CLUSTAL format seed alignment for MF_01963

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PNPH_DICTD       ------------------------------------------MRIAIIGGTGVYDP---K
PNPH_MOOTA       ------------------------------------------MRIAIIGGSGVYDP---G
PNPH_PYRFU       -----------------------------------------MPRIAIVGGSGVYDF---P
PNPH_THEKO       -----------------------------------------MPRIAIIGGSGVYDP---A
PNPH_KORCO       -----------------------------------------MVRVGIIGGSGLYE-----
MTIP_THEYD       ------------------------------------MHNKQQVKIGIIGGSGLSE-----
MTIP_METKA       -----------------------------------------MTEVGVIGGTGF------Q
MTIP_METTH       -------------------------------------------MIGIIGGTGIYEMA--E
MTIP_METAC       -----------------------------------MDEEAEVAEIAVLGGVGF------N
MTIP_METJA       -------------------------------------------MIGIIGGTGI---A--E
PNPH_ARCFU       -------------------------------------------MIGIIGGTHILE-I--K
PNPH_AQUAE       -------------------------------------------MLGIIGGSGLYNL---P
MTIP_PSEAE       -----------------------------------------MSVYAIIGGTGLTQL---E
MTIP_PSESM       -----------------------------------------MTVYAIIGGTGLTQL---E
MTIP_XYLFA       ---------------------------------------MQTIALAVIGGTGVYTL---S
MTIP_XYLFT       ---------------------------------------MQTIALAVIGGTGVYTL---S
MTIP_XANCP       -------------------------------------MSSNSIALAVIGGTGVYKL---A
MTAP_MYCS2       ------------------------------------------MMLGVIGGSGFY--T--F
MTAP_MYCTU       -------------------------------------MHNNGRMLGVIGGSGFY--T--F
PNPH_STRCO       ------------------------------------MANKVKAEIGVIGGSGFY--S--F
MTAP_HUMAN       ---------------------------------MASGTTTTAVKIGIIGGTGLDDP---E
MTAP_MACMU       ---------------------------------MASGTTTTAVKIGIIGGTGLDDP---E
MTAP_BOVIN       ---------------------------------MSSGATPAAVKIGIIGGTGLDDP---E
MTAP_MOUSE       ---------------------------------MASGSACTAVKIGIIGGTGLDDP---E
MTAP_DANRE       ------------------------------------MTSNSHVKIGIIGGSGLDDP---D
MTAP_XENTR       ------------------------------------MAGVCAVKVGIIGGSGLDDP---D
MTAP_ANODA       --------------------------------------MGTKVKIGIIGGSGLDDS---Q
MTAP_ANOGA       --------------------------------------MVSKVKIGIIGGSGLDDS---Q
MTAP_AEDAE       --------------------------------------MRPAIKIGIIGGSGLDDS---Q
MTAP_DROME       ---------------------------MITIKCKDTNLDPLPVKIGIIGGSGLDDP---D
MTAP_DROPS       ---------------------------MLHIKCKDTDLDPIPVKIGIIGGSGLDDP---D
MTAP_NEMVE       -------------------------------------MANVKVKIGIIGGTGVDNP---N
MTAP_CIOIN       ---------------------------------MMESGDRQNNKIGIIGGSGLESI---E
MTAP_CAEBR       -----------------------------------------MVKVGIIGGSGLEDP---N
MTAP_CAEEL       -----------------------------------------MVKVGIIGGSGLEDP---N
PNPH_DROME       -------------------------MEADLEVQSELEKDTIPIKIGIIGEANLDKP---I
PNPH_DROPS       -------------------------MENNLAPINE---DPFPIKIGIIGDADLDTT---I
MTAP_HYPBU       -------------------------------MPDFPPKPSVKADIAIIGGSGLYDP---G
MTAP_SACS2       -------------------------------MIEQ----NEKASIGIIGGSGLYDP---G
MTAP_AERPE       -------------------------------MFEITRPPGVRAHVGVIGGSGLYDP---G
MTAP_THEPD       ---------------------------------------MEKVKIGIIGGSGLYSP---D
MTAP_PYRFU       -----------------------------------------MPKIGIIGGSGVY-----G
MTAP_PYRHO       -----------------------------------------MPKIGIIGGSGVY-----G
MTAP_PYRAB       -----------------------------------------MPKIGIIGGSGVY-----G
MTAP_THEKO       -----------------------------------------MPRIGIIGGSGVY-----G
MTAP_THEAC       -------------------------------------MTVNMAYIGIIGGSGLY-----D
MTAP_PYRAE       -----------------------MVKLTNPPKSPKELGFDEFPSIGIIGGSGLYDP---G
MTAP_CENSY       ------------------------------------------------------------
MTAP_NITMS       --------------------------------------MEKDVEIGIFGGTGIYDS---G
MTAP_RHOS4       ----------------------------------------MKTMIGVIGGSGVYEID--G
MTAP_RHORT       -----------------------------------MSEAYRQPVLGVIGGSGVYDID--G
MTAP_BRADU       ---------------------------------------MTQAVLGIIGGSGIYDLP--G
MTAP_CHLAA       ---------------------------------------MHSATIGVIGGSGLYAMP--D
MTAP_GEOSL       ----------------------------------------MEQVIGVIGGSGLYEME--G
MTAP_SYNY3       -------MGMIISMAMTAVTIWTKTKPGRVSCFIRKNSTMVNAPIGIIGGSGLYQME--A
MTAP_THEEB       ----------------------------------------MTAKIGIIGGSGLYKME--A
MTAP_GLOVI       -------------------------------------MSYPQARIGVIGGSGLYQMA--D
MTAP_KORVE       ----------------------------------------MQAEIGIIGGSGLYSMP--G
MTAP_PROMA       --------------------MINKHFSSEEIEQDGKSCLLKNARLGVLGGSGLYSID--S
MTAP_LEPIC       --------------------------------------MSYNVRVAIIGGTGLYSLE--G
MTAP_LEPIN       --------------------------------------MSYNVRAAIIGGTGLYSLE--G
MTAP_EMENI       -----MFLRSVSSIT-KPFRRIESPKQLARRMAVLPDTYADPVRIAVIGGTGLRELP--G
MTAP_ASPFU       MLGFSSLRRYLSSFTTRPLRRIESAKQLAKTMTVLPNTYDEPVRIAVIGGTGLRELP--G
MTAP_AJECG       -------------------------------MAALRDTYNDPVHIAVIGGTGLRELP--H
MTAP_PHANO       MLQRARLWPPIFTSRCAPFPFSRSISIPYRRMAGVPSTYDAPVHIAVIGGTGISSLP--G
MTAP_NECH7       -------------------------------MGDLPTTFDKPVHIAVIGGTGLGQLE--G
MTAP_NEUCR       -------------------------------MENLPTTYDGPVHIAVIGGTGLSKLE--G
MTAP_SCLS1       ------------------------------MVESLPTTFSDSVHIAVIGGTGLQSLE--G
MTAP_TUBMM       --------------------------------MPLPDTFSESVRIAVIGGTGISALEAEG
MTAP_CANAL       ------MVKLVLKGNNLSKLIKMSVHREKIDLAKLPHHYDGPVTLAVIGGTGLYDLP--N
MTAP_CANAW       ------MAKLVLKGNNLSKLIKMSVHREKIDLAKLPHHYDGPVTLAVIGGTGLYDLP--N
MTAP_YARLI       -------------MAFLPNLVATPM--------SLASSYSKPVTLGIIGGTGLYKLG--A
MTAP_SCHPO       -----------------------------------MNKQAEPILLGVIGGSGFYDLP--G
MTAP_YEAST       ----------MNRIKNTFSVAKRLKLSKVMTNSELPSIFEGTVDLGIIGGTGLYNLD--C
MTAP_COPC7       -------------------------------------MSEENVLIGVIGGSGLYQLD--N
MTAP_CRYNJ       ------------------------------------MENNEKVLVGCIGGSGLYHLD--N
MTAP1_PUCGT      -------------------------------------MTGHAPLVGVIGGSGLYKLE--G
MTAP2_PUCGT      -------------------------------------MTGHAPLVGVIGGSGLYKLE--G
MTAP_USTMA       -----------------------------MSVPTVTSWTGAPILLGVIGGSGLYKLD--S
                                                                             

