLVFGSNSQLRALAERYAQDDAEASFVADFVAAWVKVMNADRFDL
KATG_RUEST        ADRATGEVKWTGTRADLIFGSNSQLRALSEVYAQDDNAGKMVADFVKAWVKVMELDRFDL
KATG_JANSC        KDRASGQVKWTATIVDLVFGSNSQLRAVAEVYASADAEAKMVDDFVAAWVKVMENDRFDL
                             .:  ** :.    ::   : :.       :   *     ::   .    

KATG_ECOLI        L---------------
KATG_SALTY        Q---------------
KATG_ENT38        K---------------
KATG_CROS8        Q---------------
KATG_ERWT9        R---------------
KATG_KLEP7        ----------------
KATG_ACIBC        A---------------
KATG_PSEMY        A---------------
KATG_METPP        A---------------
KATG_JANMA        A---------------
KATG_AZOC5        A---------------
KATG_RALPJ        AAA-------------
KATG_ACIAC        R---------------
KATG_PARPJ        A---------------
KATG_PARXL        A---------------
KATG_CUPNH        A---------------
KATG2_BURCJ       A---------------
KATG_BORA1        K---------------
KATG_HERSE        K---------------
KATG_XANCP        A---------------
KATG_XANC5        A---------------
KATG_XYLFA        V---------------
KATG1_MAGO7       RRGIYDETRLKSKL--
KATG_NEUCR        KQEGRGQNAPKL----
C7ZHZ3_NECH7      GKAPTLNVSPRL----
KATG2_MAGO7       KVKK------------
C7ZIK0_NECH7      KAKN------------
KATG_FLAJ1        A---------------
KATG_METI4        APA-------------
KATG_PSEE4        K---------------
KATG_PSEPF        RQ--------------
KATG_PSESM        A---------------
KATG2_BURCC       KHN-------------
KATG2_CUPPJ       ANR-------------
KATG_CUPMC        K---------------
KATG_PSEF5        R---------------
KATG_BURL3        A---------------
KATG1_BURVG       A---------------
KATG_BURM1        V---------------
KATG_BURPS        A---------------
KATG_SERP5        A---------------
KATG_RALSO        A---------------
KATG_HAHCH        A---------------
KATG_SHEB8        RRA-------------
KATG_METB6        AQK-------------
KATG_METAC        A---------------
KATG_METHJ        IQ--------------
KATG_CHLCH        SGL-------------
KATG_SYMTH        LVKK------------
KATG_FLAPJ        V---------------
KATG_GRAFK        K---------------
KATG_ACAM1        A---------------
KATG_POLSJ        A---------------
KATG_BRASO        KA--------------
KATG_RHILO        AG--------------
KATG_BEII9        I---------------
KATG_CAUVC        AA--------------
KATG_PSEU5        GKPADQFSQKLSA---
KATG_RHOP5        VR--------------
KATG_RHOPT        VAKKQAA---------
KATG_RHOPS        AAK-------------
KATG_RHOPB        IAEPVLLEAAE-----
KATG_SOLUE        ARTGETKKAAVV----
KATG_CHESB        A---------------
KATG_NITHX        HR--------------
KATG_NITWN        KA--------------
KATG_RHIL3        V---------------
KATG_SINMW        V---------------
KATG_ACICJ        A---------------
KATG2_SHEFN       ----------------
KATG_SHELP        ----------------
KATG_ALTMD        RHDLNAKLAK------
KATG_COLP3        K---------------
KATG_SHEWM        K---------------
KATG2_SHEAM       ----------------
KATG2_SHEON       ----------------
KATG2_CELJU       ----------------
KATG2_IDILO       K---------------
KATG_PSEA6        ----------------
KATG_LEPBP        K---------------
KATG_NOVAD        ----------------
KATG2_BURVG       KRI-------------
KATG_GRABC        QRQ-------------
KATG_ECOLX        NNK-------------
KATG_YERPE        KNN-------------
KATG_FRATT        QQ--------------
KATG_SACD2        K---------------
KATG2_LEGPA       KAANTNINS-------
