CLUSTAL format seed alignment for MF_01964

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A8X1T4_CAEBR          --------------------MVRPEEFNSLELDN--------------------------
IMDH_CAEEL            --------------------MVRPEDFNSLELDN--------------------------
IMDH_LEIDO            -----------------------MATNNANYRIK--------------------------
A4HYI5_LEIIN          -----------------------MATNNANYRIK--------------------------
Q4QD53_LEIMA          -----------------------MATNNANYRIK--------------------------
A4HAA5_LEIBR          -----------------------MAANNANYRIK--------------------------
K2NRC9_TRYCR          -------------------------MVNVDLRTK--------------------------
IMDH1_MOUSE           --------------------------MADYLISGGT------------------------
IMDH1_RAT             --------------------------MADYLISGGT------------------------
IMDH1_BOVIN           --------------------------MADYLISGGT------------------------
IMDH1_HUMAN           --------------------------MADYLISGGT------------------------
IMDH3_DANRE           --------------------------MADYLISGGT------------------------
IMDH1_DANRE           --------------------------MADYLISGGT------------------------
IMDH1_XENTR           --------------------------MADYLISGGT------------------------
IMDH2_HUMAN           --------------------------MADYLISGGT------------------------
IMDH2_MOUSE           --------------------------MADYLISGGT------------------------
IMDH2_RAT             --------------------------MADYLISGGT------------------------
IMDH2_BOVIN           --------------------------MADYLISGGT------------------------
Q5F4A4_CHICK          --------------------------MADYLISGGT------------------------
IMDH2_XENTR           --------------------------MADYLISGGT------------------------
IMDH2_DANRE           --------------------------MADYLISGQT------------------------
A7RG06_NEMVE          -------------------------MMADFLIAGGT------------------------
A7REY1_NEMVE          ----------------MASSPSKSAPKADYLISGPT------------------------
A9VB34_MONBE          ---------MEFKTVPHDGRASEASLKGSQLITGHM------------------------
Q16WB3_AEDAE          -----------------------------MAMAN--------------------------
W5JN05_ANODA          --------------------------MENGAHGK--------------------------
IMDH_DROME            ----------------------------MESTTKVKVNGFVESTSSSAAPAIQTKSTTGF
Q29IQ0_DROPS          --------------------------MDKSSNNKPKLNGFVDGESS-------------A
E0VEZ4_PEDHC          -------------------MCVFKFCEVNLLHSQ--------------------------
E0VCU3_PEDHC          --------------------------MTEISYCG--------------------------
C0NBC7_AJECG          -MPISNGDASGSAYERFSGNSAFLDHTKALEVLKN-------------------------
IMDH_ASPFU            -MPIANGDSLGCAMK-----ADIQDYTKALEILEK-------------------------
Q0V6E3_PHANO          -MPISNGDAMTNTAV------NALDYTTALEVLKN-------------------------
I1RBE4_GIBZE          ------------------MSASVLDYTKALEVLK--------------------------
C7YID4_NECH7          ------------------MSASVLDYRSALEVLG--------------------------
IMDH_NEUCR            --------------MAVNGNNTFLDHTSAMEVLK--------------------------
A7F2A7_SCLS1          MSPQANGESKPTASDFLAPTKDILDATKALEILK--------------------------
D5GG57_TUBMM          -------------MSSTAANIGTLDFSTALSVLEK-------------------------
IMDH_CANAL            ---------------------MVFETSKATSYLK--------------------------
IMDH_CANAX            ---------------------MVFETSKATSYLK--------------------------
C4YIV3_CANAW          ---------------------MVFETSKATSYLK--------------------------
IMDH3_YEAST           -------------------MAAVRDYKTALEFAK--------------------------
IMDH2_YEAST           -------------------MAAIRDYKTALDFTK--------------------------
IMDH4_YEAST           ------------------MSAAPLDYKKALEHLK--------------------------