PNPH_DICTD       FLENPEEIKVSTPYGE--VKLLKGIYQ------GEEVGFLA-RHGAGHTVPPHRINYKAN
PNPH_MOOTA       ILTNIHEERVETPYGA--AVLKVGTYH------GEEIGFMP-RHGDKHTVPPHKVNYRAN
PNPH_PYRFU       AE-NKREETVKTPYGE--VKITVGVVG------DEEVAFLA-RHGKGHSIPPHKINYRAN
PNPH_THEKO       LLTNIREETVETPYGT--VKVKIGEYN------GEEIVFLA-RHGEGHSVPPHKINYRAN
PNPH_KORCO       LLENPRIVRLDTPFGH--CDVQLGELA------GEEVAFIP-RHGASHRLPPYKVNYKAN
MTIP_THEYD       SEAKKEIITIKTPYGEPSCPYEIEKID------DIEVLFLR-RHGQKHSIPPHKVNYRAN
MTIP_METKA       PGLPERRRTVFTPYG--TVRVDITRVG------DHRVYFIN-RHGKGHDLPPHRINYRAI
MTIP_METTH       YGRLERRGSLITPYGK-TPEISVFKLH------GRRVAFIP-RHSPGHDKPPHMVNYRAN
MTIP_METAC       SHKDCESHPVTTPYG--RITAYLTSIK------GRSVVIIP-RHAEEIHIPPHRVNYRGN
MTIP_METJA       ILKGDKEEIINTKYG----KARVIIDK------ENEVVLLF-RHGVRHNIPPHKINYRAN
PNPH_ARCFU       VLKDVEETRIETPYG--TAEIDVGRVD------GIDVAIIQ-RHGKRKDKPPHRINHAAN
PNPH_AQUAE       GIKVKEEVQVKTPFGEPSSPVVIAEVE------GKKVAFLA-RHGRGHEYPPHLVPYRAN
MTIP_PSEAE       GLTLSESLPIETPYGAPSAPLQRGRYA------GREVLFLA-RHGHPHRFPPHQVNYRAN
MTIP_PSESM       GLNIRQSLPMNTPYGAPSGEIQIGDYA------GREVMFLA-RHGHPHRLPPHQVNYRAN
MTIP_XYLFA       QLDDVQVYEVETLYGRPSGPIRVGMLF------GQRVAFFA-RHGEEHALPPHKINYRAN
MTIP_XYLFT       QFDDVQVYEVETLYGRPSGPIRVGMLF------GQRVAFFA-RHGEEHALPPHKINYRAN
MTIP_XANCP       QLDQVQTHEVDTPYGAPSGPIRVGMLL------GHRVAFLA-RHGEGHSLPPHKVNYRAN
MTAP_MYCS2       FGSDARAVSVETPYGPPSAPITVGTVG------DHEVAFLP-RHGVKHEFSPHTVPYRAN
MTAP_MYCTU       FGSDTRTVNSDTPYGQPSAPITIGTIG------VHDVAFLP-RHGAHHQYSAHAVPYRAN
PNPH_STRCO       L-DDVTEVRVDTPYGPPSDSLFLGEVA------GRRVAFLP-RHGRGHHLPPHRINYRAN
MTAP_HUMAN       ILEGRTEKYVDTPFGKPSDALILGKIK------NVDCVLLA-RHGRQHTIMPSKVNYQAN
MTAP_MACMU       ILEGRTEKYVDTPFGKPSDALILGKIK------NVDCVLLA-RHGRQHTIMPSKVNYQAN
MTAP_BOVIN       ILEGRTEKYVDTPFGKPSDALVLGKIK------NVDCVLLA-RHGRQHTIMPSKVNYQAN
MTAP_MOUSE       ILEGRTEKYVDTPFGKPSDALILGKIK------NVDCVLLA-RHGRQHTIMPSKVNYQAN
MTAP_DANRE       ILEGRTERYVVTPYGKPSDALILGKIK------NVDCVLLA-RHGRQHTIMPTNVNYQAN
MTAP_XENTR       ILEGRLEKYVDTPFGKPSDALVLGKIK------NVDCVLLASRHGRQHTIAPTNVNYRAN
MTAP_ANODA       IIENRTERVVNTHFGIPSDVLIEGKIA------GVECVLLA-RHGRNHSIMPTNVNYRAN
MTAP_ANOGA       IIENRTERVVNTHFGIPSDVLIEGKIA------GVDCVLLA-RHGRNHSIMPSNVNYRAN
MTAP_AEDAE       ILESRSEKVVSTHFGNPSDVLIEGKIA------GVDCVLLA-RHGRNHSIMPSNVNYRAN
MTAP_DROME       ILEQRQERVVETPYGEPSDALIEGEIN------GVQCVLLA-RHGRKHDIMPSNVNYRAN
MTAP_DROPS       ILENRQEKVISTPYGEPSDALIQGEIG------GVQCVLLA-RHGRKHDIMPSNVNYRAN
MTAP_NEMVE       IMTDRQEKFVDTPFGKPSEPLITGNIQ------GVECVLIA-RHGRKHTVMPTDINYRAN
MTAP_CIOIN       LFTVKDKVNCNTPYGKPSSSLINGTLN------GIECVLLS-RHGDSHDIMPTDVNYRAN
MTAP_CAEBR       ILLNPTAISIDTPYGQPSDHLIQGTIN------GVECVLLA-RHGRKHDIMPGNVNYRAN
MTAP_CAEEL       ILLDPVTVAVDTPYGKPSDDVVEGTIN------GVECVLLA-RHGRKHDIMPGNVNFRAN
PNPH_DROME       YLAERMEYAVCTPFGKPSDVIIDGQIE------GVNVCLLS-RNGRNHDIMPSNINYRAN
PNPH_DROPS       SLQDRMEYAVCTPFGKPSDIIIEGLID------GVKCALLC-RNGRLHDIMPTNINYRAN
MTAP_HYPBU       VLENAKEYKIYTPYGEPSDYIIVGELG------GKRVAFLP-RHGRGHRIPPHKINYRAN
MTAP_SACS2       IFSESKEIKVYTPYGQPSDFITIGKIG------NKSVAFLP-RHGRGHRIPPHKINYRAN
MTAP_AERPE       IVENPVEVKVSTPYGNPSDFIVVGDVA------GVKVAFLP-RHGRGHRIPPHAINYRAN
MTAP_THEPD       FLTNPKEEKIYTPYGPPSSHVVIGEIA------GRKVAFIP-RHGKRHEIPPHKVNYRAN
MTAP_PYRFU       IFEPKETVKVHTPYGRPSAPVEIGEIE------GVEVAFIP-RHGKYHEFPPHEVPYRAN
MTAP_PYRHO       VFEPKEVVKVHTPYGRPSAPIEIGEIE------GVEVAFIP-RHGKYHEFPPHQVPYRAN
MTAP_PYRAB       VFEPKEVVKIHTPYGRPSAPVEIGEIE------GVEVAFIP-RHGKYHEFPPHEVPYRAN
MTAP_THEKO       VFEPKETVKVHTPYGRPSAPVEIGEIE------GVEVAFIP-RHGKHHEFPPHEVPYRAN
MTAP_THEAC       LMPESTKKVIETPFGNPSDAVEIGEVN------GVEVAFLP-RHGKKHTIPPHKVNYRAN
MTAP_PYRAE       IFENAVEVQIHTPYGLPSDNVIVGRVA------GRVVAFLP-RHGRGHKYPPHKIPYRAN
MTAP_CENSY       MLDNAEELSMDTPYGAPSDTITLGGIG------GRRLAFIP-RHGKKHNIAPHKINYRAN
MTAP_NITMS       LLEDAKEVDIDTPYGKPSDTITVGTFK------GRKIAFLP-RHGKKHTIPPHMINFKAN
MTAP_RHOS4       LEDAVWTKVE-TPWGDPSDEILTGRLD------GVPMAFLP-RHGRGHVHSPTTVPYRAN
MTAP_RHORT       LEGARWQTVE-SPFGDVSDQILRGTLD------GLEMAFLP-RHGRGHVLAPSDVNYRAN
MTAP_BRADU       LEGAHEEVIK-SPWGEPSAPLRRGTIA------GLPIVFLP-RHDKGHRLSPSDINYRAN
MTAP_CHLAA       LKNPEEVRLT-TPFGDPSDAFIIGELE------GRRVAFLP-RHGRGHRLNPSEVPARAN
MTAP_GEOSL       LQDVRSIVVE-TPFGAPSDEFVTGVLD------GVRMVFLP-RHGRGHRLLPTEVNYRAN
MTAP_SYNY3       LKNVEEVTLD-TPFGAPSDSFIVGELA------GVRVAFLA-RHGRGHHLLPSEIPFRAN
MTAP_THEEB       LTDVEEVRLT-TPFGDPSDAFICGKIG------GVPVVFLA-RHGRHHHLLPTEIPFRAN
MTAP_GLOVI       LADTVEVQFN-TPFGPPSDALVIGTLA------GERVAFLP-RHGRGHRLLPAELPFQAN
MTAP_KORVE       VSDVQEVRVT-TPFGEPSDPYVLGTLA------GRKVAFLA-RHGRGHRLLPTELNFRAN
MTAP_PROMA       IENIKELDIE-TPYGKPSDSLRIGNLG------GMEVVFLA-RHGRHHIYTPTEIPYRAN
MTAP_LEPIC       MELIEEIFPD-TPWGKPSDKIKIGKY------KGKLIAFLP-RHGIGHFLSPPEVPNHAN
MTAP_LEPIN       MELIEEIFPD-TPWGKPSDKIKIGKY------KGKLIAFLP-RHGIGHFLSPPEVPNHAN
MTAP_EMENI       FTQVASLNIQ-TPWGTPSSPITILHH--THKDKTVAVAFLS-RHGLHHQIAPHEVPARAN
MTAP_ASPFU       FTQVASLSIT-TPWGSPSSPITILHHQCSHNNKTVAVAFLS-RHGTHHQIAPHEVPARAN
MTAP_AJECG       FTQVASLNIT-TPWGPPSSPITILHHTCSTSGKVVPVAFLS-RHGLHHEYAPHEVPARAN
MTAP_PHANO       FELAATLDVD-TPWGKPSSPISILQHNSPTTGKPVPVAFLS-RHGLHHEHAPHEVKNQAN
MTAP_NECH7       FEPIAALNPI-TPWGAPASPIQILSH------KGVNVAFLA-RHGIHHQFAPHEVPNRAN
MTAP_NEUCR       YVPVAALNPT-TPWGSPSSPLMIFEH------NGHAVAFLA-RHGLYHQLAPHEVPARAN
MTAP_SCLS1       FIPIATINPL-TPWGYPSAPIHILSH------NNTPIAFLS-RHGTHHELAPHEIPNRAN
MTAP_TUBMM       FTAVASLDIQ-TPYGAPGSPLTILKT-----PQNTPIAFLS-RHGLHHELTPTEIPNRAN
MTAP_CANAL       LHPVARLTIS-TPWGFPSGSITISKT-----DSGFPVAFLA-RHGAHHDLLPSDVPSRAN
MTAP_CANAW       LHPVARLTIS-TSWGFPSGSITISKT-----DSGFPVAFLA-RHGAHHDLLPSDVPSRAN
MTAP_YARLI       LTPVAQIDID-TPWGKPSSPITISET-----KSGFPVAFLA-RHGVNHDLTPTDVPSRAN
MTAP_SCHPO       FDIVESVNPI-TPWGYPASPISIART-----TSGFLIAFLA-RHGVGHIYTPTEVPSRAN
MTAP_YEAST       LEPIALLPPMVTPWGTTSSPVTISQF--VGTNSHFHVAFIA-RHGINHEYPPTKVPFRAN
MTAP_COPC7       LTVVKTVNPE-TPWGFPSSPITIAALP-----SGTKVAFLA-RHGIGHVIPPSSVPSTAN
MTAP_CRYNJ       LTFVKTVHIE-TPWGKPSSPINISSLP-----SGALVAFIS-RHGSHHSITPSEVPCRAN
MTAP1_PUCGT      IEPVESLNID-TPWGRPSSPITLFKLP-----SGPVVAFLA-RHGVSHQFTPSEVPSRAN
MTAP2_PUCGT      IEPVESLNID-TPWGRPSSPITLFKLP-----SGPVVAFLA-RHGVSHQFTPSEVPSRAN
MTAP_USTMA       ITPVAEISIS-TPWGSASSPITIAKTS-----AGNHVAFLA-RHGRDHAILPSNVPNLAN
                            : :*                       ::  *:       .  :   . 

