CLUSTAL format seed alignment for MF_01962

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ADE_YEAST       ---------MVSVEFLQELPKCEHHLHLEGTLEPDLLFPLAKRNDIILPE----GFPKSV
ADE_CANGA       ---------MVPESFLLELPKCEHHLHLEGTLEPDLLFPLAKRNNIQLPD----HFPQTP
ADE_KLULA       --MAKFECTDEVTNFLTELPKCEHHLHLEGTLEPELLFQLVERNGVQLPG----TFPKTV
ADE_CANAL       --MAQYECSEHMENFLRELPKCEHHVHLEGTLEPSLLFKLAKRNNITLPE----TFPKTV
ADE_ASPFU       MC------QSPLHDFLHGLPKCEHHVHLEGCVTPELIFQLAEKNNIQLPNPATHPAYASV
ADE_ASPOR       MC------KSDLHDFLHGLPKCEHHVHLEGCLAPDLIFELAKRNNVSLPN---EPAYESI
ADE_EMENI       MCPPNTPYQSQWHAFLHSLPKCEHHVHLEGCLEPPLIFSMARKNNVSLPSPSSNPAYTSV
ADE_SCHPO       MS------NLPIYNFIRKLPKCEHHVHLEGCLSPDLVFRLAKKNGITLPS--DDAAYTTP
ADE_GIBZE       MC------KSRVHSFLQALPKVEQHLHIEGTLEPELLFTLAEKNGIELPN---DPVYESA
ADE_CAUVC       -MTDASFAPSASAEFVRGLPKAELHMHIEGSLEPELMFELAQRNGITLPFA-------SV
ADE_CAUVN       -MTDASFAPSASAEFVRGLPKAELHMHIEGSLEPELMFELAQRNGITLPFA-------SV
ADE_SPHAL       -MPDGFASHEERAAFIAGLPKAELHLHIEGSLEPELLFEFARRNRVAIPFA-------SI
ADE_RHORT       --------MAVDPAFLHALPKVELHLHIEGSLEPEMMVALAERNGLRLPYA-------SV
ADE_STRCO       --------MKRPYDALMPLPKAELHLHIEGTLEPELAFALAARNGVSLPYA-------DE
ADE_PARPJ       -MTTTTVTPTPLAEKTALAPKAELHIHIEGSLEPELIFALAERNGVKLAYD-------SI
ADE_PARXL       -MTTTTVTSTPLAEKTVLAPKAELHIHIEGSLEPELIFALAERNGVKLAYD-------SI
ADE_CUPTR       -----MTIDAALAEQIRRTPKAELHVHIEGTLEPELIFRLAQRNQVALPYP-------SV
ADE_CUPNH       -----MTIDAALAEQIRRTPKAELHVHIEGTLEPELIFRLAQRNQVALPYP-------SV
ADE_CUPPJ       -----MTIDAALADKIRRTPKAELHVHIEGTLEPELIFRLAQRNHVNLPYP-------SV
ADE_CUPMC       -----MTIDAALADKIRRTPKAELHVHIEGTLEPERIFRLAQRNNVKLAYP-------DV
ADE_RALPJ       -----MPISSALAERIATSPKAELHIHIEGSLEPELMFALAERNGVKLPYA-------SV
ADE_RALSO       -----MPISPALAERIATSPKAELHIHIEGSLEPELMFALAERNGVKLPYA-------SV
ADE_GEOLS       -MNLTNIPRQALPELLCRMPKAELHIHIEGSLEPELIFALAERNRLQLAYP-------TI
ADE_GEOUR       -MNFDCIPREDLHGILCHMPKAELHIHIEGSLEPELIFELATRNRIQLPYP-------TI
ADE_RHOFT       -MTIKPVSQERLPELLRTIPKAELHIHIEGSLEPELMFALAQRNGVSIPYP-------DV
ADE_ZYMMO       --------MNNLIKFIAALPKAELHLHIEGSLEPELMFELAKRNKVTLPFP-------DV
ADE_ACIAD       ---------MNQSELIRALPKAELHVHIEGTFEPELMFEIAQRNHIDIPYK-------SV
ADE_PSYCK       -----------MIDLIKRLPKAELHLHIEGSLEPELMFRLAKKNQIEIPYK-------DI
ADE_VIBPA       -----------MNAFIQGLPKVELHLHIEGSLEPELMFKLAKRNGIDIPYS-------SP
ADE_PSEAE       -----------MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWN-------DV
ADE_PSEA8       -----------MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWN-------DV
ADE_PSEAB       -----------MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWN-------DV
ADE_PSEA7       -----------MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWN-------DV
ADE_PSEPG       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWN-------DV
ADE_PSEPK       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWA-------DV
ADE_PSEPW       -----------MYEWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWN-------DV
ADE_PSEE4       -----------MYEWLNALPKAELHMHLEGSLEPELLFALAERNKIALPWA-------DV
ADE_PSEPF       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWS-------DV
ADE_PSEFS       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWN-------DV
ADE_PSEF5       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWS-------DV
ADE_PSE14       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWN-------DV
ADE_PSEU2       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNRIALPWD-------DV
ADE_PSESM       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNRIALPWN-------DV
ADE_PSEMY       -----------MYDWLNALPKAELHLHLEGSLEPELLFALAERNKIELPWA-------DV
ADE_AZOVD       -----------MYAWLNALPKAELHLHLEGSLEPELLFALAERNKVALPWP-------DV
ADE_PSEU5       -----------MHDWLNNLPKAELHLHLEGSLEPELMFRLAERNKIALPWN-------DV
ADE_BORBR       -----------MYDWLNALPKAELHLHLEGTLEPGLMFELARRNGVALPWP-------DV
ADE_BORPA       -----------MYDWLNALPKAELHLHLEGTLEPGLMFELARRNGVALPWP-------DV
ADE_BORA1       -----------MQDWLTALPKAELHIHLEGALEPELLFALAQRNGVTLPWP-------DI
ADE_HAHCH       -----------MQDFLKGLPKAELHLHIEGSLEPELMFEIGRRNGVALPFA-------NV
ADE_CAMLR       -----------MKTFLQNIPKVELHLHIEGSLEPKMMFELAKRNNITLKYK-------SE