Q6C897_YARLI          ------------------MTQTFKDPKDAQAFLS--------------------------
A8NJG1_COPC7          ------------MPADGNQQTQFLDPKTALEHLA--------------------------
IMDH_CRYNJ            --------MADTNPNAPPRSDSLLNPADALKYLE--------------------------
IMDH_PNECA            ----------------MGEDSYLCLSEEIKKKLE--------------------------
IMDH_SCHPO            -------------------MSAFKPYTEALEVLK--------------------------
IMDH_LEPIN            --------------------------MSNQTYRD--------------------------
IMDH_DICDI            -----------------MEKINKILQGTNSEYK---------------------------
D0N723_PHYIT          --------------------------MTSTATV---------------------------
B8BZC2_THAPS          -----------MSPSKKQKTDNGALWELDEETM---------------------------
IMDH1_ARATH           ------------------------------------------------------------
IMDH2_ARATH           ------------------------------------------------------------
IMDH_VIGUN            -----------------------------MDFT---------------------------
C5WZ26_SORBI          ----------------------------MAASR---------------------------
C5X9F2_SORBI          ------------------------------------------------------------
A9RU40_PHYPA          ------------------MASVGNGDFTFAGAG---------------------------
A9TN21_PHYPA          ------------------MGS--NGDYSF-------------------------------
Q4UCL4_THEAN          ------------------------------------------------------------
Q4N0C9_THEPA          ------------------------------------------------------------
A7AR77_BABBO          ------------------------------------------------------------
A0A113RHB4_PLABE      ------------------------------------------------------------
Q7RIL8_PLAYO          ------------------------------------------------------------
A0A384L7F5_PLAKH      ------------------------------------------------------------
A5K6S2_PLAVS          ------------------------------------------------------------
Q8I2U5_PLAF7          ------------------------------------------------------------
IMDH_HALSA            ------------------------------------------------------------
Q2FS86_METHJ          ------------------------------------------------------------
IMDH_METJA            ------------------------------------------------------------
O26245_METTH          ------------------------------------------------------------
IMDH_PYRFU            ------------------------------------------------------------
IMDH_PYRHO            ------------------------------------------------------------
Q5JFM0_THEKO          ------------------------------------------------------------
Q8TV01_METKA          ------------------------------------------------------------
IMDH_THEAC            ------------------------------------------------------------
A0QSU3_MYCS2          ------------------------------------------MSIAESSVPIAV------
IMDH_MYCTU            --------------------------------------MSRGMSGLEDSSDLVVSPYVRM
Q8NSR5_CORGL          ------------------------------------------MTTQSR------------
Q9L0I7_STRCO          ------------------------------------------------------------
IMDH_BIFLO            -----------------------------MRCRTRQRISERSQACVVKVSACSYSVCMAT
Q7VVM3_BORPE          ------------------------------------------------------------
Q63T40_BURPS          ------------------------------------------------------------
Q5F8H4_NEIG1          ------------------------------------------------------------
Q9JZB5_NEIMB          ------------------------------------------------------------
Q9HXM5_PSEAE          ------------------------------------------------------------
Q83BZ5_COXBU          ------------------------------------------------------------
Q8P8Q5_XANCP          ------------------------------------------------------------
Q5NFC2_FRATT          ------------------------------------------------------------