PNPH_DICTD       MWALKSLGVERILSTTAVGSLKLNLV-PGDLVILDQFIDFTK-NRDHTFYNGDDG-----
PNPH_MOOTA       IWALKMLKVERVLATAAVGSTNPEFR-PGDFVIVNDFLDFTK-TRTYTFFEGGET-----
PNPH_PYRFU       IWALYELGVERIIATSAVGSMNPEMK-PGDFVILDQIIDFTV-SRPRTFYDGEESPHER-
PNPH_THEKO       IWALYELGVERILSTSAVGSLNLDMK-PGDFVILDQLMDFTK-TRHYTFYDGEESPHDR-
PNPH_KORCO       LYALNMLEVERIIATNAVGSINPALE-PGTIVIPHDFIDMTK-CRDVTFYDGETTIKVRG
MTIP_THEYD       IYGFKNFGIERIFGVFATGSLTENIP-PGSIVIPNQIIDFTQGMRANTFYE-EKK-----
MTIP_METKA       VWAMRELGVKRILATNSVGVINSDEYEPGDIVLPVDFLDFTK-RRPTTFYDE--------
MTIP_METTH       IWALKELGVRQIIATNAVGSLKRSIG-PGDFVVPHDFLDFTR-SRPSTFYDE--------
MTIP_METAC       IWAAHSLGAKRVISTNSVGSMRGHPV--GSFVVLDDFIDFTR-SRPSTFHDD--------
MTIP_METJA       IYALKKLGVERILAINSVGSLKEDLK-PGMFFVPNDFIEFTK-KREETFYDEG-------
PNPH_ARCFU       FYALKSLGVKYVIGMGSVGALREEYS-LPSLIIPHDYIDFFS-G--VTIYNDS-------
PNPH_AQUAE       LWALREVGVKRVLGISAVGGINELLM-PGDFVVIHDYLDFTK-TRRSTYYEGKFSVKVEG
MTIP_PSEAE       LWALKQAGAEAVIAVNAVGGIHAAMG-TGHLCVPHQLIDYTS-GREHTYFAGDIE-----
MTIP_PSESM       IWALKQAGAEAILAVNAVGGIHPAMG-TGHFCVPHDLVDYTS-GRQHTFFADDLE-----
MTIP_XYLFA       IAALQQLGVSRVLALNTVGGINEAFG-PRTLVCPDQLIDYTW-GRVSTFCEEVGS-----
MTIP_XYLFT       IAALQQLGVSRVLALNTVGGINEAFG-PRTLVCPDQLIDYTW-GRVSTFCEEVGS-----
MTIP_XANCP       IAALQQIGATRVLALNTVGGITDSFG-PRVLACPDQLIDYTW-GRISTFCEEAGS-----
MTAP_MYCS2       LWALRSLGVRRVFAPCAVGSLTPDLG-PGSIVVPDQLVDRTS-GRDDTYFD---------
MTAP_MYCTU       MWALRALGVRRVFGPCAVGSLDPELE-PGAVVVPDQLVDRTS-GRADTYFD---------
PNPH_STRCO       LWALRSVGARQVLGPCAVGGLRPEYG-PGTLLVPDQFVDRTR-SRPSTYFDGLPMPDGT-
MTAP_HUMAN       IWALKEEGCTHVIVTTACGSLREEIQ-PGDIVIIDQFIDRTT-MRPQSFYDGSHS-----
MTAP_MACMU       IWALKEEGCTHVIVTTACGSLREEIQ-PGDIVIIDQFIDRTT-MRPQSFYDGSHS-----
MTAP_BOVIN       IWALKEEGCTHVIVTTACGSLKEEIQ-PGDIIIIDQFIDRTT-RRLQTFYDGNHS-----
MTAP_MOUSE       IWALKEEGCTHVIVTTACGSLREEIQ-PGDMVIIDQFIDRTS-LRPQTFYDGSHC-----
MTAP_DANRE       IWALKEEGCTHLLVTTACGSLREDIQ-PGDIVLIDQFIDRTT-KRVQTFYDGQPT-----
MTAP_XENTR       IWALKSEGCTHILVTTACGSLREEIQ-PGDIVIVDQFIDRTT-KREQTFYDGGPS-----
MTAP_ANODA       IWALKTLGCTHVLVSTATGSLRDEIH-PGDIVIPDNFIDRTT-KRVQTFYDGNE------
MTAP_ANOGA       IWALKTLGCTHVIVSTATGSLKEEIH-PGDIVIPDNFIDRTT-KRVQTFYDGNE------
MTAP_AEDAE       IWALKTVGCTHVIVSTATGSLQERIH-PGDLVIPDNFIDRTT-KRAQTFYDGND------
MTAP_DROME       IWALRDVGCTHLIVSTACGSLREEIK-PGNLVVPHDFIDRTT-KRLQTFYDGKAQ-----
MTAP_DROPS       IWALRDVGCTHLIVSTACGSLREQIK-PGNLVMPHDFIDRTT-KRSQTFYDGSAT-----
MTAP_NEMVE       VWALKEEGCTHIVVTTACGSLTEAYR-PGEIVFPDQIIDRTT-KRPSTFYDGQTN-----
MTAP_CIOIN       LYALKEAGCSIILATTACGSLQEELK-PTDFVVIDQFIDRTT-KRHSTFYDGQNV-----
MTAP_CAEBR       LWALYSLGVDVIIASTACGSLKEEVA-PGHLLFPDSVFDRTN-SRKATFFDGTFS-----
MTAP_CAEEL       LWALYSRGVDVIIASTACGSLQENVE-PGHLLFPDSVFDRTT-GRQSTFFDGSYD-----
PNPH_DROME       VWAMRKMGCTHILVTNTFSSLRDTFQ-PGHLVVPNDVIDYTS-RRAQTFYDGAVG-----
PNPH_DROPS       IWAMRKLGCTHILVTHSLSSLREDIM-PGDFVVPNDLIDHTT-RRAQTFYDGALG-----
MTAP_HYPBU       IWALKMLGVKWVIAVSAVGSLREDYK-PGDIVVPDQFIDMTKSR-VYTFFDEG-------
MTAP_SACS2       IWALKELGVRWVISVSAVGSLRMDYK-LGDFVIPDQFIDMTKNR-EYSFFDGP-------
MTAP_AERPE       IWALKALGVKWVISVSAVGSLREDYR-PGDFVVPDQFIDMTKNRRHYTFYDGP-------
MTAP_THEPD       IYALKELGVERLISVSAVGSLREDYK-PGDFVCTDQFIDMTKGR-VYTFYDGP-------
MTAP_PYRFU       IWALHELGVERVIAVNAVGSLKEEYK-PGDIVIIDQFIDFTKKR-EYTFYNGP-------
MTAP_PYRHO       IWALHELGVERVIAINAVGSLKEEYK-PGDIVIIDQFIDFTKKR-EYTFYNGP-------
MTAP_PYRAB       IWALYELGVERIIAINAVGSLKEEYK-PGDIVIIDQFIDFTKKR-EYTFYNGP-------
MTAP_THEKO       IWALKELGVERVIGITAVGSLREEYK-PGDIVITDQFIDFTKKR-DYTFYNGP-------
MTAP_THEAC       IWALHELGVERIIGLNAVGSLREDYK-PGEIVIPDQYIDFTKRR-DLTFYDGP-------
MTAP_PYRAE       IYSLYMLGVRSIVAVSAVGSLRPDYA-PGDFVVPDQFVDMTKGR-EYTFYDGP-------
MTAP_CENSY       IWALQKLGVSRVVAPSAVGSLREELA-PGRFVVPSQFLDFTRTR-EGSFSEDG-------
MTAP_NITMS       IWAFKELGVTRIIAPSAVGSLKEELA-PGHFVLPTQFLDFTKSR-DGSFSEDG-------
MTAP_RHOS4       IDALKRLGVTDLVSVSACGSFREEMA-PGDFVIVDQFIDRSFA-RAKSFF----------
MTAP_RHORT       IDALKRAGVTEILSVSAVGSLAEDLP-PGTFVIADQFIDRTFA-REKSFF----------
MTAP_BRADU       IDVLKRAGVTDLISLSACGSFKEEMP-PGTFVLVDQFVDRTHK-RESSFF----------
MTAP_CHLAA       IYAFKLLGVRALISVSAVGSLREDYA-PGHAVIPDQIFDRTKGIRPATFF----------
MTAP_GEOSL       IYGMKKLGVTRIISVSAVGSMREEIV-PGHIVIPDQFIDRTNATRANTFF----------
MTAP_SYNY3       IHGMKQLGVKYLISASAVGSLQAEAK-PLDMVVPDQFIDRTRQ-RISTFF----------
MTAP_THEEB       IYGFKSLGVEYLLSASAVGSLQEAVK-PLDIVVPDQFIDRTRN-RISTFF----------
MTAP_GLOVI       IYAMKMLGVEYLLSASAVGSLREEYR-PRDIVFPDQFFDRTKD-RPSTFF----------
MTAP_KORVE       IHGFKQLGVERIISVSAVGSLKEEHR-PLEFVIPDQFYDRTKQ-RVSTFF----------
MTAP_PROMA       IWALRSLNVRWILSPSAVGSLQEQVR-PLDMVVPDQFIDRTHQ-RPLTFF----------
MTAP_LEPIC       ICALKQLGVEEIVAFSSVGSLREEIK-PLDFVLPSQIIDRTRFRNSTYFG----------
MTAP_LEPIN       ICALKQLGVEEIVAFSSVGSLREEIK-PLDFVLPSQIIDRTRFRNSTYFG----------
MTAP_EMENI       IAALRSIGVRTIIAFSAVGSLQEEIK-PRDFVVPDQVIDRTKGIRPFTFF----------
MTAP_ASPFU       IAALRSIGVRTIIAFSAVGSLQEEIK-PRDFVIPDQVIDRTKGVRPWTFF----------
MTAP_AJECG       IAALRSIGVRSIVAFSAVGSLQEAIK-PRDFVVPDQVIDRTKGVRPWTFF----------
MTAP_PHANO       IAALRHIGVRTIIAFSAVGSLQEEVR-PRDFVVPDQIIDRTKGIRPFTFF----------
MTAP_NECH7       IAALRHIGVRCVIAFSAVGSLQEEIK-PMDFVVPDQVIDRTKGVRPFTFF----------
MTAP_NEUCR       IAALRSIGVRTIIAFSAVGSLREEIK-PMDFVIPDQIIDRTKGIRPFTFY----------
MTAP_SCLS1       IAALRSMGVRTIIAFSAVGSLREEIK-PRDFVVPDQVIDRTKGVRPFTFF----------
MTAP_TUBMM       IAALRSIGVRSIIAFSAVGSLQEHIR-PRDFVVPSQIIDRTKGLRASTFF----------
MTAP_CANAL       IAALKRLGVKAIIAFSAVGSLQQEIK-PRDFVLPTQIIDRTKGIRPSTFF----------