ADE_CROS5       -----------MKTLIEQLPKAELHIHIEGSLEPELMFKLAQRNHQRLSFS-------SV
ADE_CHLPB       -----------MNEYIKGLPKAELHLHIEGTLEPEMMIDIGKRNGVPLPYP-------DA
ADE_PELLD       --------MTTVPCFIAGLPKAELHLHIEGTLEPAMMLRLAERNRQPPPFP-------DV
ADE_WOLSU       --------MPTLKELIAKLPKAELHLHIEGSLEPELMFELAQKNRIPLPYK-------SV
ADE_MARMS       --------METLIELSKKMPKTELHLHIEGTFEPEQMFAIAQRNQVELKYS-------TV
ADE_RHOPB       --------MTDLESFIRGLPKTDLHMHIEGSIEPQLMLDLAARNGMKLRWD-------TA
ADE_RHIEC       --------------MTSHLKKVELHCHLEGAASPALTEAQARKYGIDISGQ---------
ADE_RHIE6       --------------MTSHLKKVELHCHLEGAAPPALTEAQARKYGIDMSEQ---------
ADE_RHILW       --------------MTLHLKKVELHCHLEGAAPPELTAAQARKYGVDISGE---------
ADE_RHIL3       --------------MTSHLKKVELHCHLEGAAPPALTAAQARKYGVDISAE---------
ADE_AGRRK       --------------MTSHLKKVELHCHLEGAAPPALTLAQARKYNVDTNAF---------
ADE_AGRFC       --------------MTSHLLKAEIHCHLEGAAPPALVVKQAEKYGIDTSGF---------
ADE_RHIME       --------------MTAHLKKAELHCHIEGATPPELALRQARKYGVDTSAI---------
ADE_SINFN       --------------MTAHLKKAELHCHIEGATPPELALRQARKYSVDTSAI---------
ADE_SINMW       --------------MTAHLKKAELHCHIEGATPPELAVRQARKYGVDTGTI---------
ADE_AGRVS       --------------MTASLLKAELHCHIEGAAPPALVAAQAEKYGIDASSF---------
ADE_CHESB       -----------------MLLKAELHCHIEGAASPALVKAQARKYGADISSF---------
ADE_RHILO       -----------------MPLKAELHCHIEGAAAPELVIRQAQKYGKDTAPY---------
                                    * : * *:**   *        :                 

ADE_YEAST       EELNEKYKKFRDLQDFLDYYYIGTNVLISEQDFFDLAWAYFKKVHKQGLVHAEVFYDPQS
ADE_CANGA       EELAVRYTQFKDLQDFLDYYYIGTNVLLKEEDFFDLAWAYFTKVSKQGLVHAELFYDPQS
ADE_KLULA       NELHVIYNNFADLQDFLNYYYIGCNVLLSEDDFFELAWSYFKRVSTQGLRHAEVFYDPQS
ADE_CANAL       EECNDRYNRFADLQDFLDHYYIGMGVLITENDFYDLAMDYFTKAHSDGCLHSEVFFDPQG
ADE_ASPFU       EALRARYAEFTSLNDFLDFYFHGMSVLHHQSDFEELAWAYFQKAHADGVHHAEVFFDPQV
ADE_ASPOR       EALSHRYGHFTSLDDFLRFYFIGMSVLHHESDFADLAWAYFQKAHADGVHHAEVFFDPQV
ADE_EMENI       ETLSKRYGHFSSLDDFLSFYFIGMTVLKTQSDFAELAWTYFKRAHAEGVHHTEVFFDPQV
ADE_SCHPO       STLLASYEHFGCLDDFLRYYYIAVSVLIEASDFEALAYEYFSIAHSQGVHHAEVFFDPQT
ADE_GIBZE       DKLRERYGRFTSLDDFLHYYYLGMSVLITENDFETLAYQYFQRAAGENVRHAEIFFDPQA
ADE_CAUVC       EEIRAAY-DFSNLQDFLDIYYQGAGVLITEADFKDLALAYFQRLAADGGAHAEIFFDPQT
ADE_CAUVN       EEIRAAY-DFSNLQDFLDIYYQGAGVLITEADFKDLALAYFQRLAADGGAHAEIFFDPQT
ADE_SPHAL       DDVRAAY-AFTNLQDFLDIYYQGMGVLHTEQDFFDLTAAYCARANADSVRHIEIFFDPQG
ADE_RHORT       EAVRAAY-DFQNLQDFLDLYYQGMAVLRTERDFEDLAMAYFQRAAAQNVLHAEIFFDPQG
ADE_STRCO       DALREAY-RFADLQSFLNLYYELMAVLRTERDFEDLADAYLARAAAQGVRHAEIFFDPQA
ADE_PARPJ       DALRAAY-AFTDLQSFLDIYYAGASVLLHEQDFYDMTMAYVERCLADNVIHSEIFFDPQT
ADE_PARXL       DALRAAY-AFTDLQSFLDIYYAGASVLLHEQDFYDMTMAYVERCLADNVVHSEIFFDPQT
ADE_CUPTR       DALRAAY-AFTDLQSFLDIYYAGASVLLTEEDFFDMTMDYVKRAVADNVRHAEIFFDPQT
ADE_CUPNH       EALRAAY-AFTDLQSFLDIYYAGASVLLTEEDFFDMTMDYVKRAVADNVRHAEIFFDPQT
ADE_CUPPJ       EALRAAY-AFTDLQSFLDIYYAGASVLLTEEDFFDMTMDYVKRAVADNVRHAEIFFDPQT
ADE_CUPMC       EALRAAY-AFTDLQSFLDIYYAGASVLLTEEDFFDMTMDYVKRAAADNVRHAEIFFDPQT
ADE_RALPJ       EEVRAAY-AFDDLQSFLDLYYAGASVLLTEQDFYDMTAAYVARALADNVHHAEIFFDPQT
ADE_RALSO       DEVRAAY-AFNDLQSFLDLYYAGASVLLTEQDFYDMTAAYVARAVADNVRHAEIFFDPQT
ADE_GEOLS       ESLRAAY-AFTNLQSFLDIYYAGASVLQTEQDFFDMAWAYLLRAKADNVVHAEIFFDPQT
ADE_GEOUR       DELRAAY-AFTDLQSFLDIYYAGASVLQKEADFFDMAWAYLKRAKAENVVHAEIFFDPQT
ADE_RHOFT       ASLRAAY-VFDNLQSFLDIYHAGTLVLRTEQDFYDMTHAYLARAAADNVLHAEIFFDPQT
ADE_ZYMMO       ESVKAAY-NFNNLQEFLDIYYQGTNVLKTEEDFCDLAMAYFYRAHRDNVLHSEIFFDPQS
ADE_ACIAD       EEIKKAY-NFHNLQSFLDIYYAGANVLINEQDFYDLAWAYFKKCAEDRVVHTEMFFDPQT
ADE_PSYCK       EDVRNAY-NFTNLQTFLDIYYAGANVLITQDDFYDLTWEYILKCVEDNVIHTEIFFDPQT
ADE_VIBPA       SELREAY-QFEDLQSFLDLYYQGANVLRTEQDFYDLTWEYLEHCKADNVIHTEIFFDPQT
ADE_PSEAE       ETLRKAY-AFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQT
ADE_PSEA8       ETLRKAY-AFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQT
ADE_PSEAB       ETLRKAY-AFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQT
ADE_PSEA7       ETLRKAY-AFNNLQEFLDLYYAGADVLRSEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQT
ADE_PSEPG       ETLRGAY-AFNNLQEFLDLYYQGADVLRTEQDFYDLTWAYLQRCKAQNVVHTEPFFDPQT