IMDH_ECOLI            ------------------------------------------------------------
Q32D54_SHIDS          ------------------------------------------------------------
Q8ZN59_SALTY          ------------------------------------------------------------
IMDH_YERPE            ------------------------------------------------------------
IMDH_HAEIN            ------------------------------------------------------------
Q9KTW3_VIBCH          ------------------------------------------------------------
Q5E764_ALIF1          ------------------------------------------------------------
Q8EC51_SHEON          ------------------------------------------------------------
Q89N70_BRADU          ------------------------------------------------------------
Q9A7V2_CAUVC          ------------------------------------------------------------
Q2RXU6_RHORT          ------------------------------------------------------------
Q3J2F5_RHOS4          ------------------------------------------------------------
IMDH_CHLTE            ------------------------------------------------------------
A0A4Y7QN78_9BACI      ------------------------------------------------------------
Q81JC8_BACCR          ------------------------------------------------------------
IMDH_BACSU            ------------------------------------------------------------
Q926Y9_LISMO          ------------------------------------------------------------
IMDH_STAA8            ------------------------------------------------------------
Q8DMX2_STRR6          ------------------------------------------------------------
IMDH_STRPY            ------------------------------------------------------------
Q9CIY6_LACLA          ------------------------------------------------------------
Q82YY8_ENTFA          ------------------------------------------------------------
Q97FM8_CLOAB          ------------------------------------------------------------
A5I721_CLOBH          ------------------------------------------------------------
Q8RE86_FUSNN          ------------------------------------------------------------
Q2RJG7_MOOTA          ------------------------------------------------------------
D1B5E0_THEAS          ------------------------------------------------------------
Q8A126_BACTN          ------------------------------------------------------------
A6H0L3_FLAPJ          ------------------------------------------------------------
Q2S2G2_SALRD          -----------------------------------------------------------M
Q72D85_DESVH          ------------------------------------------------------------
Q1IS88_KORVE          ------------------------------------------------------------
Q74B47_GEOSL          ------------------------------------------------------------
Q9RT87_DEIRA          --------------------------------------------------------MSVP
Q5SL61_THET8          ------------------------------------------------------------
A9WEU7_CHLAA          ------------------------------------------------------------
IMDH_AQUAE            ------------------------------------------------------------
Q9X168_THEMA          ------------------------------------------------------------
B8DZU8_DICTD          ------------------------------------------------------------
B5YHZ0_THEYD          ------------------------------------------------------------
Q0P9J4_CAMJE          ------------------------------------------------------------
IMDH_HELPY            ------------------------------------------------------------
IMDH_RHOBA            ---------------------------MGASTRFRRQSGKVPYNSTAASVIIARFPHRIT
IMDH_TRIFO            ------------------------------------------------------------
                                                                                  