MTAP_CANAW       IAALKKLGVKAIIAFSAVGSLQQEIK-PRDFVLPTQIIDRTKGIRPSTFF----------
MTAP_YARLI       IAALKKVGVKAIVAFSAVGSLQEEIA-PRDFVVPTQIIDRTKGIRPSSFF----------
MTAP_SCHPO       IAALKSLGVLAIVSFSAVGSLREDIP-PEDFVLPTQIIDRTLCARPNTFF----------
MTAP_YEAST       MAALKNLNCKAVLSFSAVGSLQPHIK-PRDFVLPQQIIDRTKGIRHSSYFN---------
MTAP_COPC7       IAALKSLGVSAILSFSAVGSLREEIS-PGSFALPSQIIDRTKGIRDSSFFNG--------
MTAP_CRYNJ       IAALKHIGCEAIIAFSAVGSLREEIA-PGHFIIPDQIIDRTKGIREDTFFRG--------
MTAP1_PUCGT      IAALKKIGCQVIIAFSAVGSLREEIK-PRDIVVPSQIIDRTKSVRPCTFFEG--------
MTAP2_PUCGT      IAALKKIGCQVIIAFSAVGSLREEIK-PRDIVVPSQIIDRTKSA----------------
MTAP_USTMA       IAALKHLGVKAIVAFSAVGSLREEIA-PKDFVIPSQIIDRTKGVRRASFFGFGDE-----
                 .          :.   : .                .  :                     

PNPH_DICTD       -----------KVIHIDFTN-PYCPELRNILYETSKEIG------------------IKA
PNPH_MOOTA       -----------GVVHTDFTT-PYCPELGQVLVETAARLG------------------IKA
PNPH_PYRFU       ----------KFVAHVDFTE-PYCPEIRKALITAARNLG------------------LPY
PNPH_THEKO       ----------KFVAHVDFTE-PYCPELRKALMNAARELG------------------FTY
PNPH_KORCO       RE-------VSGVVHVSMTPYTYCPEIRASIIEAAEHMG------------------LGV
MTIP_THEYD       ------------VVHIDFTE-PFCSEIRHYLLETARKIG------------------INV
MTIP_METKA       -----------KVVHVDVTE-PYCPELREALLKAADDLG------------------YTV
MTIP_METTH       -----------KTVHVDMTE-PYCRNIRSALSGSSG-----------------------V
MTIP_METAC       -----------KTVHVDVSE-PYCPEIRASLRYSLEKRG-------------------IS
MTIP_METJA       -----------KVVHIDMTD-PYCPELRNILKSILDKNN-------------------FS
PNPH_ARCFU       -----------LVHVTPGFD-EYLREVLVEVARKISSFP--------------------V
PNPH_AQUAE       EDKVAKLLREGKVVHVDMSE-AYCPEMRKVLIQILKEKN------------------FRF
MTIP_PSEAE       -----------HVTHIDFSH-PYDEPLRQRLIEALRALG------------------LAH
MTIP_PSESM       -----------EVTHIDFSY-PYSEALRVRLVAALAAEG------------------CAF
MTIP_XYLFA       -----------EVLHVDFGH-PYSPLLRGCLLRAARDVD------------------VSL
MTIP_XYLFT       -----------EVLHVDFGH-PYSPLLRGCLLRAARDVD------------------VSL
MTIP_XANCP       -----------EVQHVDFGH-PYSPMFRSKVIAAAKVTG------------------VTL
MTAP_MYCS2       ----------SGGIHVAFAD-PYCPTLRAAATGLPG-----------------------V
MTAP_MYCTU       ----------FGGVHAAFAD-PYCPTLRAAVTGLPG-----------------------V
PNPH_STRCO       ---------VPNVVHVSLAD-PYCPTGRAAALKAARGRE------------------WEP
MTAP_HUMAN       --------CARGVCHIPMAE-PFCPKTREVLIETAKKLG------------------LRC
MTAP_MACMU       --------CARGVCHIPMAE-PFCPKTREVLIETAKKLG------------------LRC
MTAP_BOVIN       --------CARGVCHIPMAE-PFCPKTREVLIETAKKLG------------------LRC
MTAP_MOUSE       --------SARGVCHIPMAE-PFCPKTREVLIETAKKLG------------------LRC
MTAP_DANRE       --------SPPGVCHIPMAE-PFCSKTREVLLEVAQGLG------------------VKC
MTAP_XENTR       --------CLPGVCHIPMAE-PFCAKTREVLIDIAKRLG------------------IKC
MTAP_ANODA       --------LLVGVCHIPMEP-AFCSRTRDVLIETARELGI-----------------AGV
MTAP_ANOGA       --------LLSGVCHIPMEP-AFCNRTRDVLIETARGIG------------------LGV
MTAP_AEDAE       --------MLVGVCHVPMEP-AFCSRTREVLIETAKELGL-----------------VGV
MTAP_DROME       --------SPRGVCHLPMFP-AFSERTRNILLQAAKELE------------------IPA
MTAP_DROPS       --------SPRGVCHLPMYP-AFSERTRNILIEAAKELE------------------IPA
MTAP_NEMVE       --------SPVGVCHIPMHD-PYCSVTKQILANEAQKLG------------------IPH
MTAP_CIOIN       --------QMKGVCHIPMRN-PFCEKLQNVLLSACNVNN------------------VSC
MTAP_CAEBR       --------GAPGVSHIQAHP-TYNEKLRQVLISTAEKCK------------------LVH
MTAP_CAEEL       --------QAPGVCHIQAHP-TYNEKLRQVLISTAERCQ------------------LVH
PNPH_DROME       --------SPLGVCHVPMNP-TFCERTRQHLLSAAEELG------------------FPT
PNPH_DROPS       --------SPFGVCHLPMYP-AFCERTRQHLLNAAQELD------------------LAT
MTAP_HYPBU       -----------IVAHVSMA-DPFCEHLRQEIISTARELG------------------YRV
MTAP_SACS2       -----------VVAHVSMA-DPFCNSLRKLAIETAKELN------------------IKT
MTAP_AERPE       -----------VTVHVSMA-DPFCEDLRQRLIDSGRRLG------------------YTV
MTAP_THEPD       -----------VVAHVSMA-DPFCPELRELCIRSARKLG------------------ITM
MTAP_PYRFU       -----------RVAHISMA-DPFCPELRRIFIETAKELN------------------LPV
MTAP_PYRHO       -----------KVAHVSMA-DPFCPELRKIFIETAKELN------------------LPV
MTAP_PYRAB       -----------KVAHVSMA-DPFCPELRRIFIETAKELG------------------LPV
MTAP_THEKO       -----------RVAHVSMA-DPFCPEMRKIFYETAKELG------------------FPV
MTAP_THEAC       -----------QVYHISEA-DPFCPEMNSILYDTARNLK------------------IPV
MTAP_PYRAE       -----------RTCHIQIGLEPFTQEIRQILIETAKKYN-------------------RT
MTAP_CENSY       -----------RVIHISVA-EPFCPELRTVLLDAAG----------------------DA
MTAP_NITMS       -----------RVIHISVA-DPFCPELQSSITEVTDSLD------------------MNI
MTAP_RHOS4       --------GSGCVAHVSLAH-PTCGRLSALCAEAAR----------ATGVTVHE------
MTAP_RHORT       --------GKGLVAHVSMAH-PVSAWLGDRVEEVLA----------DLAIPHRR------
MTAP_BRADU       --------GRGCVAHVSMAH-PVSPRLRIHLAAAAE----------AEGIAIAR------
MTAP_CHLAA       --------EGGVVAHVAFDR-PFCPYLSNILLHAAQ----------AAGAVVHQ------
MTAP_GEOSL       --------GNGVVAHIQFAD-PVCADLSADLYAAAQ----------EAGATVHR------
MTAP_SYNY3       --------GEGIVAHIGFGN-PICPQLAQCLSTAIA----------GLELEGVT-----L
MTAP_THEEB       --------GDGIVAHIGFAD-PVCPALAGVLADAIA----------DLNLPDVT-----L
MTAP_GLOVI       --------GGGLVAHIGFDQ-PICTELAHLAAEAAR----------GVELIGETR----I
MTAP_KORVE       --------GEGIVAHVGFGD-PVCGEMAKVVKHATD----------KAGVVAKA------
MTAP_PROMA       --------CDGAVAHVTMAD-PFCPTLSRLLAEEGE----------LLMPEARQ-----V
MTAP_LEPIC       ---------NGVVAHAPFAE-PFSPNLSKRIAQTAKK----------IGLEIHL------
MTAP_LEPIN       ---------NGVVAHAPFAE-PFSPNLSKRIAQTAKK----------IGLEIHL------