ADE_PSEPK       ETLRGAY-AFNNLQEFLDLYYQGADVLRTEQDFYDLTWAYLQRCKAQNVIHTEPFFDPQT
ADE_PSEPW       EALRSAY-AFNNLQEFLDLYYQGADVLRSEQDFYDLTWAYLQRCKSQNVIHTEPFFDPQT
ADE_PSEE4       ETLRGAY-AFNNLQEFLDLYYQGADVLRTEQDFYDLTWAYLQRCKAQNVIHTEPFFDPQT
ADE_PSEPF       ETLRKAY-AFNNLQEFLDLYYQGADVLRTSQDFYDLTWAYLLRCKEQNVIHTEPFFDPQT
ADE_PSEFS       ETLRKAY-AFNNLQEFLDLYYKGADVLRTSQDFYDLTWAYLLRCKEQNVIHTEPFFDPQT
ADE_PSEF5       ETLRKAY-AFNNLQEFLDLYYQGADVLRTSQDFYDLTWAYLLRCKEQNVIHTEPFFDPQT
ADE_PSE14       ETLRKAY-AFNNLQEFLDLYYRGADALRTEQDFYDLTWAYLLRCKEQNVIHTEPFFDPQT
ADE_PSEU2       ETLRKAY-AFNNLQEFLDLYYRGADVLRTEQDFYDLTWAYLLRCKAQNVVHTEPFFDPQT
ADE_PSESM       EALRKAY-AFNNLQEFLDLYYRGADVLRTEQDFYDLTWAYLLRCKEQNVIHTEPFFDPQT
ADE_PSEMY       ETLRAAY-AFNNLQEFLDLYYQGANVLRSEQDFYDLTWAYLQRCKAQNVVHVEPFFDPQT
ADE_AZOVD       ESLRKAY-AFNNLQEFLDLYYQGANVLRTEQDFYDLTWAYLRKCKEQNVVHTEPFFDPQT
ADE_PSEU5       EALRSAY-NFGNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCEEQNVVHTEPFFDPQT
ADE_BORBR       ESLRRAY-DYDNLQEFLDLYYRGAEVLRTEQDFYDLTWAYLLKCREQNVVHTEPFFDPQT
ADE_BORPA       ESLRRAY-DYDNLQEFLDLYYRGAEVLRTEQDFYDLTWAYLLKCREQNVVHTEPFFDPQT
ADE_BORA1       DALRQAY-QYQNLQEFLDLYYQGAHVLRTEQDFYDLTWAYLRKCAEQGVTHTEPFFDPQT
ADE_HAHCH       EEVRAAY-EFNNLQEFLDIYYQGAQVLLHEQDFYDMTFAYLQRCREQNVIHAEMFFDPQT
ADE_CAMLR       DEIKKAY-DFSNLQDFLDIYYQGANVLQTKQDFYDLTFAYMKKCKEQNVVHTEIFFDPQT
ADE_CROS5       EEAKQAY-QFNDLQSFLNIYYQGANVLYGEEDFYDLTWNYLEKAKKQNICHTEIFFDPQT
ADE_CHLPB       EAAREAY-AFKDLQSFLDIYYQAASVLLCEQDFYDLTMAYLKKARSQNVRHAEIFFDPQT
ADE_PELLD       ETAEKAY-RFTNLQSFLDIYYRSTEVLVTEEDFYDLTLAYLEKAASQKIGHAEIFFDPQA
ADE_WOLSU       EEVRKAY-SFTSLQSFLDIYYAGAKVLLTESDFFDLAWAYLLRCKAQNICHTEIFFDPQT
ADE_MARMS       DALKAAY-QFTNLQDFLDLYYQGMSVLLHEADFYDLTMAYLEKVHSENVVHVEIFFDPQG
ADE_RHOPB       EALRGAY-QFDNLQSFLDLYFEGCKVLVAEGDFRDVTRAYLRRAHEDGVVRAELFIGPQS
ADE_RHIEC       --LRDGVYIWHDFASFLECYDKVSEVYRTEEDYALLTETYLDELAGINTIYSELIVSPDH
ADE_RHIE6       --LRDGAYVWHDFASFLECYDKVSEVYKTEEDYALLTETYLDELAAINTIYSELIVSPDH
ADE_RHILW       --LRGGAYVWHDFASFLECYDKVSEVYRTEEDYARLTETYLDELAGINTIYSELIVSPDH
ADE_RHIL3       --LRDGAYVWHDFASFLVCYDKVSEVYRTEEDYALLTETYLDELAGIDTIYSELIVSPDH
ADE_AGRRK       --MRDGVYLWKDFAEFLVCYDKVSEVYRTEEDYALLTETYLEELAGIGTIYSELIVSPDH
ADE_AGRFC       --LRDGQYVWSDFAEFIQCYDAVAQVFKSDEDYAVLTETYLTELAEANTIYSELIISPDH
ADE_RHIME       --IRDRAYVWEDFTSFVRCYDAVASLFRTEGDYALLAETYLTELAKAGTIYSEIIVSPDH
ADE_SINFN       --IRDKAYVWEDFTSFVRCYDSVASLFRTQGDYALLAETYLTELAEAGTIYSEIIVSPDH
ADE_SINMW       --IRDGAYVWEDFTSFVKCYDAVASLFRTEGDYALLAEAYLTELAEAGTIYSEIIVSPDH
ADE_AGRVS       --IRNGSYVWEDFTSFIAAYDFVASVFRTEEDFAALAEAYLIELAGVNTIYSELFVSPDH
ADE_CHESB       --IRGGAYYWQDFTTFLLAYDQAASLFRTQEDYALLAETYLKELAAGGAIYSEFFTSPDH
ADE_RHILO       --IQNGSFVWHDFTSFLAAYDFSAELFRTEEDYARLADHYLTSLARDGAIYSEVFTSPDH
                         :  :  *:  *           *:  ::  *            * : .*: 

ADE_YEAST       HTSRGISIETVTKGFQRACDKAFSEFGITSKLIMCLLRHIEPEECLKTIEEATPFIKD--
ADE_CANGA       HTTRGVSLETVTRGFERACKKAHEELGITSKLIMCLLRHLPPQDCLQTIEEAEQLIKS--
ADE_KLULA       HTSRGISLEVVTKGFERACAKAQEEFNISTKLIMCLLRHCPVEECMDTVKSAKSLIES--
ADE_CANAL       HVERNIDIDVVVQGFNRACKDANTKYGTTNKLIMCLLRHLPAENGLQTIHSASKYYQD--
ADE_ASPFU       HQARGIDYETVVSGFTAGCKRAERELGLSTRLILCFVRHLPVDSATKLYELALASNHF--
ADE_ASPOR       HRDRGIPYETIVSGFVAGCQRAERELGLTTRLILCFVRHLPVDNAARVYQEALDQEHF--
ADE_EMENI       HMERGLEYRVIVDGYVDGCKRAEKELGISTRLIMCFLKHLPLESAQRLYDTALNEGDLGL
ADE_SCHPO       HTSRGISYDVVVSGFSAACERANRDFGMSTNLIMCFLRHLPSEAAHETFAEALKRNDF--
ADE_GIBZE       HIARGVSYDTVVAGLVAAKHRAQKELGITVELIVCILRHLPVPESHALVDTLLDRGHF--
ADE_CAUVC       HTDRGIAFDTVMNGLLAGMDEAEKTLGVTSKLILCFLRHLSEEAAFETLEQAKPW-----
ADE_CAUVN       HTDRGIAFDTVMNGLLAGMDEAEKTLGVTSKLILCFLRHLSEEAAFETLEQAKPW-----
ADE_SPHAL       HTARGVAFETVITGITRALDDAEARYGITSKLILCFLRHLSEAEAEATLDEALPF-----
ADE_RHORT       HTARGVALEAVIAGLTSARKRAEAELGVSSELILSFLRHLSEEEAFATLEEALPH-----
ADE_STRCO       HLARGVEMGTVVEGLWRALGASRENHGVSTRLILCFLRDESAESAMRTLDAAGPY-----
ADE_PARPJ       HTERGVPIATVVAGIERALADAEKR-GMTSKLILCFLRHLSEEDALATFEEALPLFEQ--
ADE_PARXL       HTERGVPIATVVAGIERALADAEQR-GMSSKLILCFLRHLSEEDALATFEEARPLFEQ--
ADE_CUPTR       HTARGVPIGVVIDGIADALAQARTEYDFSSSLILCFLRHLSEEDAFATLEAALPY-----