A8X1T4_CAEBR          --SLTDGETVHEMMAHK-A--GLTYNDFNILPGFIN---------FGVHDVCLETNITKD
IMDH_CAEEL            --SLTDGETVHEMMAHK-A--GLTYNDFNILPGFIN---------FGVHDVSLETNITKD
IMDH_LEIDO            --TIKDGCTAEELFRGD----GLTYNDFIILPGFID---------FGAADVNISGQFTKR
A4HYI5_LEIIN          --TIKDGCTAEELFRGD----GLTYNDFIILPGFID---------FGAADVNISGQFTKR
Q4QD53_LEIMA          --TIKDGCTAEELFRGD----GLTYNDFIILPGFID---------FGAADVNISGQFTKR
A4HAA5_LEIBR          --VIKDGCTAEELFQGD----GLTYNDFIILPGFID---------FGAADVNISGQFTKQ
K2NRC9_TRYCR          --TIRDGVTAEELFQSD----GLTYSDFIILPGFID---------FGASDVRVSGQFTKK
IMDH1_MOUSE           GYVPEDGLTAQQLFANA---DGLTYNDFLILPGFID---------FIADEVDLTSALTRK
IMDH1_RAT             GYVPEDGLTAQQLFANA---DGLTYNDFLILPGFID---------FIADEVDLTSALTRK
IMDH1_BOVIN           GYVPEDGLTAQQLFANA---DGLTYNDFLILPGFID---------FTADEVDLTSALTRK
IMDH1_HUMAN           GYVPEDGLTAQQLFASA---DGLTYNDFLILPGFID---------FIADEVDLTSALTRK
IMDH3_DANRE           GYIPDDGLSAQQLFAVG---DGLTYNDFLILPGFID---------FTSDEVDLTSALTKK
IMDH1_DANRE           GYVPEDGLTAQQLFAIG---DGLTYNDFLILPGFID---------FISDEVDLTSALTRK
IMDH1_XENTR           GYVPEDGLTAQHLFANS---DGLTYNDFLILPGFID---------FTADEVDLTSALTRK
IMDH2_HUMAN           SYVPDDGLTAQQLFNCG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKK
IMDH2_MOUSE           SYVPDDGLTAQQLFNCG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKK
IMDH2_RAT             SYVPDDGLTAQQLFNCG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKK
IMDH2_BOVIN           SYVPDDGLTAQQLFNCG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKK
Q5F4A4_CHICK          GYVPDDGLTAQQLFSCG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKR
IMDH2_XENTR           SYVPDDGLTAQQLFGAG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKK
IMDH2_DANRE           GYVPDDGLTGQQLFNSG---DGLTYNDFLILPGYID---------FTADQVDLTSALTKQ
A7RG06_NEMVE          SYVPEDGMTAGQLFQS----DGLTYSDFIILPGFID---------FPATDVDLTSPLTRR
A7REY1_NEMVE          SYVPEDGLTANALFGGG---QGLTYDDFLILPGFID---------FSADVVELNSALTRE
A9VB34_MONBE          GYVPEDGKSAAQMLSD----GGLTYDDFLILPGFID---------FVPDDVSLRSPLTRN
Q16WB3_AEDAE          GDNLQDGLSCEDLFRNS---DGLTYNDFIILPGYID---------FTADDVDLSSPLTKK
W5JN05_ANODA          EGSLLDGLSCEELFQKS---DGLTYNDFIILPGFID---------FTPDEVDLASPLTKK
IMDH_DROME            DAELQDGLSCKELFQNG---EGLTYNDFLILPGYID---------FTAEEVDLSSPLTKS
Q29IQ0_DROPS          EDQLQDGLSCRELFQNG---DGLTYNDFLILPGYID---------FTAEDVDLGSPLTKK
E0VEZ4_PEDHC          NSVLVDGVSVSEFIKNG---EGFTYNDFIILPGYID---------FSAKDVDLTSPFTKN
E0VCU3_PEDHC          NTTPKDGVSVPQFFSQG---DGVTYNDFIILPGYID---------FAAKEVDLTSPLTKK
C0NBC7_AJECG          DYA-GDGLDINQLIDSE-KRGALTYNDFLILPGYIG---------FPASDVSLETPVTRR
IMDH_ASPFU            EYTTRDGLDVDTLLDSD-KHGALTYNDFLILPGYIG---------FPASDVTLDTPVTKR
Q0V6E3_PHANO          EYQERDGIDVKTLIDSK-KNGGLTYNDFLMLPGYIGAAPNIHTIGFPAIDVNLDTPITKR
I1RBE4_GIBZE          EYKQRDGLDIHELMDTT-KHGGLTYNDFLLLPGYIG---------FAASEVTLDSPITKR
C7YID4_NECH7          EYKQKDGLDLHELMDTT-KHGGLTYNDFLLLPGYIG---------FAASAVTLDAPITKR
IMDH_NEUCR            EYERRDGLDIRDLMDSK-LQGGLTYNDFLLLPGYIG---------FPASAVTLDSPITKR
A7F2A7_SCLS1          EYESRDGLSINDLIDSK-KHGGLTYNDFLVLPGYIG---------FAASEVVLDSPVTKR
D5GG57_TUBMM          EYR-RDGLDVHSLLDSS-KRGGLTYNDFLILPGYIG---------FPASDVTLDSKITKR
IMDH_CANAL            DYPKKDGLSVKELIDST-NFGGLTYNDFLILPGLIN---------FPSSAVSLETKLTKK
IMDH_CANAX            DYPKKDGLSVKELIDST-NFGGLTYNDFLILPGLIN---------FPSSAVSLETKLTKK
C4YIV3_CANAW          DYPKKDGLSVKELIDST-NFGGLTYNDFLILPGLIN---------FPSSAVSLETKLTKK
IMDH3_YEAST           SLPRLDGLSVQELMDSK-TRGGLTYNDFLVLPGLVD---------FPSSEVSLQTKLTRN
IMDH2_YEAST           SLPRPDGLSVQELMDSK-IRGGLTYNDFLILPGLVD---------FASSEVSLQTKLTRN
IMDH4_YEAST           TYSSKDGLSVQELMDST-TRGGLTYNDFLVLPGLVN---------FPSSAVSLQTKLTKK