MTAP_EMENI       --------EGGVVGHVPFGD-PFDESVAKIVRACGHS-------LEGEGVKLHD------
MTAP_ASPFU       --------EGGVVAHVPFGD-PFDEGVAKVVRACGHS-------LEGEGVVLHD------
MTAP_AJECG       --------EGGAVAHVGFAD-PFDEQMAKVVRACGHS-------LEGDGVVLHD------
MTAP_PHANO       --------EKGMVGHVGFGD-PFDKSLAEIVRKCGHS-------LEGEGVRLHD------
MTAP_NECH7       --------EGGVVGHVGFAD-PFDAGLAKVVKTCAEH-------MEGDGVVLHE------
MTAP_NEUCR       --------EGGVVGHVGFAD-PFDAGLAQVVEKCASA-------MKGDGVVLHN------
MTAP_SCLS1       --------EKGVVGHVGFAD-PFDERIAKVVRECGHA-------LEGEGIVLHD------
MTAP_TUBMM       --------EGGLVGHVGFAD-PFDSELSKVVFDIGSDG-----VLNGEGVKMHK------
MTAP_CANAL       --------EKGFVAHAMFGE-PFDLKLNKLISDAIPSKGFLEGFDTDGTPVLHTKENTNN
MTAP_CANAW       --------EKGFVAHAMFGE-PFDLKLNKLISDAIPSKGFLEGFDTDGTPVLHTKENTNN
MTAP_YARLI       --------EKGFVGHVGFGE-PFDVALGKLVAEHAD-----KAFD-NSKYKIHTKAKA--
MTAP_SCHPO       --------ESGCVAHVSFGD-PFDQDLYEILSSCGS--------NLKNGSKLHTKRKG--
MTAP_YEAST       --------DEGLVGHVGFGQ-PFSQKFAEYIYQFKNEITN---PESEEPCHLHYD-----
MTAP_COPC7       ---------TSIVAHAMFGD-PFSNKLIRWLEPRVRKALE----KEGKGKLLFT------
MTAP_CRYNJ       ---------EGLVVHSMFGE-PFSQKLNAFVAPRVEKILK----ETGD-VVLHT------
MTAP1_PUCGT      ---------LGVVGHAMFGE-PFDTELTGLVTKSIKEAVTG--FEMNDRIGVHA------
MTAP2_PUCGT      --------------HAMFGE-PFDTELTGLVTKSIKEAVTG--FEMNDRIGVHA------
MTAP_USTMA       ---------ESVVAHAGFGD-PFCETLRPIVYSTVQATLAS--------------HPIKV
                                                                             

PNPH_DICTD       HPFGTYVCTEGPRFETPAEIKMYSF-FG-DVVGMTNVPEVILARELEICYASVSLVTNYA
PNPH_MOOTA       HAGGVYACTEGPRFETPAEIRMIRQ-LGGDLVGMTNVPEVVLAHEVGLCYGLIAMVTNMA
PNPH_PYRFU       HPRGTYVCTEGPRFETAAEIRAYRI-LGGDVVGMTQCPEAILARELEMCYATVAIVTNYA
PNPH_THEKO       HPMGTYACMEGPRFETRAEIRALKI-LGADVVGMTQCPEAALARELEMCYASVAIVTNYA
PNPH_KORCO       RDGGVYVCTEGNRFETPAEIRAFSI-LGGDIVGMTGCPEASLARELAICYASISVVTNYA
MTIP_THEYD       ISHATYICVNGPRLETAAEIKFFKN-IGADIIGMTIMPEASLAREVEICYAAVAVVANYA
MTIP_METKA       KEGAVYVATEGPRFETPAEIRAFRK-LGGDIVGMTGFPEVVLARELEICYASVCLCTNYA
MTIP_METTH       VDGGVYVCTEGPRFETPAEIRMFQT-LGGTVVGMTGLPEAVLARELEMCYASICLVSNYA
MTIP_METAC       YTEGVYACTEGPRFETRAEIRMMSQ-FA-DVVGMTGVPEVVLAKELSLCYASLSIVTNQA
MTIP_METJA       YGEGVYVCTEGPRFETKKEIAIYKN-WG-DVVGMTGYPEVVLARELEMCYVSLCNITNYA
PNPH_ARCFU       IDKGVYFQTRGPRLETKAEIAMIKS-FA-DCVGMTAGSEATIARELGLSYAIVCTMDNYA
PNPH_AQUAE       HPKGVYACTEGPRFETPSEIKMLKL-LGADVVGMTGYPEVALARELTMCYASLCVVANPA
MTIP_PSEAE       SSHGVYACTQGPRLETVAEIARLER-DGNDIVGMTGMPEAALARELDLPYACLALVVNPA
MTIP_PSESM       SDRGVYACTQGPRLETVAEIIRLER-DGCDIVGMTGMPEAALARELELEYACLALVVNPA
MTIP_XYLFA       VEYGCYGVTQGPRLETIAEIARLRR-DGCDLVGMTGMPEAALAREKGLEYACLGIVSNWA
MTIP_XYLFT       VEYGCYGVTQGPRLETIAEIDRLRR-DGCDLVGMTGMPEAALAREKGLEYACLGIVSNWA
MTIP_XANCP       VAGGCYGATQGPRLETIAEIARMRR-DGCDLVGMTGMPEAALAREKGLEYACLAIVANWA
MTAP_MYCS2       VDGGTMVVIQGPRFSTRAESRWFAS-QGFTLVNMTGYPEAVLARELEMCYAAVALVTDLD
MTAP_MYCTU       VDGGTMVVIQGPRFSTRAESQWFAA-AGCNLVNMTGYPEAVLARELELCYAAIALVTDVD
PNPH_STRCO       VDGGTLVVVEGPRFGTRAESLWHRA-QGWSVVGMTGHPEAALARELELCYTSLTLVTDLD
MTAP_HUMAN       HSKGTMVTIEGPRFSSRAESFMFRT-WGADVINMTTVPEVVLAKEAGICYASIAMATDYD
MTAP_MACMU       HSKGTMVTIEGPRFSSRAESFMFRT-WGADVINMTTVPEVVLAKEAGICYASIAMATDYD
MTAP_BOVIN       HSKGTMITIEGPRFSSRAESIMFQT-WGADVINMTTVPEVVLAKEAGICYASIAMATDYD
MTAP_MOUSE       HSKGTIVTIEGPRFSSRAESLIFRT-WGADVVNMTTVPEVVLAKEAGICYASIAMATDYD
MTAP_DANRE       HTRGTMVTIEGPRFSSRAESLMFRQ-WGADVINMTTVPEVVLAKEAGLCYASIAMATDYD
MTAP_XENTR       HSKGAMITIEGPRFSSKAESQMFRL-WGADVINMTTVPEVILAKEAGICYASIAMATDYD
MTAP_ANODA       HNSGTVVTIEGPRFSSKAESNLFRQ-WGAHLVNMTLVPEVVLAKEAGLCYAAIAMATDYD
MTAP_ANOGA       HEKGTVVTIEGPRFSSKAESNLFRQ-WGADLVNMTLVPEVVLAKEAGLCYAAIAMATDYD
MTAP_AEDAE       HNKGTVVTIEGPRFSSKAESNLFRQ-WGADLVNMTLVPEVVLAKEAGLCYAAIAMATDYD
MTAP_DROME       HDKATIVTIEGPRFSSRSESHMFRQ-WGGDLINMTTCPEVVLAKEAGLLYGSVAIATDYD
MTAP_DROPS       HEKATIVTIEGPRFSSRSESLMFRE-WGGDLINMTTCPEVVLAKEAGLLYGSVAIATDYD
MTAP_NEMVE       HASGVNVVIEGPRFSTRAESRMFRG-LGGEIISMTAMPEVALANEAGLCYAAIAMVTDYD
MTAP_CIOIN       HSKGTMVTIEGPRFSTYAESNLFRK-WGGSLINMTTVPEVVLANELGMLYAALAMVTDYD
MTAP_CAEBR       HRTGFGVCIEGPRFSTKAESMVFKS-WGASLVNMTMMPECILAKELGIPYATTALVTDYD
MTAP_CAEEL       HRTGFGVCIEGPRFSTKAESMVFKS-WGASLVNMTMMPECILAKELGIPYATTALVTDYD
PNPH_DROME       GSSGTVLTLEGPRYSTVAENNMFRK-WGADLLSMTLCPEAILAKEAGIPYASLGLVTNME
PNPH_DROPS       HSKATVLTLEGPRYSTLAENNIYRK-WGADLLSMTLSPEATLAKEAGILYASIGLVTNIE
MTAP_HYPBU       HPRGTYICIEGPRFSTRAESRVWREVFKADIIGMTLVPEVNLACEAQLCYATIALVTDYD
MTAP_SACS2       HESGTYICIEGPRFSTRAESRTWREVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYD
MTAP_AERPE       HERGTYVCIEGPRFSTRAESRVWKDVFKADIIGMTLVPEINLACEAQLCYATLAMVTDYD
MTAP_THEPD       HEKGTYICIEGPRFSTRAESRLWRQ-FGADIIGMTLVPEVNLAREARMCFLNIAMVTDYD
MTAP_PYRFU       HEKGTYICIEGPRFSTRAESRMFRQ--FADVIGMTLVPEVNLARELGMCYVNISTVTDYD
MTAP_PYRHO       HERGTYVCIEGPRFSTRAESRMFRQ--FADVIGMTLVPEVNLARELGMCYVNISTVTDYD
MTAP_PYRAB       HEKGTYICIEGPRFSTRAESRMFRQ--FADVIGMTLVPEVNLARELGMCYVNISTVTDYD
MTAP_THEKO       HEKGTYVCIEGPRFSTRAESFMFRQ--FAHIIGMTLVPEVNLARELGMCYVNIATVTDYD
MTAP_THEAC       HNSGTYITIEGPRFSTRAESKMFRQ--FADIIGMTLVPEVSLAGELALCYSVIASITDYD
MTAP_PYRAE       HDGGCYVCIEGPRFSTKAESRIWREVFGCDIIGMTLVPEINLARELGMCYGLIALVTDYD
MTAP_CENSY       HDGGTYACIEGPRFSTRAESALFRA-AGADIIGMTMVPECQLSREAQMCYASVSTVTDYD
MTAP_NITMS       HKDCTYVCIEGPRFSTKAESKFYRT-TGADIIGMTLVPECQLAREAQICYASISTVTDYD
MTAP_RHOS4       --GGTYLCMEGPQFSTLAESLLYKS-WGCHVIGMTNMPEAKLAREAEICYASVAMVTDYD
MTAP_RHORT       --GGTYLCMEGPQFSTLAESNLYRQ-WGCHVIGMTNMPEAKLAREAEIAYCTVAMVTDFD