ADE_CUPNH       HTARGVPIGVVIDGIADALAQARTEYDFSSSLILCFLRHLPEEDAFATLEAALPY-----
ADE_CUPPJ       HTARGVPIGTVIDGISDALAQARTEYDFSSSLILCFLRHLSEEDAFATLEAALPY-----
ADE_CUPMC       HTARGVPMGTVIDGIADALAQARTEYDFSSSMILCFLRHLSEEDALATLEAALPY-----
ADE_RALPJ       HTARNVPMHVVIHGIVRALDDAEREHGFSSALILCFLRHLSEEDAFDTLEAALPYIQD--
ADE_RALSO       HTARDVPMHVVIGGIVRALDDAERAHGFSSRLILCFLRHLSEADAFDTLEAALPYIQD--
ADE_GEOLS       HTARGIPFATIINGLDRAIQQGRNELGISAALILCFLRHLTEADAFTVLEEALPF-----
ADE_GEOUR       HTARGIPFETVINGLDRAIRRGREELGLSASLILCFLRHLSEEDAFAALEDALPF-----
ADE_RHOFT       HTAHGVSADVVINGLYRACVDARVEFDMNASLILCFLRHLSEQEAFECLEQALPH-----
ADE_ZYMMO       HTERGIPFNVVMNGLLAAITKAEAELGMSVQLIMCFLRHLDEESAFATLRMAEPF-----
ADE_ACIAD       HTERGVSFEIVLNGLKRACKDAKEHLGISSHLIMCFLRHLSEEDAFKTLEQALPY-----
ADE_PSYCK       HTARGVTFETVITGIKRALADAKAQYGITSCIIMCFLRHLSQEEAFETLEQALPF-----
ADE_VIBPA       HTERGIDFDTVLNGISRALTDGREKLGITSQIIACFLRHLSEESAMETLQSVLKH-----
ADE_PSEAE       HTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPF-----
ADE_PSEA8       HTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPF-----
ADE_PSEAB       HTDRGIPFEVVLAGIRAALQDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPF-----
ADE_PSEA7       HTDRGIPFEVVLAGIRAALRDGEKQLGIRHGLILSFLRHLSEEEAQKTLDQALPF-----
ADE_PSEPG       HTDRGIAFEVVLNGISQALKDGREQLGISSGLILSFLRHLSEDEAHKTLDQALPF-----
ADE_PSEPK       HTDRGIAFEVVLNGISQALKDGREQLGISSGLILSFLRHLSEDEAQKTLDQALPF-----
ADE_PSEPW       HTDRGIPFEVVLNGINQALKDGREQLGISSGLILSFLRHLSEEEAQKTLDQALPF-----
ADE_PSEE4       HTDRGIPFEVVLGGITQALKDGREQLGIGSGLILSFLRHLSEDEAQKTLDQALPF-----
ADE_PSEPF       HTDRGIPFEVVLNGIAAALKDGEQQLGITSGLILSFLRHLSEDEAQKTLDQALPF-----
ADE_PSEFS       HTDRGIPFEVVLNGIAAALKDGEQQLGITSGLILSFLRHLSEAEAEKTLDQALPF-----
ADE_PSEF5       HTDRGVPFEVVLNGIASALKDGEQQLGITSGLILSFLRHLSEEEAQKTLDQALPF-----
ADE_PSE14       HTDRGIPFEVVLAGITGALKDGKSKLGVDSGLILSFLRHLSQEEAEKTLDQALPF-----
ADE_PSEU2       HTDRGIPFEVVLAGITGALKDGKSKLGVDSGLILSFLRHLSQEEAEKTLDQALPF-----
ADE_PSESM       HTDRGIAFEVVLAGITGALKDGKSKLGVDSGLILSFLRHLSEDEAEKTLDQALPF-----
ADE_PSEMY       HTDRGIPFEVVLRGIRQALLDGEKQLGISHGLILSFLRHLPEEEAFKTLEQAMPF-----
ADE_AZOVD       HTDRGIPFETVLSGIGQALEDGRKRLGIGSGLILSFLRHLSEEEAHKTLDQALPF-----
ADE_PSEU5       HTDRGVPFEAALNGISAALADGRELLGISSGLILSFLRHLPEEEAFKTLEQALPY-----
ADE_BORBR       HTDRGIAFETVLAGITQALEDGRTQLGIQGGLILSFLRHLPEEAAMRTLEQALPY-----
ADE_BORPA       HTDRGIAFETVLAGITQALEDGRTQLGIQGGLILSFLRHLPEEAAMRTLEQALPY-----
ADE_BORA1       HTDRGVPFQVVLSGIQAALADGRRDLGIQSGLILSFLRHLPEEAAMRTLDEALPY-----
ADE_HAHCH       HTDRGVDIGVVIRGLTRAMEDAEIQWGQSSKLILCFLRHLSEDAAIETLRQALPY-----
ADE_CAMLR       HTARNIPLKDVIEGIWQALQKAKEEFGISSFLIACILRHLSEEEGLKTLDELCLY-----
ADE_CROS5       HTNRGVPFAAIITGITEALKAGKDQLGISSYLILCFLRDLTVESAFETLEQAIKY-----
ADE_CHLPB       HTSRGIAFDTVITGINNALRDGEQNLGITSKLIMCILRHLSQDEGLKTLEQALEY-----
ADE_PELLD       HTVRGIAFATVLRGMEEACREAHSRLGISTRLIMCILRHLSEQEGMTMLNEAVRW-----
ADE_WOLSU       HTSRGVSFETVIEGITKALEKGEKELGISSFLIMCFLRHLSESEGFEILKSSLPF-----
ADE_MARMS       HLSRGVGFDVQIQGIYKALQDAEKKWGMTSKLIMSFLRHLSEESAFETLELAKPH-----
ADE_RHOPB       FTERGTPLEALMSGVLGAMQEARREHGLSVGLMISVHRHRTEADAMVMLDQIMPW-----
ADE_RHIEC       GKRIGLGADAYISGVCEGIRRAKAKSGIEARLIVTGERHFGPESVIGAAEYAAKAG----
ADE_RHIE6       GKRIGLGADAYISGVCEGIRRAKEKSGIEARLIVTGERHFGPDSVIGAAEYAAKAG----
ADE_RHILW       GKRIGLGADAYISGICEGIRRAREKSGIEARLIVTGERHFGPESVIGAAEYAAKAG----
ADE_RHIL3       GKRIGLGADAYISGICEGIRRAREKSGIEARLIVTGERHFGPESVIGAAEYAARAA----
ADE_AGRRK       GDRIGLGADAYMEGVSAGIRAAKEKSGIEARLIVTGERHFGPERVVKAAEYAAKSD----
ADE_AGRFC       GDRIGLGADAYLAGVAEGIRIAKEKTGIETRIIVTGERHFGPERVIAAAEYAARIR----
ADE_RHIME       GVTIGLGADAYIEGLAAGMEAARVKTGIESRMLITGIRHLGPDSVIRTAEYAAMRR----
ADE_SINFN       GNTIGLGADAYLEGLAAGMEAAKAKTGIESRMLITGIRHLGPESVAKTAEYAAMRR----
ADE_SINMW       GNTVGLGADAYLEGLAAGMEAAKARKGIESRMLITGIRHLGPEAVVRTAEYAASHR----
ADE_AGRVS       GEAVGLSAEAYIEGLAEGIVAARIKTGIECRMVIIGERHLGPENVLRRAKWLADYH----
ADE_CHESB       AERAGLSPQAYTDGLAEGMVQAKAATGIESRMIVTGVRHFGPEAVEKAARFAASCE----
ADE_RHILO       ATKAGLSPKAYTDALGEGMLRAKAKTGIEGRMIVTGVRHVGVESIERAARFAARCG----
                    .        .   .   .    .    ::    :.                     