Q6C897_YARLI          TYKQKDGLDVHSLMDSS-VRGGLTYNDFLMLPGKID---------FPSHEVSLETKLTKK
A8NJG1_COPC7          TYNDRDGLSVSDLMNST-VHGGLTYNDFLLLPGKID---------FPASDVVTESKITRN
IMDH_CRYNJ            EYPRGDGLSLQELMDSR-KNGGLTYNDFLVLPGHIS---------FPASDVSLQSRATKN
IMDH_PNECA            EYSEKDGYDLDSLICSR-RHGGLTYNDIIILPGYID---------FEVNSVSLESHITKK
IMDH_SCHPO            KYEKKDGLSIDDLIRHN-FQGGLTFNDFLILPGYID---------FVPNNVSLETRISRN
IMDH_LEPIN            -SEYLDGLSGEELFNLQ-I--GLTYRDFLVLPGFID---------FHPSEVELETRLTRN
IMDH_DICDI            SEWFVDGFDCFELFQ---QRHGYTYDDLIMLPGHIN---------FSADDVSLKTKLTKN
D0N723_PHYIT          DPELLDGRSAIDIFVNKNQGQGYTYDDLILMPGHIN---------FSVDAVHLDTKVSRN
B8BZC2_THAPS          NSGAV-GFTASQIFMKNPACVAYTYDDVIMMPGHIN---------FGLNEVDISTKLTKK
IMDH1_ARATH           MSTLEDGFPADKLFA---QGYSYTYDDVIFLPHFID---------FSTDAVSLSTRLSRR
IMDH2_ARATH           MSGFEDGFSAEKLFS---QGYSYTYDDVIFLPHFID---------FSTDAVSLSTRLSKR
IMDH_VIGUN            PPPIEDGFTAEKLFS---QGFSYTYDDVIFLPHYID---------FAADAVDLSTRLTRR
C5WZ26_SORBI          ADLADDGFAAPRLFS---QGVSYTYDDVIFLPGYIG---------FPADAVDLSTRLSRR
C5X9F2_SORBI          --MADDSFSAARLFS---QGVSYTYDDVIVLPGYID---------FPADAVDLSTRLSRR
A9RU40_PHYPA          CGVLSDGFSAAALFK---QGFSYTYDDLIFHPGYID---------FAVDDVELGTSLTRN
A9TN21_PHYPA          ---VSDGFSAGSLFK---QGFSYTYDDLIFHPGYIN---------FAVDDVDLSTSLTRN
Q4UCL4_THEAN          ---MADGYSAAEFFNF--TKLSLSYEDLIILPGYIR---------DSVDKVDLSSNVTRN
Q4N0C9_THEPA          ---MTDGYSAAEFFNF--TKFSLSYEDLILLPGYIS---------DSVDKVDLTTHVSRN
A7AR77_BABBO          ---MADGSTAAEIFEK--SAVGYTYDDLILLPGYIS---------GSCNDVDVSSRLTRT
A0A113RHB4_PLABE      ---MANGWDAEKIFG---STISYTYDDIICMPGYID---------FPLSEIDLSNNMTKD
Q7RIL8_PLAYO          ---MANGWDAEKIFG---STISYTYDDIICMPGYID---------FPLSEIDLSNNLTKD
A0A384L7F5_PLAKH      ---MANGWPAEKVFG---DVMSYTYDDIICLPGYIN---------FPMSEIDLSNNLTPN
A5K6S2_PLAVS          ---MANGWPADKIFG---DVMSYTYDDIICLPGYIN---------FPMSEIDLCNNLTPE
Q8I2U5_PLAF7          ---MASGWKADEVFG---GVMSYTYDDIICMPGYID---------FALSDIDLTNNMTDN
IMDH_HALSA            -MANDSSTDGRFSEKL-RVPEALTFDDVLLRPAESR---------VEPDDADVATRVSTN
Q2FS86_METHJ          ----------MYIEKL-QAETGLTFDDILLVPAASE---------VEPDQADVTTRFSRN
IMDH_METJA            ----------MFLKKLIEAKKAYTFDDVLLVPNASW---------VEPKDTDVSTDLA-G
O26245_METTH          ----------MYRKKLTEAETGYTFDDFLLLPQASY---------VEPRDVETAGRVSRN
IMDH_PYRFU            --------MGKFVEKLENAIRGYTFDDVLLIPQPTE---------VEPKDVDVSTQITPN
IMDH_PYRHO            --------MGKFVEKLEKAIKGYTFDDVLLIPQATE---------VEPKDVDVSTRITPN
Q5JFM0_THEKO          --------MGKFEQKLVNALKGYTFDDVLLIPQATE---------VEPKDVDVSTQITPN
Q8TV01_METKA          -------MVGRYTRKLEDAELALTFDDVLLLPERSS---------VEPADVDVSTRVTVN
IMDH_THEAC            ----------MYREKFTKITEGFTFDDVLLIPMRTA---------VEPKNVVVSSRISRH
A0QSU3_MYCS2          ------PVPTGGDDPTKVAMLGLTFDDVLLLPAASD---------VVPATADTSSQLTKR
IMDH_MYCTU            GGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASD---------VVPATADTSSQLTKK
Q8NSR5_CORGL          -------VSTGGDNPNKVALVGLTFDDVLLLPDASD---------VVPSEVDTSTQLTRN
Q9L0I7_STRCO          ------MTANVDGVPEKFATLGLTYDDVLLLPGASA---------VLPNAVDTSSRISRN
IMDH_BIFLO            NLDELNAQSAYAPLPPIFAKLGLAYDDVLLLPNETD---------VIPSEVDTSTHLTRK
Q7VVM3_BORPE          ---------------MRLVQKALTFDDVLLVPAYSE---------VLPRDTSLTTRLTRN
Q63T40_BURPS          ---------------MRLIQKALTFDDVLLVPAFSD---------VLPRDTSLKTQLTRN
Q5F8H4_NEIG1          ---------------MRIVEKAYTFDDVLLVPAHST---------VLPRDVKLQTKLTRE
Q9JZB5_NEIMB          ---------------MRIVEKAYTFDDVLLVPAHST---------VLPRDVKLQTKLTRE
Q9HXM5_PSEAE          --------------MLRISQEALTFDDVLLIPGYSE---------VLPKDVSLKTRLTRG
Q83BZ5_COXBU          ---------------MRVKEEALTFDDVLLLPNYSE---------VLPKDVSLTTRLTRE
Q8P8Q5_XANCP          --------------MLRIQAEALTYDDVSLVPAHSI---------VLPKDVSLETRLTRD