MTAP_BRADU       --GGTYVCMEGPQFSTYAESMTYKT-SGYSVIGMTNMPEAKLAREAEICYATVAMVTDFD
MTAP_CHLAA       --GGTLVVMEGPQFSTKAESEENRR-RGHSLIGMTALPEAKLAREAEIAYATLAMVTDYD
MTAP_GEOSL       --GGTYICMEGPAFSTRAESNLYRS-FGVSVIGMTNIPEAKLAREAEICYGVIALATDYD
MTAP_SYNY3       HDRGTYVSMEGPAFSTIAESNLYRS-WGGTVIGMTNLPEAKLAREAEIAYATLALVTDYD
MTAP_THEEB       HRQGTYVCMEGPAFSTLAESNLYRS-WGGTVIGMTNLPEAKLAREAEIAYATLALVTDYD
MTAP_GLOVI       HTGGTYVCMEGPAFSTLAESRLYRS-WGMDIIGMTNLQEAKLAREAEICYATMALVTDYD
MTAP_KORVE       --GGTYVCMEGPQFSTKAESNLYRS-WGFDVIGMTNLQEAKLAREAELCYVTVAMVTDYD
MTAP_PROMA       HKGGTYLAMEGPAFSTRAESQLYRS-WGCKVIGMTNHTEARLAREAEIAYTSLSMVTDYD
MTAP_LEPIC       --DKTLVCMEGPLFSTKAESHLYRS-WGADIINMTVLPEAKLAREAEIAYQMICMSTDYD
MTAP_LEPIN       --DKTLVCMEGPLFSTKAESHLYRS-WGADIINMTVLPEAKLAREAEIAYQMICMSTDYD
MTAP_EMENI       --RGTLICMEGPQFSTRAESKLYRS-WGGSVINMSCLPEAKLAREAEIAYQMICMSTDYD
MTAP_ASPFU       --RGTLICMEGPQFSTRAESNLYRS-WGGSVINMSCLPEAKLAREAEIAYQMICMSTDYD
MTAP_AJECG       --RGTLICMEGPQFSTRAESNLYRS-WGGSIINMSCIPEAKLAREAEIAYQMICMSTDYD
MTAP_PHANO       --KGLLICMEGPQFSTRAESNLYRT-WGGSVINMSALPEAKLAREAEISYQMICMATDYD
MTAP_NECH7       --KGTVIVMEGPQFSTRAESHMYRS-WGGSVINMSTLPEAKLAREAEMAYQVIAMATDYD
MTAP_NEUCR       --KGTIICMEGPAFSTRAESHMYRS-WGGSVINMSALPEAKLAREAELAYQMICMATDYD
MTAP_SCLS1       --KGTIICMEGPAFSTRAESHMYRS-WGGSVINMSALPEAKLAREAEMVYQMICMATDYD
MTAP_TUBMM       --DALLICMEGPQFSTRAESNLYRS-WGGDVINMSALPEAKLAKEAEIAYVMVCMSTDYD
MTAP_CANAL       GEDLTIICMEGPQFSTRAESRLYRS-WGGSVINMSVLPEAKLAREAEIAYQMICMSTDYD
MTAP_CANAW       GEDLTIICMEGPQFSTRAESRLYRS-WGGSVINMSVLPEAKLAREAEIAYQMICMSTDYD
MTAP_YARLI       GKDLTLVCMEGPAFSTRAESQLYRS-WNGAVINMSAIPESKLAKEAEIAYQMICMSTDYD
MTAP_SCHPO       -DDLTVVCMEGPAFSTRAESNLYRS-WGASIINMSVIPEAKLAREAEIAYQMVCMATDYD
MTAP_YEAST       -KDMTVVCMEGPQFSTRAESKMYRM-FGGHVINMSVIPEAKLARECELPYQMICMSTDYD
MTAP_COPC7       --DKTIVCMEGPQFSTRAESVMYRQ-WGGDLINMSVLPEAKLAREAELSYALIAMATDYD
MTAP_CRYNJ       --GKTVVCMEGPAFSTRAESLMYRQ-WGGDIINMSVIPEAKLAREAELDYTLICTSTDFD
MTAP1_PUCGT      --EKVAICMEGPAFSTRAESNMYRM-FGGDIINMSVLPEAKLAREAELSYALIAQITDYD
MTAP2_PUCGT      --EKVAICMEGPAFSTRAESNMYRM-FGGDIINMSVLPEAKLAREAELSYALIAQITDYD
MTAP_USTMA       HTDKTVVCMEGPQFSTRAESLMYRT-WGGDIINMSVLPEAKLAREAEIAYVLIATATDYD
                          .*    :  *            :.*:   *  :: *  : :       :  

PNPH_DICTD       AGI-SPN-PLTHSEVLEVMTQNIEKVRKLFAAVIPKIPK---------------------
PNPH_MOOTA       AGI-SST-PLSHEEVLEIMDQNGKNLRDLIMQAIPGIPR---------------------
PNPH_PYRFU       AGM-SGK-KLTHSEVVELMQKKSEDIVKLILAAIPLIPK---------------------
PNPH_THEKO       AGI-SPN-KLTHTEVVELMAQKSNEIKLLLMKAIEYIPK---------------------
PNPH_KORCO       AGV-SGAVKLTQGEVIEIFSRKIQDISRLIEETIRRIPK---------------------
MTIP_THEYD       AGI-SKF-PLTVKEVIETMEDSLDAVGFLIKETIKKLPE---------------------
MTIP_METKA       AGI-DDR-RRTIDEVFELVEELRPKAVELIERCIEYIPP---------------------
MTIP_METTH       ASI-SPS-KLTIDEVFEIMDEKKNDLIDIIDAAIRDLKT---------------------
MTIP_METAC       CGM-TTQ-KLTADEVTEVVGKAQASIFKILSDAIGKIPE---------------------
MTIP_METJA       CGI-SKN-ILTVDEVLEKIKEMENKILKVVEDFINYGFG---------------------
PNPH_ARCFU       HGI-KNQ-SIDYREIVEKAKENARECLKIVEEAVKKVWE---------------------
PNPH_AQUAE       AGI-AGY-RLTSNEVIQLMKRKEEEIKEVVLKFIKELPE---------------------
MTIP_PSEAE       AG--KSAGIITMAEIEQALHDGIGKVREVLARVLAG------------------------
MTIP_PSESM       AG--KSTAVITMAEIEQALRDGMGKVKATLARVLSAS-----------------------
MTIP_XYLFA       AGC-GDGAEITMGEILSNVATVFRN-----------------------------------
MTIP_XYLFT       AGC-GDGAEITMGEILSNVATAFSCLPELISKVARE------------------------
MTIP_XANCP       AGC-GDAQEITMAEVLSNVDAASSGLPELIGELARG------------------------
MTAP_MYCS2       AGI-EVGSGVRAVDVFAEFERNMPPFKKLVFEALEAVEV---------------------
MTAP_MYCTU       AGV-AAGDGVKAADVFAAFGENIELLKRLVRAAIDRVAD---------------------
PNPH_STRCO       AGA-ESGEGVSHEEVLRVFAANVDRLRGVLFDAVAALPAS--------------------
MTAP_HUMAN       CWK-EHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGST--------------------
MTAP_MACMU       CWK-EHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGST--------------------
MTAP_BOVIN       CWK-EHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSM--------------------
MTAP_MOUSE       CWK-EHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSM--------------------
MTAP_DANRE       CWK-EHEEAVCVDNVLKTMKENANKASSILLTAIPQICQM--------------------
MTAP_XENTR       CWK-EHEEAVSVDRVLKTLKENANKATSILLTAIPQIAAM--------------------
MTAP_ANODA       CWR-ETGEDVNVADVLATFKKNVTKVTELIINAIPKIAAL--------------------
MTAP_ANOGA       CWR-EAGEDVNVADVLATFKKNVTKVTDLIINAIPKVAAL--------------------
MTAP_AEDAE       CWR-DCGENVNVADVMATFKKNVTKVTQLITAVIPKIAEM--------------------
MTAP_DROME       CWR-MGCEGVNVQDVLRTFAENVIKVKKILVNAVGRIAKE--------------------
MTAP_DROPS       CWR-MGCEGVNVQDVLKTFAENVIKVKKILVNAVGRIAKE--------------------
MTAP_NEMVE       CWR-DDHAPVTVESVIATFKVNVANAIKILIAAIPEIAAK--------------------
MTAP_CIOIN       CWK-EDHASVNVENVMKTMKVNRGNALKVLVSAVEIISKQ--------------------
MTAP_CAEBR       CWK-D-EDQVTAASVMKVFAANVEKAKTLFIEAVAEIGKI--------------------
MTAP_CAEEL       CWK-E-EDHVTASSVMKVFAANVEKAKTLFVEAVGEIGKI--------------------
PNPH_DROME       CWC-AKQPNATTHEIIYIFKKQSENLQKVLITAIRNMAAE--------------------
PNPH_DROPS       CWC-ANQPIATTHEIIYVFKNKVEKLQQVLSKAIANISKE--------------------
MTAP_HYPBU       VWA---ERPVTAEEVARVMKENTEKAKKILYKLIPRLPPEP-------------------
MTAP_SACS2       VFA---EIPVTAEEVTRVMAENTEKAKKLLYALIQKLPEKP-------------------
MTAP_AERPE       VWA---DRPVTAEEVERVMISNVERARRMLYDVIPKLAGEP-------------------