ADE_YEAST       ----GTISALGLDSAEKPFPPHLFVECYGKAASLNKDLKLTAHAGEEGPAQFVSDALDLL
ADE_CANGA       ----GVIHGLGLDSAEKPFPPSLFVECYERAAKINPELRLTAHAGEEGTHQFVSDALDLL
ADE_KLULA       ----GVIDGLGLDSSERPFPPELFVECYQLAKSYNKELQLTAHAGEEGDPSFVTNTLDLL
ADE_CANAL       ----GIIHGLGLDSSEKPFPPNLFTECYAHIKDNFPEVGLTAHAGEEGDHTFVSDALNLL
ADE_ASPFU       --ESRVVHGLGWSSSEVGPPKDMFREIYASASG--KGIRLTAHAGEEGDPTYISTALE-L
ADE_ASPOR       --DNEVVHGLGWSSTEVGPPKDMFRELYSSASA--KGIRLTAHAGEEGDPSYISAALE-L
ADE_EMENI       DGRNPVIHGLGASSSEVGPPKDLFRPIYLGAKE--KSINLTAHAGEEGDASYIAAALD-M
ADE_SCHPO       --ENGIVAGVGLDSSEVDFPPELFQEVYKLAAE--KGIRRTGHAGEEGDPSYIRSGLDNL
ADE_GIBZE       --NDGTLTGFGMVSSEKAFPPELFTDVYARVAK--TGTHLTTHAGEEAPPSFITASLEHL
ADE_CAUVC       ---LAKLAGVGLDSSEVGHPPAKFARVLQASRD--LGLKVVAHAGEEGPPAYVWEAIDLV
ADE_CAUVN       ---LAKLAGVGLDSSEVGHPPAKFARVLQASRD--LGLKVVAHAGEEGPPAYVWEAIDLV
ADE_SPHAL       ---LGRIAGVGLDSSEVGHPPAKFERVFARARS--LGLKTVAHAGEEGPPEYVREALDLL
ADE_RHORT       ---RDQFIGVGLDSSEVGHPPAKFARVFARARA--EGLRLVAHAGEEGPPDYVREALDLL
ADE_STRCO       ---LDRITGVGLDSAEVGHPPVKFREVYEAAAA--LGLRRVAHAGEEGPPAYVVEALDVL
ADE_PARPJ       --YKHRLIGVGLDSSERGHPPSKFERVFAKARA--LGLKLVAHAGEEGPPSYIYEALDLL
ADE_PARXL       --YRHRLIGVGLDSSERGHPPSKFERVFAKARS--LGLKLVAHAGEEGPPSYIYEALDLL
ADE_CUPTR       ---RDRFVGVGLDSSEKGNPPEKFARVFARARE--LGLHLVAHAGEEGPAQYVADALDIL
ADE_CUPNH       ---RDRFVGVGLDSSERGNPPEKFARVFARARE--LGLHLVAHAGEEGPAQYVTDALDIL
ADE_CUPPJ       ---RDRFVGVGLDSSEKGNPPEKFARVFTRARE--LGLHLVAHAGEEGPAQYVTDALDIL
ADE_CUPMC       ---RDRFVGVGLDSSERGNPPEKFARVFARAKE--LGLHLVAHAGEEGPPQYVTDALDIL
ADE_RALPJ       --PANRIIGVGLDSSERGNPPEKFARVFARCKE--LGLRLVAHAGEEGPAQYVIDALDIL
ADE_RALSO       --PANRIIGVGLDSSERGNPPEKFARVFARCKA--LGLRLVAHAGEEGPAQYVIDALDIL
ADE_GEOLS       ---RDKFIGVGLDSGEKGNPPEKFSRVFARCRE--LGLRLVAHAGEEGTAEYIWHALDLL
ADE_GEOUR       ---RDKFIGVGLDSSERGNPPEKFTRVFARCRE--LGLRLVAHAGEEGSAEYISHSLDLL
ADE_RHOFT       ---LDKLVGVGLASSEMGHPPEKFARVFARARE--LGLRLVAHAGEEGPPAYIWSALDVL
ADE_ZYMMO       ---LDKIAGVGLDSSEVGNPPSKFRHVFAEARQ--KGLKLVAHAGEEGDASYIKEALDIL
ADE_ACIAD       ---KADIIAVGLDSSEVGHPPSKFARVFEKARE--EGFLVVAHAGEEGPPEYVWEALDLL
ADE_PSYCK       ---KDDIIGVGLDSSELGNPPSKFIEVFKKAKE--EGFKLVAHAGEEADFSYIYEALDLL
ADE_VIBPA       ---RDKIIGVGLDSSEKGHPPAKFLRVFQQAKE--AGLLTVAHAGEEGPAQNITDAIEML
ADE_PSEAE       ---RDAFIAVGLDSSEVGHPPSKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSEA8       ---RDAFIAVGLDSSEVGHPPSKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSEAB       ---RDAFIAVGLDSSEVGHPPSKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSEA7       ---RDAFVAVGLDSSEVGHPPRKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSEPG       ---RDAFIAVGLDSSEMGHPPRKFQRVFDRARS--EGFVAVAHAGEEGPPEYIWEALDLL
ADE_PSEPK       ---RDAFIAVGLDSSEMGHPPSKFQRVFDRARS--EGFVAVAHAGEEGPPEYIWEALDLL
ADE_PSEPW       ---RDAFIAVGLDSSEKGHPPSKFQRVFDRARS--EGFEAVAHAGEEGPPEYIWEALDLL
ADE_PSEE4       ---RDAFVAVGLDSSEKGHPPSKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEAIDLL
ADE_PSEPF       ---RDAFVAVGLDSSEMGHPPSKFQRVFDRARH--EGFLTVAHAGEEGPPEYIWEAIDLL
ADE_PSEFS       ---RDAFVAVGLDSSEMGHPPSKFQRVFDRARH--EGFLTVAHAGEEGPPEYIWEAIDLL
ADE_PSEF5       ---RDAFVAVGLDSSEMGHPPSKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSE14       ---RDAFVAVGLDSSEMGHPPSKFQRVFDRARS--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSEU2       ---RDAFVAVGLDSSEMGHPPSKFQRVFDRARN--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSESM       ---RDAFVAVGLDSSEMGHPPSKFQRVFDRARN--EGFLTVAHAGEEGPPEYIWEALDLL
ADE_PSEMY       ---RDAFIGVGLDSSEKGFPPRLFERVFAKARS--EGLHAVAHAGEEGPPEYIWEALDLL
ADE_AZOVD       ---RHAFIAVGLDSSEKGHPPRKFRQVFERARA--EGFATVAHAGEEGPPEYIWEALDLL
ADE_PSEU5       ---RNAFFAVGLDSSEVGHPPSKFQRVFDKARG--EGLLTVAHAGEEGPPEYIWQALDLL
ADE_BORBR       ---RDAFIAVGLDSSERGFPPRLFQRVFERARA--AGLPAVAHAGEEGPPEYIWEALDLL
ADE_BORPA       ---RDAFIAVGLDSSERGFPPRLFQRVFERARA--AGLPAVAHAGEEGPPEYIWEALDLL
ADE_BORA1       ---RDAFIAVGLDSSEAGFPPRLFERVFARARA--EGLPAVAHAGEEGPPEYIWEALERL
ADE_HAHCH       ---KQHFVGVGLDSSEVGHPPEKFQRVFEQAQN--AGLLTVAHAGEEGPPEYIWQALDLL
ADE_CAMLR       ---KDKIKAIGLDSSELNNPPFKFKNLFQKAKE--EGFLLVMHAGEEGSSEYIKQALEL-
ADE_CROS5       ---GEKIKAIGLDSAEKNNPPSKFKEVFDKARA--EGFLTVAHAGEEGSSDYIWQAINLL
ADE_CHLPB       ---KGVIAGIGLDSSELGNPPDKFRSLYERAHK--EGFLTVAHAGEEGHADYIWQALNTL
ADE_PELLD       ---KRWITGIGLDSSERGNPPSKFHNLYREARR--EGFFLTAHAGEEGSAASVKETLDLL
ADE_WOLSU       ---REKILGVGLDSSEVGHPPSKFERLFLECRK--AGYKIVAHAGEEGDSSYIWEAIHKL
ADE_MARMS       ---LKWIDGIGLDSSEVGHPPEKFLRVFEACKN--LGLKVTAHAGEEGPPDYVWQAIEQI
ADE_RHOPB       ---KDQIIAIGMGGAELGNPPAKFARFFKAARD--RGFRTTVHAGEEGPAAYVREALELL
ADE_RHIEC       ---NPLITGFNLAGEERMGRVADYIRAFDIARD--AGLGLTIHAGEVCGAFSVADALDAV
ADE_RHIE6       ---NPLITGFNLAGEERMGRVADYSRAFDIARD--AGLGLTIHAGEVCGAFSVADALDAV
ADE_RHILW       ---NPLITGFNLAGEERMGRVADYARAFDIARD--AGLGLTIHAGEVCGAFSVADALDAV
ADE_RHIL3       ---NPLITGFNLAGEERMGRVADYARAFDIARD--AGLGLTIHAGEVCGAFSVADALDAV
ADE_AGRRK       ---NPLISGFNMAGEERMGRVADYARAFDIARE--AGLGITIHAGEVCGAFSVADAVELV
ADE_AGRFC       ---HPLVTGFNMAGEERMGRVADYARAFDIARD--AGLGLTIHAGEVCGPESVADALDLV
ADE_RHIME       ---HPLVTGFNLAGEERMHSVAEFSRAFDIVRD--AGLGLTIHAGELSGAFSVRDALDHV
ADE_SINFN       ---HPLVTGFNLAGEERMHSVAEFARAFDIVRD--AGLGLTIHAGELSGAFSVRDALDHV
ADE_SINMW       ---HPLVTGFNLAGEERMHSVAEFSRAFDIVRD--AGLGLTIHAGELSGAFSVRDALDHV
ADE_AGRVS       ---HPLITGFNMAGEERMNRVADYAPAFDIARE--AGYGITIHAGELCGAFSVRDALDLV
ADE_CHESB       ---HPLVTGFGMAGDERAGHPRDFAYAFDIARE--AGLGISIHAGEFGGAESVEAALDHI
ADE_RHILO       ---NPLVTGFGVAGDERVGEMEDYVRAFEIARE--AGLGITIHAGELTGWETVQAALDHI
                      . ...  . *       :                  ****      :   :.  