Q5NFC2_FRATT          --------------MLRITQQAITFDDVLLSPRYSN---------VLPHQVDLKTNITRD
IMDH_ECOLI            --------------MLRIAKEALTFDDVLLVPAHST---------VLPNTADLSTQLTKT
Q32D54_SHIDS          --------------MLRIAKEALTFDDVLLVPAHST---------VLPNTADLSTQLTKT
Q8ZN59_SALTY          --------------MLRIAKEALTFDDVLLVPAHST---------VLPNTADLSTQLTKT
IMDH_YERPE            --------------MLRIAKEALTFDDVLLVPAHST---------VLPNTAELGTQLTAT
IMDH_HAEIN            -------------MSLRIKQEALTFDDVLLVPAHST---------VLPNTANLSTQLTKE
Q9KTW3_VIBCH          ------------MHMLRIAKEALTFDDVLLVPAHST---------VLPNTADLRTRLTKN
Q5E764_ALIF1          --------------MLRIAKEALTFDDVLLVPAHST---------VLPNTADLRTQLTKN
Q8EC51_SHEON          --------------MLRLIKEALTFDDVLLVPAHST---------VLPNTAILKTRLTNT
Q89N70_BRADU          ----------MATVQVQGIREALTFDDVLLKPGLSD---------VMPGEVDIRSRVTRA
Q9A7V2_CAUVC          ----------------MEIREGLTFDDVLLEPAASD---------VMPTQVTTETRFTRE
Q2RXU6_RHORT          ----------------MEFPEALTFDDVLLVPAASS---------VLPAQADTRTRLTRT
Q3J2F5_RHOS4          ----------------MEIREALTFDDVLLVPAASS---------VLPSDADTSTFVTKA
IMDH_CHLTE            --------------MDKILYDALTFDDVLLVPAYSN---------VLPKETVVKSRLTRQ
A0A4Y7QN78_9BACI      -----------MWESKFVK-EGLTFDDVLLVPAKSD---------VLPREVSVKTVLSES
Q81JC8_BACCR          -----------MWESKFVK-EGLTFDDVLLVPARSD---------ILPREVSVKTVLSES
IMDH_BACSU            -----------MWESKFSK-EGLTFDDVLLVPAKSE---------VLPRDVDLSVELTKT
Q926Y9_LISMO          -----------MWETKFAK-EGLTFDDVLLVPAKSD---------VLPNDVDLSVEMAPS
IMDH_STAA8            -----------MWESKFAK-ESLTFDDVLLIPAQSD---------ILPKDVDLSVQLSDK
Q8DMX2_STRR6          ---------MSNWDTKFLK-KGFTFDDVLLIPAESH---------VLPNDADLTTKLADN
IMDH_STRPY            ---------MSNWDTKFLK-KGYTFDDVLLIPAESH---------VLPNEVDLKTKLADN
Q9CIY6_LACLA          ---------MSNWETKFLK-KGFTFDDVLLIPAESH---------VLPNEVSMKTKLAKN
Q82YY8_ENTFA          ---------MSNWETKFAK-KGLTFDDVLLIPAESH---------VLPNDVDMSVQLAKN
Q97FM8_CLOAB          -------------MAKILK-QAYTFDDVLLVPNKSE---------VLPKEVDLSTNLTKK
A5I721_CLOBH          -------------MAKIIK-QAYTFDDVLLVPNKSE---------VLPKEVNLGTNLTKK
Q8RE86_FUSNN          ------------MNGKIVK-EGITFDDVLLIPAKSD---------VLPNEVSLKTRLTKK
Q2RJG7_MOOTA          -----------MTTDKIIG-EGLTFDDVLLVPGESE---------VLPREVDISSNFTRH
D1B5E0_THEAS          ----------MSFEDRFVGYEGFTFDDVLLEPAYSE---------VLPYQVDLRSQLTPK
Q8A126_BACTN          ---------MSFIADKIVM-DGLTYDDVLLIPAYSE---------VLPRTVDLSTKFSRN
A6H0L3_FLAPJ          ---------MKAHNSKIIG-EGLTYDDVLLIPSYSE---------VLPREVSIKTHFSRN
Q2S2G2_SALRD          SQPVTNGTPDTAANDKIKT-EGLTYDDVLLVPGHSE---------VMPRETDTSAWLTQN
Q72D85_DESVH          --------------MSKIVCKALTFDDVLLQPGYSE---------VTPDQVDVATWLTPS
Q1IS88_KORVE          -------------MIHFPVPEALTFDDVLLLPAKSD---------VIPTATSTATKLTRN
Q74B47_GEOSL          -------------MLDELIPEGLTFDDVLLVPAHSQ---------VLPRDVSLNTRLTRN
Q9RT87_DEIRA          AAPQTPSQSQEDRYRYKFAQEGITFDDVLLQPRHSQ---------VLPHEVDVSAQLTRR
Q5SL61_THET8          --------MDEG----KILYEGLTFDDVLLLPDYSE---------VLPKEVSVRTRLTKR
A9WEU7_CHLAA          -----MGIAWEE----KFTREGLTFDDVLLIPAESD---------VLPATVDVSTWLTRN
IMDH_AQUAE            -----------MVEVEKKIKEGLTFDDVLLVPQYSE---------VLPHEVDVSTYLTKR
Q9X168_THEMA          ------------------MKEALTFDDVLLVPQYSE---------VLPKDVKIDTRLTRQ
B8DZU8_DICTD          -----------MNFDERFLGEALTFDDILLVPAYSE---------VTPREVSVDTYLTDR
B5YHZ0_THEYD          -------------MKENEIPLGLTFDDVLLVPSKSD---------IIPAEVDVTTYFTPN
Q0P9J4_CAMJE          ---------------MKIVKRALTFEDVLLRPGYSE---------VLPKEVKIHTKLTKN
IMDH_HELPY            ---------------MRILQRALTFEDVLMVPRKSS---------VLPKDVSLKSRLTKN
IMDH_RHOBA            FGCPRPRGNENGMFDDKIGDLGVTFDDVLLQPRYSE---------VVPSEVDVSSQMTQR
IMDH_TRIFO            -------------MAKYYNEPCHTFNEYLLIPGLSTVDCIPSNVNLSTPLVKFQKGQQSE
                                             :: :    *                            