MTAP_THEPD       VWA---EKPVTAHEVARVMAENTEKVKRLLADLIPSIP----------------------
MTAP_PYRFU       VWA---EKPVDAQEVLRVMKENEEKVQKLLKRAIPKIP----------------------
MTAP_PYRHO       VWA---EKPVDAQEVLRVMKENEEKVQKLLKRAIPKIP----------------------
MTAP_PYRAB       VWA---EKPVNAQEVLRVMKENEEKVQKLLRKAIPKIP----------------------
MTAP_THEKO       VWA---DKPVDAQEVLKVMAENNYKVQELLKKGIPKIP----------------------
MTAP_THEAC       VWS---TKPVDAREVMNIMKQNDHKVRDILFNALPLIK----------------------
MTAP_PYRAE       IWV-P-HQPVTAEAVEKMMTEKLGIIKKVIAEAVPKLP----------------------
MTAP_CENSY       AWA---EKAVTAKEVLATLADNVERTKALLAKLIPTIP----------------------
MTAP_NITMS       VWA---EKPVTAKEVLETLSKNVEGTKKILTELIEKIP----------------------
MTAP_RHOS4       SWH-PHHGEVDITAIIATLGTNADHARGLVAGLPARLGTE-------------------R
MTAP_RHORT       CWH-PDHDHVSVEAVVRVLLQNADKARSLVKAMPAKLKDR-------------------P
MTAP_BRADU       CWH-PDHDAVTVQDIIRVLTSNADKAKALVARLAKDFPRE-------------------H
MTAP_CHLAA       VWH-PEHDAVTAEQVIKVLSANVNLSQQIVRHAVAQID---------------------E
MTAP_GEOSL       CWH-ESHDDVSVDAIIAIIKQNVAMAKSIIRNAVRRID---------------------R
MTAP_SYNY3       CWH-PDHDHVTVEMVIGNLQKNAVNAQQVILETVKQLA---------------------A
MTAP_THEEB       CWH-PEHDSVTVEMIMGNLQRNVKNAQAIICETVKRVH---------------------A
MTAP_GLOVI       CWH-PDHGAVTVELIIDNLHKNAENAQRIVRAVVERLH---------------------A
MTAP_KORVE       CWH-PDHDAVTVDQIVAVLLKNAENACSVVREAVAAMP---------------------K
MTAP_PROMA       CWH-EGFGNVSVDLVIENLAANAKLASKIVEATAKRIS---------------------K
MTAP_LEPIC       CWR-EGEESVTVEMVIANLTKNAETAKKLLSELIHVLG---------------------N
MTAP_LEPIN       CWR-EGEESVTVEMVIANLTKNAETAKKLLSELIHVLG---------------------N
MTAP_EMENI       CWH-ESTEDVTVEMVMGNMKANAVNAKHFVTAVLDELADDRNA--------------ELV
MTAP_ASPFU       CWH-ESTADVTVEMVMGHMKANAQNARRFVTAVLDALASDEHA--------------DLV
MTAP_AJECG       CWH-SEAADVTVDMVMANMKMNSVNARNFIGAVLDELTKDEHA--------------ALV
MTAP_PHANO       CWRGDGSEDVNVEMVMAHMKANAENARRFVGAVLNELTKEEHG--------------ELV
MTAP_NECH7       CWH--SFEDVNVEMVGKYMKANSKNAKRLVGAVLDRLADLDNS--------------DLV
MTAP_NEUCR       CWRDEAGEDVDVAMVMKYMAANGENAKHLVGAVLDELLKQDNS--------------DLV
MTAP_SCLS1       CWH--STADVDVEMVMGHMHANGQNAKRLVGAVLDALNMRWST--------------IDS
MTAP_TUBMM       CWK-TNEAAVTVETVMGNMHANGANAKHLAAAILKELAKEEHQ--------------DLV
MTAP_CANAL       SWN-ESEEPVTVETVVGNLKANSANACKLAAKLID--EFAAK---------------GGE
MTAP_CANAW       SWN-ESEEPVTVETVVGNLKANSANACKLAAKLID--EFAAK---------------GGE
MTAP_YARLI       AWK-EDEEPVTVEQVVSNLTANAESATGVVEALLEPLEKALA---------------DKS
MTAP_SCHPO       CWR-MNEEPVTVETVMEHISNNKDNAKIFLLEAVKKLEAPLL---------------QGF
MTAP_YEAST       AWR-DEAEPVTVETVIGNLTNNGRNANILASKIIVSMAKEIPE--------------FMH
MTAP_COPC7       SWR-PHSDAVTAHDVVQTLHDNGASAKLVLSTILDDLHTTINTHHRALTNGNSQDLEAIR
MTAP_CRYNJ       AWR-TGYDPVTVEEVVKVLHTNAGNSRAVAAGILQDVH------------------DVVV
MTAP1_PUCGT      AWR-ESEEPVTVAEVMATIAANVSVSNRLTLTILDEVH------------------NAVA
MTAP2_PUCGT      AWR-ESEEPVTVAEVMATIAANVSVSNRLTLTILDEVH------------------NAVA
MTAP_USTMA       AWR-PSTAAVNVAEVMESLKANVEASNLVTTKVLDRVWLEIDTDE---------------
                               :                                             

PNPH_DICTD       --------ERNCICKNALKEYREKGLL---------------------------------
PNPH_MOOTA       --------QRNCRCSLAAGKIEV-------------------------------------
PNPH_PYRFU       --------ERRCGCKDALKGATG-------------------------------------
PNPH_THEKO       --------ERRCPCKDALKGATGE------------------------------------
PNPH_KORCO       --------RRECPCKDALSEYLK-------------------------------------
MTIP_THEYD       --------ERKCLCKHALKNASF-------------------------------------
MTIP_METKA       --------KRSCPCSQALEGAEV-------------------------------------
MTIP_METTH       --------EQSCPCQHALRGADVNNHEEELYEGFNDICKPEKEEQHHDGP----------
MTIP_METAC       --------TRNCMCRFAKEGACL-------------------------------------
MTIP_METJA       --------ERKCICKDALKHAVIG------------------------------------
PNPH_ARCFU       --------EKIQRT----------------------------------------------
PNPH_AQUAE       --------IRSCDCEKSLEGAEV-------------------------------------
MTIP_PSEAE       ------------------------------------------------------------
MTIP_PSESM       ------------------------------------------------------------
MTIP_XYLFA       ------------------------------------------------------------
MTIP_XYLFT       ------------------------------------------------------------
MTIP_XANCP       ------------------------------------------------------------
MTAP_MYCS2       --------ERTCTHCLTHSGVQLPFELP--------------------------------
MTAP_MYCTU       --------ERTCTHCQHHAGVPLPFELP--------------------------------
PNPH_STRCO       -------GERDCPCGAALGGMDPGIALP--------------------------------
MTAP_HUMAN       -------EWSETLHNLKNMAQFSVLLPRH-------------------------------
MTAP_MACMU       -------EWSETLHNLKNMAQFSVLLPRH-------------------------------
MTAP_BOVIN       -------EWSETLHNMKKMAQFSVLLPRH-------------------------------
MTAP_MOUSE       -------EWSETLRNLKNMAQFSVLPPRH-------------------------------
MTAP_DANRE       -------DWDSTINAHKSMSQSSVMLPKH-------------------------------
MTAP_XENTR       -------DWTELLQSMKSTVQLSVMLPKH-------------------------------
MTAP_ANODA       -------DWTETIEELAKTVNTSIMLPHSN------------------------------
MTAP_ANOGA       -------DWSDTIEELGKTVNTSIMLPHSN------------------------------
MTAP_AEDAE       -------DWTETIGELTKTVNGSIMLPHAY------------------------------
MTAP_DROME       -------DWSEDILNAKQCVCNNTMSGAM-------------------------------
MTAP_DROPS       -------DWSEDILNAKQCVCNNTMSGAM-------------------------------