ADE_YEAST       QVTRIDHGINSQYDEELLDRLSRDQTMLTICPLSNVKLQVVQSVSELPLQKFLDRDVPFS
ADE_CANGA       NVTRIDHGVNSKQSEELMARLAEQQTLLTVCPLSNVKLQVVQSVKEIPLQLFLDKNIAFS
ADE_KLULA       ETTRIDHGVRSIEDAELIKRLAAQKVMLTLCPLSNVKLQVVKDVSELPLQEFLDNDVPFS
ADE_CANAL       KVSRIDHGVNSHQSEELMQRLAEQKTLLSLCPLSNVKLQVVKDVKELPIDKFFQMNVPFS
ADE_ASPFU       GARRIDHGIRLVEDPELMERVAREGIMLTVCPLSNVRLRCVQSVEQVPIRKFLDAGVKFS
ADE_ASPOR       GAQRIDHGIRLVEDPVLMEKVVRDRIMLTVCPISNLQLRCVESIAHVPIRKFLDAGVMFS
ADE_EMENI       GATRIDHGIRLGEDPELMERVAREEVLLTVCPVSNLQLKCVKSVAEVPIRKFLDAGVRFS
ADE_SCHPO       SLQRIDHGIRLVEDKELMKRVAEENIMLTMCPLSNLKLRCVNSIAELPVREFLEAGVPFS
ADE_GIBZE       KVSRIDHGLAAAQDPELLKKLAANRTLLTFCPWSNVALCNLPELADAPVREFLDAGVLFS
ADE_CAUVC       KVDRIDHGNRALEDEALTARLVKDGITLTVCPLSNLKLCGVPSLDVHPLKRMLDLGLKAT
ADE_CAUVN       KVDRIDHGNRALEDEALTARLVKDGITLTVCPLSNLKLCGVPSLDVHPLKRMLDLGLKAT
ADE_SPHAL       KVDRIDHGNRSLEDPALVARLAASDMTLTVCPLSNLKLCVVDDIADHPLKIMLDADLKAT
ADE_RHORT       AIDRLDHGNRALEDEALIERLIAEGMALTVCPLSNLKLRVVDDLGAHPLKAMLERGLKAT
ADE_STRCO       GVERIDHGLRSVEDPALVERLVRERVPLTLCPLSNVRLRTVDTLADHPLPAMLDAGLMCT
ADE_PARPJ       KVDRVDHGVRSIEDPALVTRLADSRVALTVCPLSNLKLCVFDDLTKHTLKDLLDRGVAVT
ADE_PARXL       KVDRVDHGVRSIEDPALVTRLADSRVALTVCPLSNLKLCVFDDLTKHTLKDLLDRGVAVT
ADE_CUPTR       KAERIDHGVRAIDDAALVERLARERVALTVCPLSNVKLKVYPDLRDHPLKRMLDAGVAIT
ADE_CUPNH       KAQRIDHGVRAIDDPALVERLARERVALTVCPLSNVKLKVYPDLRDHPLKRMLDAGVVIT
ADE_CUPPJ       KVERIDHGVRSIDDAALIERLARERVALTVCPLSNQKLKVHPDLSEHPLKRMLDAGVAIT
ADE_CUPMC       KVERIDHGVRAIEDEALVQRLARERVALTVCPLSNQKLMVHPDLRDHPMKRLLDAGVAVT
ADE_RALPJ       KVERIDHGVRAIDDAALVKRLAAERIALTVCPLSNEKLKVYPDLRDHSLKQLLDAGCAVT
ADE_RALSO       QVERIDHGVRAIDDAALVKRLAASRVALTVCPLSNEKLKVYPDLRDHSLKQLLDAGCAVT
ADE_GEOLS       QAERIDHGVHCLDDPQLVTRLVQQQVPLTVCPLSNVKLRVFPDLAAHNIARLLACGIRAT
ADE_GEOUR       KAERIDHGVHCLDDPKLVARLVQQRIPLTVCPLSNVKLCVFPSLSAHNIGKLLAAGIAAT
ADE_RHOFT       KVERIDHGVQAVQDPLLMARLARDRIALTVCPLSNLKLRVFPTLAAHNLGRLLEAGIVAT
ADE_ZYMMO       NIDRIDHGNRITEDRLLMTRAARSAIALTICPLSNQKLQVVPDLRNHPLPYLLRQGLRVT
ADE_ACIAD       KVNRIDHGVRSEEDPALMQRLIQEKMPLTVCPLSNLKLCVVNDMKEHNIRRLLNQGVHVT
ADE_PSYCK       DISRIDHGVQSIKSAELMQRLKDEQMPLTVCPNSNIELRVFNNYKEHNIKELLDYGLNIT
ADE_VIBPA       EVSRVDHGVRCVEDEALVGSLIETKMPLTVCPLSNIKLCVFDEMGQHNIVELLRKGVAVT
ADE_PSEAE       KVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVT
ADE_PSEA8       KVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVT
ADE_PSEAB       KVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVT
ADE_PSEA7       KVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVT
ADE_PSEPG       KIKRIDHGVRAIEDERLMQRIIEEQIPLTVCPLSNTKLCVFDHMSQHNILDMLERGVKVT
ADE_PSEPK       KIKRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDHMSQHNILDMLERGVKVT
ADE_PSEPW       KIKRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDHMSQHNILDMLERGVKVT
ADE_PSEE4       KIQRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFEHMSQHNILDMLERGVKVT
ADE_PSEPF       KIQRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDHMSQHNILDMLERGVKVT
ADE_PSEFS       KIQRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDDMAQHNILDMLERGVKVT
ADE_PSEF5       KIQRIDHGVRAFEDERLMQRIIDEQIPLTVCPLSNTKLCVFDHMSQHNILQMLERGVKVT
ADE_PSE14       KIQRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDDMAQHNILDMLERGVKVT
ADE_PSEU2       KIQRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDDMAQHNILDMLERGVKVT
ADE_PSESM       KIQRIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDDMAQHNILDMLERGVKVT
ADE_PSEMY       KVERIDHGVRAIEDERLMQRIIDEQIPLTVCPLSNIKLCVFEHMGQHNILDMLERGVKVT
ADE_AZOVD       KVKRIDHGVRAAEDPRLLERLIDEQIPLTVCPLSNVKLRVFKDMSEHNILKLLEMGVKVT
ADE_PSEU5       KVSRIDHGVRAAEDPKLIARLIEEQIPLTVCPLSNTKLKVFADMRQHNILDLLEQGVKVT
ADE_BORBR       QVRRIDHGVRAAEDERLIERLIDTQIPLTVCPLSNTRLRVFDSMAEHNILELLERGVKVT
ADE_BORPA       QVRRIDHGVRAAEDERLIERLIDTQIPLTVCPLSNTRLRVFDSMAEHNILELLERGVKVT
ADE_BORA1       QVKRIDHGVRAWEDPRLIAHLVDTQIPLTVCPLSNVRLQVFEHMGQHNVLEMLERGLNVC
ADE_HAHCH       KVKRIDHGVRCIEDAALMQRLIDEQIPLTVCPLSNIKLCVFDSMSEHNILRLLEKGLKVT
ADE_CAMLR       GVNRIDHGVRCQEDLELVKQLAKSQIPLTICPLSNIKLKVFQNMQEHNILKLLKQNLCVC
ADE_CROS5       KVSRIDHGIRCIDDPKLVEYLAEKQIPLTVCPLSNVKLKVFNCLEDHNLKILLDQGLCVT
ADE_CHLPB       HVARIDHGVHCMEDETLIHTLVERQIPLTVCPLSNVRLGVFSSMEEHNLKKMLDRELSVT
ADE_PELLD       HVDRIDHGVRCMDDPALVKELVRRAVPLTVCPLSNVKLQVFGSMQEHNLKAMLEKGLMVT
ADE_WOLSU       QVERIDHGIRCEEDENLVEWLIQKQTPLTVCPLSNVKLQAVKNLSEHNILRLLRKGVLVT
ADE_MARMS       GVDRIDHGNRALEDNKLIEAIKQRNLTLTVCPLSNLKLCVVNDMKNHPIKNMLALGLNAT
ADE_RHOPB       QVDRIDHGNACLADPDLVRELAMRRIPLTVCPLSNLRLKGVTEMARHPLKTMMAQGLHVT
ADE_RHIEC       RPARIGHGVRAIEDLDLVKRLADLGTVLEVCPGSNIALRVYPDFASHPLRRLKEAGVRVT