A8X1T4_CAEBR          LKIKAPLVSSPMDTVTESGMAIVMALYGGIGIIHGNFPKPEDQAAEVLKVKRFKQGYVM-
IMDH_CAEEL            LKIKAPLVSSPMDTVTESGMAIVMALYGGIGIIHGNFPKPEDQAAEVLKVKRFKQGYVM-
IMDH_LEIDO            IRLHIPIVSSPMDTITENEMAKTMALMGGVGVLHNNC-TVERQVEMVKSVKAYRNGFIS-
A4HYI5_LEIIN          IRLHIPIVSSPMDTITENEMAKTMALMGGVGVLHNNC-TVERQVEMVKSVKAYRNGFIS-
Q4QD53_LEIMA          IRLHIPIVSSPMDTITENEMAKTMALMGGVGVLHNNC-TVERQVEMVKSVKAYRNGFIS-
A4HAA5_LEIBR          IRLHIPIVSSPMDTITENEMAKTMALMGGVGVLHNNC-TVERQVEMVKSVKAYRNGFIS-
K2NRC9_TRYCR          IRLHIPIVSSPMDTVTESEMARTVALMGGIGVLHNNC-SVQHQVQMVRSVKMFRNGFIM-
IMDH1_MOUSE           ITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNC-TPEFQANEVRKVKKFEQGFIT-
IMDH1_RAT             ITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNC-TPEFQANEVRKVKKFEQGFIT-
IMDH1_BOVIN           ITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNC-TPEFQANEVRKVKKFEQGFIT-
IMDH1_HUMAN           ITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNC-TPEFQANEVRKVKKFEQGFIT-
IMDH3_DANRE           ITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNC-TPEFQANEVRKVKRFEQGFIT-
IMDH1_DANRE           ITLKTPLISSPMDTVTESSMAIAMALMGGIGIIHHNC-TPEFQANEVRKVKKFEQGFIT-
IMDH1_XENTR           ITLKTPLISSPMDTVTESDMAIAMALMGGIGIIHHNC-TPEFQANEVRK--KFEQGFIT-
IMDH2_HUMAN           ITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNC-TPEFQANEVRKVKKYEQGFIT-
IMDH2_MOUSE           ITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNC-TPEFQANEVRKVKKYEQGFIT-
IMDH2_RAT             ITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNC-TPEFQANEVRKVKKYEQGFIT-
IMDH2_BOVIN           ITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNC-TPEFQANEVRKVKKYEQGFIT-
Q5F4A4_CHICK          ITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNC-TPEFQANEVRKVKKYEQGFIT-
IMDH2_XENTR           ITLKTPMVSSPMDTVTEASMAIAMALTGGIGIMHHNC-TPEFQANEVRKVKKYEQGFIT-
IMDH2_DANRE           ITMKTPLISSPMDTVTESGMAIAMALTGGIGFIHHNC-TPEFQANEVRKVKRYEQGFIT-
A7RG06_NEMVE          ITIKTPLVSSPMDTVTESALATAMALNGGIGIIHHNC-SIEFQANEIRKVKKFEQGFIM-
A7REY1_NEMVE          ITLKTPFVSSPMDTVTESAMAVAMALHGGIGIIHHNC-SIEFQADEVKKVKKYKQGFIN-
A9VB34_MONBE          ISLNAPLVSSPMDTVTEHEMAIAMALMGGIGILHHNC-DAERQAEMVRMVKKYKQGFIM-
Q16WB3_AEDAE          IMLKAPLVSSPMDTVTEADMAISMALCGGIGIIHHNC-TPEFQANEVHKVKKYKHGFIR-
W5JN05_ANODA          IMLKAPLVSSPMDTVTEADMAISMALCGGIGIIHHNC-SAEYQANEVHKVKKYKHGFIR-
IMDH_DROME            LTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNC-TPEYQALEVHKVKKYKHGFMR-
Q29IQ0_DROPS          LTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNC-TPEYQALEVHKVKKYKHGFMR-
E0VEZ4_PEDHC          INLKLPLVSSPMDTVTESEMAIAMALCGGIGIIHHNC-TPDKQAKEVIKVKKYKQGFIR-
E0VCU3_PEDHC          INLKLPLVSSPMDTVTESEMAIAMALCGGIGIIHHNC-SPEEQAHEVSKVKKYKQGFIR-
C0NBC7_AJECG          ITLKAPLLSSPMDTVTEHSMAIHMALLGGLGVIHHNC-SAEDQANMVRKVKRYENGFIL-
IMDH_ASPFU            VSLKVPLLSSPMDTVTEHNMAIHMALLGGLGVIHHNC-SPEDQAEMVRKVKRYENGFIL-
Q0V6E3_PHANO          ITLKTPFVSSPMDTVTEHNMAIHIALLGGLGVIHHNC-SQDDQAEMVRKVKRFENGFIL-
I1RBE4_GIBZE          ITLRTPFVSSPMDTVTEHEMAIHMALQGGLGVIHHNC-SPEAQADMVRKVKRYENGFIN-
C7YID4_NECH7          ITLKTPFVSSPMDTVTEHEMAIHMALQGGLGVIHHNC-SPEAQADMVRKVKRYENGFIL-
IMDH_NEUCR            ITLKTPLVSSPMDTVTEHEMAIHMALQGGVGVIHHNC-SPDEQADMVRKVKRYENGFIL-
A7F2A7_SCLS1          ITLKTPFVSSPMDTVTEHDMAIHMALQGGLGVIHHNC-SADEQAEMVQKVKRYENGFIL-
D5GG57_TUBMM          VSLKLPLVSSPMDTVTEEQMAIFMALLGGVGVIHHNC-TAEDQAEMVRKVKKYENGFIL-
IMDH_CANAL            ITLKSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNC-TSEEQAEMVRKVKKYENGFIN-
IMDH_CANAX            ITLKSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNC-TSEEQAEMVRKVKKYENGFIN-
C4YIV3_CANAW          ITLKSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNC-TAEEQAEMVRKVKKYENGFIN-