KATG2_HALMA       E---------------
KATG1_HALMA       E---------------
KATG_HALSA        E---------------
KATG_NATPD        E---------------
KATG_SALRD        E---------------
KATG_METRJ        KGHRRYGPMAA-----
KATG_PSELT        KV--------------
KATG_ARCFU        WRSNRKLYKEITAGLR
B5Y4Y9_PHATC      K---------------
B8CF21_THAPS      IPPVVEMNSRL-----
KATG3_MYCS2       T---------------
KATG_MYCGI        KQ--------------
KATG1_MYCVP       G---------------
KATG_MYCSS        EKF-------------
KATG1_MYCFO       D---------------
KATG_MYCIT        K---------------
KATG_MYCUA        E---------------
KATG2_MYCS2       K---------------
KATG_RHOJR        D---------------
KATG_NOCSJ        A---------------
KATG_SALTO        A---------------
KATG1_CUPPJ       LGTRNGRRAVTSKPV-
KATG_FRACC        V---------------
KATG_FRASN        A---------------
KATG_STRCO        A---------------
KATG_STRRE        V---------------
KATG_STRGG        V---------------
KATG_SACEN        A---------------
KATG2_MYCFO       EA--------------
KATG2_MYCVP       GKGA------------
KATG1_MYCS2       A---------------
KATG_MYCA9        R---------------
KATG_MYCTU        R---------------
KATG_NOCFA        A---------------
KATG_GLOVI        PR--------------
KATG_KORVE        AKKKAAAN--------
KATG_CAUSK        A---------------
KATG_MARMS        A---------------
KATG1_ALKMQ       A---------------
KATG_DESHY        A---------------
KATG_PELCD        A---------------
KATG_PELPD        A---------------
KATG_GEOLS        V---------------
KATG_GEOSL        A---------------
KATG_DESOH        A---------------
KATG_CLOBB        K---------------
KATG_PROA2        G---------------
KATG_AZOSB        K---------------
KATG_DECAR        K---------------
KATG_SYNSC        R---------------
KATG_SYNPW        RS--------------
KATG_SYNR3        L---------------
KATG_PSYIN        I---------------
KATG_SYNP2        A---------------
KATG_SYNP6        D---------------
KATG1_VIBPA       ----------------
KATG_SHEDO        S---------------
KATG_SHEHH        D---------------
KATG_AERS4        MS--------------
KATG_ALKEH        A---------------
KATG_HALHL        VA--------------
KATG_PECAS        AE--------------
KATG_RHOS5        A---------------
KATG1_LEGPL       A---------------
KATG_EDWTA        R---------------
KATG_LEPCP        QG--------------
KATG_VIBCH        V---------------
KATG_VIBVY        ----------------
KATG_POLAQ        ----------------
KATG2_VIBPA       Q---------------
KATG1_SHEAM       ----------------
KATG_AGRFC        I---------------
KATG_PARDP        AA--------------
KATG_CHRSD        A---------------
KATG_MARHV        QA--------------
KATG_HYPNA        A---------------
KATG_MARMM        A---------------
KATG_PARL1        KK--------------
KATG_DINSH        LA--------------
KATG_ROSDO        AA--------------
F2I1Y2_PELSM      N---------------
KATG1_SHEON       A---------------
KATG_SHESW        A---------------
KATG1_SHEFN       M---------------
KATG1_CELJU       K---------------
KATG_SYNY3        PRG-------------
KATG1_IDILO       ----------------
KATG_VIBCB        ----------------
KATG_BACHD        KLNKKAQLTSK-----
KATG_GEOKA        HLKQAKESVTV-----
KATG_ERYLH        TYAKYN----------
KATG_SPHAL        A---------------
KATG_PHEZH        PRAQRLARAA------
KATG_ARCB4        KK--------------
KATG_RUEPO        T---------------
KATG_RUEST        K---------------
KATG_JANSC        HR--------------