ADE_RHIE6       RPARIGHGVRAIEDLDLVKRLADLGTVLEVCPGSNIALRVYPDFASHPLRRLKEAGVPVT
ADE_RHILW       HPSRIGHGVRAVEDVDLVKRLADLGTVLEVCPGSNIALGVFPDFASHPLRRLKEAGVRVT
ADE_RHIL3       RPSRIGHGVRAIEDLDLVTRLADLGTVLEICPGSNIALGVFPDFASHPLRRLKDAGVRVT
ADE_AGRRK       RPARIGHGVRAIEDADLVKRLADLGTVLEVCPGSNIALNVFPDFPSHPLRKLRDAGVRVT
ADE_AGRFC       KPSRIGHGVRAIEDAALISRLVETGTVLEVCPGSNIALSVYPDFASHPLKALSDAGVRVC
ADE_RHIME       RPARISHGVRAIEDGDLVKRLADEGVVLEVCPGSNVALQVFPDFASHPLRRLYEAGVRVT
ADE_SINFN       RPARISHGVRAIEDADLVKRLAEEGVVLEVCPGSNVSLQVFADFASHPLRPLYEAGVRVT
ADE_SINMW       RPARISHGVRAIEDTDLVRRLADEGVVLEVCPGSNIALKVFPDFPSHPLRRLYDAGVRVT
ADE_AGRVS       RPSRIGHGVRAIEDADLVQRLADEGVVLEVCPASNIALKVFEDYASHPMRDLTDAGVRVC
ADE_CHESB       RPSRIGHGVRAIENPDLVRRIADEGVVLEVCPVSNVVLKVFPEFARHPFPQLVAAGCRVT
ADE_RHILO       RPSRIGHGVRAIENPDLVRRIADEGIVLECCPGSNIALKVFDSFADHPLPALQAAGCKVT
                   *:.**     .  *          *  ** **  *          .  :        

ADE_YEAST       LNSDDPAYFGGYILDVYTQVSKDFPHWDHETWGRIAKNAIKGSWCDDKR--KNGLLSRVD
ADE_CANGA       LNSDDPAYFGGYILDNYYQVNKDFPDWDFKVWERIAKNGINGSWCEQKR--KEELLAKVD
ADE_KLULA       INSDDPAYFGGYILQNYLEVYSRF-GWSKAVWAKIARQSIEGSWCDPKR--KQELLSEVS
ADE_CANAL       INSDDPAYFGGYILDNYKAVHTRF-GFTKDQWKIIALNGIKGSWCDDQR--KNELISLVE
ADE_ASPFU       INSDDPAYFGGYILDNYCAVQEAF-QLSILEWRVIAENSVNESWIDEAR--KAELLKRID
ADE_ASPOR       INSDDPAYFGGYILDNYCAVQEAF-QLTVDEWRVIAENSIKGSWIGEER--KTELLKRID
ADE_EMENI       INSDDPAYFGAYILECYCAVQEAF-NLSVADWRLIAENGVKGSWIGEER--KNELLWRID
ADE_SCHPO       INCDDPAYFGGYTLENYFAIQKHF-NLTVKEWVFIANAAINGSWISGKR--KEELLSSVQ
ADE_GIBZE       VNSDDPAYFGAYVQEVYCRVQDTF-NLSVKDWAWIVRGAVEESWCSEER--KKEILKEME
ADE_CAUVC       VNSDDPAYFGGYLLENYLATADAV-GLTRDDIVTLAKNSFAGSFLTDAE--KAQRIAAVE
ADE_CAUVN       VNSDDPAYFGGYLLENYLATADAV-GLTRDDIVTLAKNSFAGSFLTDAE--KAQRIAAVE
ADE_SPHAL       VNSDDPSYFGGYVNANYQAVADAL-DLSRDDLVTLARNSFTGSFLSDAE--KARHLAAID
ADE_RHORT       INSDDPSYFGGYMLENMAAVAEAL-ALETHHLRTLTANAIDASFASPAR--KAEMHARLA
ADE_STRCO       VNSDDPAYFGGYAGDNFDAVRQAL-GLTGERLRELARNSFLASFLEDDEELRARYLAEVE
ADE_PARPJ       VNSDDPAYFGGYVNANYFATIDAL-KLNDAEVYTIIRNSFEASFVTPEQ--RSELIAKLD
ADE_PARXL       VNSDDPAYFGGYVNANYLATIDAL-KLNDAEVYTIIRNSFEASFVTPGQ--RSELIAKLD
ADE_CUPTR       LHSDDPAYFGGYMNANWEATFDAL-PLDAADAHKLARNSFEAAFLPAMQ--KAEFLAEVD
ADE_CUPNH       LHSDDPAYFGGYMNANWEATFEAL-PLDAADAHKLARNSFEAAFLPAMQ--KAEFLAEVD
ADE_CUPPJ       LHSDDPAYFGGYMNANWEATFAAL-PLDAADAHKLARNSFEAAFLPPMQ--KAEFLAEVD
ADE_CUPMC       LHSDDPAYFGGYMNANWEASFDAL-PLDAADAHKLARNSFEAAFLPDVQ--KAEFLAEVD
ADE_RALPJ       LHSDDPAYFGGYMNTNWLATFNAL-DLSAADAHALARNSFEASFLPEQD--KALWLAKVD
ADE_RALSO       LHSDDPAYFGGYMNTNWLATFNAL-GLSAADAHTLARNSFEASFLPEQD--KALWLNAVD
ADE_GEOLS       INSDDPAYFGGYLNQNYLETFAALPELGAAEAYQLARNSFEASFVDAEV--KAGWIRELD
ADE_GEOUR       INSDDPAYFGGYLNRNYTATFAALPGLGAKEAYQLARNSFEASFVNENI--KEGWIRELD
ADE_RHOFT       VNSDDPSYFGGYINQNFTQTFAAL-GLTAQHAYQLAHNSFEASFIDDRL--KRQYFDRLA
ADE_ZYMMO       INSDDPAYFGGYVNDNYKALAEYC-GLKAADFVEIARNSFLGSFLPDQT--VAAYLDVLD
ADE_ACIAD       VNSDDPSYFGGYMNDNFVAIQAAL-DLSNEELKKLAINSFEASFIDEEE--KQNWIEEIN
ADE_PSYCK       VNSDDPAYFKGYINQNFINISENL-PLTEDDIITLVKNSFRSSFISDEL--KQQYLNRVD
ADE_VIBPA       INSDDPVYFGGYMTDNFLAVNQAH-PMIKEELAKFTLNAIDASFIDNEL--KAQYRHKVE
ADE_PSEAE       VNSDDPAYFGGYVTENFHALQQSL-GMTEEQARRLAQNSLDARLVK--------------
ADE_PSEA8       VNSDDPAYFGGYVTENFHALQQSL-GMTEEQARRLAQNSLDARLVK--------------
ADE_PSEAB       VNSDDPAYFGGYVTENFHALQQSL-GMTEEQARRLAQNSLDARLVK--------------
ADE_PSEA7       VNSDDPAYFGGYVTENFHALQQSL-GMTEEQARRLAQNSLDARLVK--------------
ADE_PSEPG       VNSDDPAYFGGYVTENFHALHTHL-GMTEDQARRLAQNSLDARLI---------------
ADE_PSEPK       VNSDDPAYFGGYVTENFHALHTHL-GMTEDQARRLAQNSLDARLV---------------
ADE_PSEPW       VNSDDPAYFGGYVTENFHALHTHL-GMTEDQARRLAQNSLDARLV---------------
ADE_PSEE4       VNSDDPAYFGGYVTENFHALYEHL-GMTQDQARRLAQNSLDARLVR--------------
ADE_PSEPF       VNSDDPAYFGGYVTENFHALHEHL-GMTQDQAKRLAQNSLDARLVKP-------------
ADE_PSEFS       VNSDDPAYFGGYVTENFHALYTSL-GMTQDQAKRLAQNSLDARLVKP-------------
ADE_PSEF5       VNSDDPAYFGGYVTENFHALHTDL-GMTQDQARRLAQNSLDARLVKP-------------
ADE_PSE14       VNSDDPAYFGGYVTENFHALYTHL-GMTEDQAKRLAQNSLDARLVKP-------------
ADE_PSEU2       VNSDDPAYFGGYVTENFHALYTHL-GMTEDQAKRLAQNSLDARLVKP-------------
ADE_PSESM       VNSDDPAYFGGYVTENFHALHTHL-GMTEDQARRLAQNSLDARLVKP-------------
ADE_PSEMY       VNSDDPAYFGGYVGENFAALHEHL-GMSEEQARRLAQNSLDARLA---------------
ADE_AZOVD       VNSDDPAYFGGYVTENFVALQESL-GMTCEQAERLAQNSLDARLA---------------
ADE_PSEU5       VNSDDPAYFGGYVTENFVALHESL-GMTEAQARRLAQNSLDARLAY--------------
ADE_BORBR       VNSDDPAYFGGYITENFHALHEHL-GMTQDQARRLAANSMDARLAGG-------------