MTAP_NEMVE       -------DWTEIINERKSQVKPPILDSTWVMFIREYRKIGSDDASKLM------------
MTAP_CIOIN       -------NLQPDIQLAEKNAKNSVML----------------------------------
MTAP_CAEBR       -------DWSAEILQTKTAARQSIMISPDVEVEFLKVPKT--------------------
MTAP_CAEEL       -------DWSAEILKLKTEARESVMISPDVVIPFLTTDNQKKF-----------------
PNPH_DROME       -------DWAEDILKAKILVCSNFANSK--------------------------------
PNPH_DROPS       -------DWSEDILKAKILVCSNFANRNK-------------------------------
MTAP_HYPBU       -------DKARCSCCSSLETALL-------------------------------------
MTAP_SACS2       -------EEGSCSCCNSLKTALV-------------------------------------
MTAP_AERPE       -------ELERCSCCRALDTAAI-------------------------------------
MTAP_THEPD       -------EERKCQCARALDEALI-------------------------------------
MTAP_PYRFU       -------EERKCGCADVLKTMFV-------------------------------------
MTAP_PYRHO       -------EERKCGCADVLKTMFV-------------------------------------
MTAP_PYRAB       -------EERKCGCADVLKTMFV-------------------------------------
MTAP_THEKO       -------EERHCGCADVLKTMFV-------------------------------------
MTAP_THEAC       -------KERKCSCSLRLDNAKM-------------------------------------
MTAP_PYRAE       --------AELPKCSETLKYACV-------------------------------------
MTAP_CENSY       -------RDRKCTCADALAEAEF-------------------------------------
MTAP_NITMS       -------KDRSCSCAKALEEAEF-------------------------------------
MTAP_RHOS4       DLC---PHGCDRALDHALMTAPAKRDPELLAKLDAVAGRVLKG-----------------
MTAP_RHORT       YPL---PDGSHRSLDNAIITHPDRRNPGMARKLSAVAGRVLG------------------
MTAP_BRADU       EPC---PIGSDRALDTALITAPEARDPELLKKLDAVAGRVLRG-----------------
MTAP_CHLAA       NF----TSPAHDALRYAIVTHPDHIPAAVKERLAPIAGRYWS------------------
MTAP_GEOSL       ER----NCPCASALRYAIITDKAAIPAETKERLDLIIGSYV-------------------
MTAP_SYNY3       NPF---ESIAHRALQYAVLTPPDKFPAATYEKLSLLLGKYYPPAP---------------
MTAP_THEEB       HPP---VSKAHRALKNAILTPLDQVPAATKEKLHLLLAKYL-------------------
MTAP_GLOVI       AAP---PCASHSALKYALLTQPEDVPQATKQKLAAILAKYPAYRPEV-------------
MTAP_KORVE       DR----TCKCGSALATAIITNKDVVPAATKEKLKLIIGKYFGEQKAGA------------
MTAP_PROMA       LLP---PSEAHTALKNSLMTSKDKVSETTREKINLFTENYWGKFNK--------------
MTAP_LEPIC       GDD--LSLKNSTRY--SIITAPEKRNPETVKKLRVLFPEYF-------------------
MTAP_LEPIN       GDD--LSLKNSTRY--SIITAPEKRNSETVKKLRVLFPEYF-------------------
MTAP_EMENI       QAK---QYAGSVKF--GLSTAQANWSPEARERMNWLFPGYFEIDLYIRYLLLIQRDIDLT
MTAP_ASPFU       QAK---HVEGSIKF--GLSTAQANWSPEARAKLEWLFPGYWN------------------
MTAP_AJECG       QAK---HLEGTCKF--GLSTSPGYLSAEALTKLSWLFPGYFSNN----------------
MTAP_PHANO       LAK---HIEGQMRFA-GAMTKKEGRGQDAEKKLQWLFPGYFD------------------
MTAP_NECH7       LAK---HWQGASQGAVKFMTKPEGRDPEAMKRVEYLFPGFWEE-----------------
MTAP_NEUCR       LAK---KWQGSAQGAVKFMTKPEGRDPEAMKRVEFLFPGFWEQN----------------
MTAP_SCLS1       IRR---RKNKPELANAQQHQIWRGRTYHFAWSISACY--FSSE-----------------
MTAP_TUBMM       GAK---HLEGLSKW--ACCTAPAGRKAEVVKKIEFMLPGYFS------------------
MTAP_CANAL       IGK---DLQGSMKY--AVSTSPHGVKKELLEKMHFLFPGYWEV-----------------
MTAP_CANAW       IGK---DLQGSMKY--AVSTSPHGVKKELLEKMHFLFPGYWEV-----------------
MTAP_YARLI       IGY---DLDGSMKF--AVSTAPAARDATVAKNLDFLHPGYW-------------------
MTAP_SCHPO       LGR---NLRESVQN--GIQTNHKHRNPDAIRRLQFLFPNLTIPH----------------
MTAP_YEAST       TGD---GLRGSIKK--SISTKPEAMSKETLERLRYLFPNYW-------------------
MTAP_COPC7       EEEALLQERGSMKF--SIMPASPQQKAEDRKKLAFILPEHFKDAA---------------
MTAP_CRYNJ       EGKTLTDIKGSMKF--ACVTRKDIQPEASRKKLSYILP-YFSD-----------------
MTAP1_PUCGT      KGQ-LKTCKGTMEY--SVMTKKEMISEESKKTLSFILPYFS-------------------
MTAP2_PUCGT      KGQ-LKTCKGTMEY--SVMTKKEMISEESKKTLSFILPYFS-------------------
MTAP_USTMA       ---KPAVKNIKDSTKFSIMTKSQVIPDKAKQNLRFLHPWFARD-----------------
                                                                             

PNPH_DICTD       ---
PNPH_MOOTA       ---
PNPH_PYRFU       ---
PNPH_THEKO       ---
PNPH_KORCO       ---
MTIP_THEYD       ---
MTIP_METKA       ---
MTIP_METTH       ---
MTIP_METAC       ---
MTIP_METJA       ---
PNPH_ARCFU       ---
PNPH_AQUAE       ---
MTIP_PSEAE       ---
MTIP_PSESM       ---
MTIP_XYLFA       ---
MTIP_XYLFT       ---
MTIP_XANCP       ---
MTAP_MYCS2       ---
MTAP_MYCTU       ---
PNPH_STRCO       ---
MTAP_HUMAN       ---
MTAP_MACMU       ---
MTAP_BOVIN       ---
MTAP_MOUSE       ---
MTAP_DANRE       ---
MTAP_XENTR       ---
MTAP_ANODA       ---
MTAP_ANOGA       ---
MTAP_AEDAE       ---
MTAP_DROME       ---
MTAP_DROPS       ---
MTAP_NEMVE       ---
MTAP_CIOIN       ---
MTAP_CAEBR       ---
MTAP_CAEEL       ---
PNPH_DROME       ---
PNPH_DROPS       ---
MTAP_HYPBU       ---
MTAP_SACS2       ---
MTAP_AERPE       ---
MTAP_THEPD       ---
MTAP_PYRFU       ---
MTAP_PYRHO       ---
MTAP_PYRAB       ---
MTAP_THEKO       ---
MTAP_THEAC       ---
MTAP_PYRAE       ---
MTAP_CENSY       ---
MTAP_NITMS       ---
MTAP_RHOS4       ---
MTAP_RHORT       ---
MTAP_BRADU       ---
MTAP_CHLAA       ---
MTAP_GEOSL       ---
MTAP_SYNY3       ---
MTAP_THEEB       ---
MTAP_GLOVI       ---
MTAP_KORVE       ---
MTAP_PROMA       ---
MTAP_LEPIC       ---
MTAP_LEPIN       ---
MTAP_EMENI       SWN
MTAP_ASPFU       ---
MTAP_AJECG       ---
MTAP_PHANO       ---
MTAP_NECH7       ---
MTAP_NEUCR       ---
MTAP_SCLS1       ---
MTAP_TUBMM       ---
MTAP_CANAL       ---
MTAP_CANAW       ---
MTAP_YARLI       ---
MTAP_SCHPO       ---
MTAP_YEAST       ---
MTAP_COPC7       ---
MTAP_CRYNJ       ---
MTAP1_PUCGT      ---
MTAP2_PUCGT      ---
MTAP_USTMA       ---