ADE_BORPA       VNSDDPAYFGGYITENFHALHEHL-GMTQDQARRLAANSMDARLAGG-------------
ADE_BORA1       INSDDPAYFGGYVLENFMALREHL-GMSQEQARRLAANSLASVLTA--------------
ADE_HAHCH       VNSDDPAYFGGYMNENFIAMQEAL-PMSKEQAAQLARNSFEASFLTSEE--KARLLARLD
ADE_CAMLR       VNSDDPAYFGGYILENFIALDETF-KLSKDEVKKLCINAVNASFLNINE--KEKLVKQIK
ADE_CROS5       INSDDPAYFGGYLNENFLAISQAL-RLTEIDLQKMINNSFRASFLNTSE--KEQLYIQ--
ADE_CHLPB       VNSDDPAYFGGYVNENYLAVQQAL-TLERKDLVRLAVNSFTASFLTQEK--KQQHIAAIH
ADE_PELLD       LNSDDPAYFGGYLNDNFTAAAEAL-DLSFSDIIRLAANSFNASMLSIVQ--KKIHLLELA
ADE_WOLSU       VNSDDPAYFGGYLNENYEALSEHL-NASKEELKALAINSFKASFLSEEK--KMDWIKQII
ADE_MARMS       VNSDDPAYFGGYMNDNYASLINGT-RISKEELFQLAKNGITGSWMEDHL--KELHLKQLH
ADE_RHOPB       VNTDDPPYFGGYVTENLLACREAL-DLSREEIVRLVRNGLEAAFVTTEE--REILLRQLD
ADE_RHIEC       ISSDDPPFFHTSLEREYALAAEAFGFGDA-EIDAMTRVAIEAAFVDEET--RKALLARL-
ADE_RHIE6       ISSDDPPFFHTSLEREYALAAEAFGFDNA-EIDAMTRTAIEAAFVDAQT--RKALLARL-
ADE_RHILW       ISSDDPPFFHTSLAREYELAAEAFGFSDA-EIDAMTRTAIEAAFVDEET--RKALLARL-
ADE_RHIL3       ISSDDPPFFHTSLKREYELAAGTFGFGDA-EIDAMTRTAIEAAFVDDET--RKALLARI-
ADE_AGRRK       ISSDDPPFFHTSLKREYELASTAFGFSDD-EINAMTRTAIEAAFLDEAT--RAALLARL-
ADE_AGRFC       ISSDDPPFFFTSLAREYALAADAFGFNDA-EINRMTRTALECAFVDEAT--RERLLARLG
ADE_RHIME       LNSDDPPFFHTSLAQEYEIAFHAMGFSDS-EIDRMTKTAIEAAFVDEPT--REKLLAALH
ADE_SINFN       LNSDDPPFFHTSLAQEYEVAAHVMGFSDS-DIDRMTKTAIEAAFVDEPT--RERLLAALH
ADE_SINMW       LNSDDPPFFHTSLAQEYEIAAHAMGFSDG-EIDRMTRTALEAAFVDEPT--RERLLAALH
ADE_AGRVS       INSDDPPFFATSLANDYAIAA-SMGFSDV-EIDAMTRTAIEAAFVDEAT--RQNLLQRLQ
ADE_CHESB       LNSDDPPHFHTSLAREYAVAAEYFGLDET-TLNAITSTAIEAAFVDEKT--RAALFARLK
ADE_RHILO       LNSDDPPYFWTSLKREYDIAAEHFAMNEK-ALAAVTRTAIEAAFVDRKT--KAALLARLN
                :  *** .*                         .   ..                    

ADE_YEAST       EVVTKYSH----------------
ADE_CANGA       AVVAKYTN----------------
ADE_KLULA       EVVNKYVNLP--------------
ADE_CANAL       EVYKKYNIEGC-------------
ADE_ASPFU       DHVQKHTVVA--------------
ADE_ASPOR       DHVQRHVAAV--------------
ADE_EMENI       ECVKRFEGVL--------------
ADE_SCHPO       KCVKEYTAEIQQPKTLETAVEVQA
ADE_GIBZE       QVLEKYKDLDA-------------
ADE_CAUVC       AYAAAH------------------
ADE_CAUVN       AYAAAH------------------
ADE_SPHAL       AYA---------------------
ADE_RHORT       AVN---------------------
ADE_STRCO       AYRFPAA-----------------
ADE_PARPJ       AHWHPSGPH---------------
ADE_PARXL       AHWHPGGPH---------------
ADE_CUPTR       HFWSAPPKSPPATAPAA-------
ADE_CUPNH       HFWSSPPKSPPATAPAA-------
ADE_CUPPJ       HFWSATPTSPPATAPAA-------
ADE_CUPMC       HFWSATPASPPATANVTTTT----
ADE_RALPJ       DHWKAAH-----------------
ADE_RALSO       IHWRAHT-----------------
ADE_GEOLS       QFFQQQCDKI--------------
ADE_GEOUR       EFFTHYRENEGKWLPL--------
ADE_RHOFT       GVFETFE-----------------
ADE_ZYMMO       KYVDSF------------------
ADE_ACIAD       QI----------------------
ADE_PSYCK       QAVG--------------------
ADE_VIBPA       QYVAQHSSM---------------
ADE_PSEAE       ------------------------
ADE_PSEA8       ------------------------
ADE_PSEAB       ------------------------
ADE_PSEA7       ------------------------
ADE_PSEPG       ------------------------
ADE_PSEPK       ------------------------
ADE_PSEPW       ------------------------
ADE_PSEE4       ------------------------
ADE_PSEPF       ------------------------
ADE_PSEFS       ------------------------
ADE_PSEF5       ------------------------
ADE_PSE14       ------------------------
ADE_PSEU2       ------------------------
ADE_PSESM       ------------------------
ADE_PSEMY       ------------------------
ADE_AZOVD       ------------------------
ADE_PSEU5       ------------------------
ADE_BORBR       ------------------------
ADE_BORPA       ------------------------
ADE_BORA1       ------------------------
ADE_HAHCH       QYLQNH------------------
ADE_CAMLR       AYK---------------------
ADE_CROS5       ------------------------
ADE_CHLPB       TFDKNIT-----------------
ADE_PELLD       DYARGFAPGH--------------
ADE_WOLSU       ------------------------
ADE_MARMS       ALFA--------------------
ADE_RHOPB       DYLARHAVASTS------------
ADE_RHIEC       ------------------------
ADE_RHIE6       ------------------------
ADE_RHILW       ------------------------
ADE_RHIL3       ------------------------
ADE_AGRRK       ------------------------
ADE_AGRFC       DA----------------------
ADE_RHIME       V-----------------------
ADE_SINFN       V-----------------------
ADE_SINMW       I-----------------------
ADE_AGRVS       AAGSGDEAAI--------------
ADE_CHESB       PVVES-------------------
ADE_RHILO       GAAR--------------------