IMDH3_YEAST           ITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHHNC-TPEDQADMVRRVKNYENGFIN-
IMDH2_YEAST           ITLNIPLVSSPMDTVTESEMATFMALLGGIGFIHHNC-TPEDQADMVRRVKNYENGFIN-
IMDH4_YEAST           ITLNTPFVSSPMDTVTEADMAIYMALLGGIGFIHHNC-TPKEQASMVKKVKMFENGFIN-
Q6C897_YARLI          ITLKAPLVSSPMDTVTESEMAIHMALLGGIGIIHHNC-SADEQAEMVRKVKKYENGFIA-
A8NJG1_COPC7          VVLKTPFMSSPMDTVTEGNMAVAMALLGGIGVIHHNQ-PPEAQAAMVRAVKRHENGFIT-
IMDH_CRYNJ            IVLNTPFLSSPMDTVTEDRMAIALALHGGLGIIHHNC-SAEEQAAMVRRVKKYENGFIT-
IMDH_PNECA            IVLKTPFMSSPMDTVTESDMAINLALLGGIGVIHHNC-TIEEQTEMVRKVKKFENGFIT-
IMDH_SCHPO            IVLKTPFMSSPMDTVTEDQMAIYMALLGGIGVIHHNC-TPEEQAAMVRKVKKYENGFIL-
IMDH_LEPIN            IKLKRPFISSPMDTVTESQMAIAQALMGGIGIIHYNN-TIEEQVALVEKVKRFENGFIT-
IMDH_DICDI            ISLNAPLVSSPMDTVTEHLMAINMALLGGIGIIHYNN-TVEEQVVEVKKVKRFKNGFIT-
D0N723_PHYIT          ISLHLPLVSSPMDTVTEHAMAIGMALHGGIGIIHYNM-TVEEQVKEVRLVKKFKNGFIT-
B8BZC2_THAPS          ISLKVPFVSSPMDTVTEHKMAISMALQGGIGIIHSNF-TMEDQAEEVRKVKRFKNGFIT-
IMDH1_ARATH           VPLSIPCVSSPMDTVSESHMAAAMASLGGIGIVHYNC-GIAAQASIIRQAKSLKHPIAS-
IMDH2_ARATH           VPLSIPCVASPMDTVSESHMAAAMAALGGIGIVHYNC-DIDTQASVIRHAKSLQVPIAS-
IMDH_VIGUN            LPLAVPLVASPMDTVSESAMASAMASLGGIAIVHSNV-PAAAQASLVRAAKSRRVPILS-
C5WZ26_SORBI          VPLSIPCVASPMDTVSEATMAAAMASLGAAAVVHCNT-EPHAQAAIVRAAKSRRLPFVS-
C5X9F2_SORBI          VPLSLPCVASPMDTVSESAMAAAMASLGAAAVVHSNA-DAETQASILRAAKSRRVPWVS-
A9RU40_PHYPA          IKLRTPCVSSPMDTVTEESMAVAMAAVGGVGFVHYNN-TAREQAEIVRRAKKLRAGYVS-
A9TN21_PHYPA          IKLRTPCVSSPMDTVTEESMAVAMAAVGGIGFVHYNN-TAQEQADIVKKAKKQRVGFVA-
Q4UCL4_THEAN          IKLRIPILSSPMDTVTESKMATAMALLGGLGVIHNNL-SIDNLIKEVKAVKRFENGFVH-
Q4N0C9_THEPA          IRLRIPIVSSPMDTVTESKMATAMALLGGLGVIHNNL-SIEDLVKEVKAVKRFENGFVQ-
A7AR77_BABBO          LRLNTPVVSSPMDTVTEAKMAIEIALQGGIGIIHNNL-TMEESVEEVRKVKRYENGFIV-
A0A113RHB4_PLABE      ICLKTPIISSPMDTVTEHKMAISMALCGGLGIIHNNM-SIENQIEEVKKVKRFENGFIF-
Q7RIL8_PLAYO          ISLKTPIISSPMDTVTEHKMAISMALCGGLGIIHNNM-SIENQIEEVKKVKRFENGFIF-
A0A384L7F5_PLAKH      ICLKTPIISSPMDTVTEHKMSISLALCGGLGIIHNNM-SIENQIEEVKKVKRFENGFIF-
A5K6S2_PLAVS          ISLKTPIISSPMDTVTEHKMSISLALCGGLGIIHNNM-SIENQIEEVKKVKRFENGFIF-
Q8I2U5_PLAF7          ITLKTPVISSPMDTVTGHKMSIALALSGGLGVIHNNM-SIEKQIEEVKKVKRFENGFIF-
IMDH_HALSA            VELEVPVLSAAMDTVTESRLAIAMAREGGLGVLHQNM-DTDRVVAEVERVKRADELVIDR
Q2FS86_METHJ          IPLNIPLVSAAMDTVSTSSMAVALARAGGITVIHRNM-TPEQEAEEVRKVKHESEIIQ--
IMDH_METJA            LKLNIPIVSAAMDTVTEKEMAIALARLGGLGVIHRNM-SIEEQVHQVQAVKKADEVVI--
O26245_METTH          IELKIPVISSAMDTVTEYDMAIAMAQEGGMGVIHRNM-SIRDQVEQVKKVKRSGDITI--
IMDH_PYRFU            VKLNIPILSAAMDTVTEWEMAVAMAREGGLGVIHRNM-SIEEQVEQVKRVKRAERFIV--
IMDH_PYRHO            VKLNIPILSAAMDTVTEWEMAVAMAREGGLGVIHRNM-GIEEQVEQVKRVKRAERLIV--
Q5JFM0_THEKO          VRLNIPILSAAMDTVTEWEMAVAMAREGGLGVIHRNM-SIEEQVEQVKRVKRAERFIV--
Q8TV01_METKA          YRINIPILSAAMDTVTEAEMAIAMARHGGLGVIHRNM-TVEEQVKEVRRVKEARDVVQ--
IMDH_THEAC            IQVKVPIVSSPMDTVTEDAMAIAMARYGAIGVIHRNQ-PREKEVEMVKRVKREETIII--
A0QSU3_MYCS2          IRLRVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNL-PVAEQAGQVETVKRSEAGMV--
IMDH_MYCTU            IRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNL-PVAEQAGQVEMVKRSEAGMV--
Q8NSR5_CORGL          IRLNTPILSAAMDTVTEARMAIGMARHGGIGVLHRNL-SIQEQAENVELVKRSESGMV--
Q9L0I7_STRCO          VRVNIPLLSAAMDKVTESRMAISMARQGGVGVLHRNL-SIEDQANQVDLVKRSESGMV--
IMDH_BIFLO            IVMKAPVLSAAMDTVTESEMAIAMARNGGIGVLHRNL-SIDDQAAQVDVVKRSESGMI--
Q7VVM3_BORPE          ITLNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNL-SADDQAKEVARVKRHEFGIV--
Q63T40_BURPS          ISLNMPLVSAAMDTVTEGRLAIAMAQQGGVGIVHKNL-TPVEQAREVAKVKRFESGVV--
Q5F8H4_NEIG1          ITLNLPLLSAAMDTVTEARLAISMAQEGGIGIIHKNM-PPEMQARAVSKVKRHESGVV--
Q9JZB5_NEIMB          ITLNLPLLSAAMDTVTEARLAISMAQEGGIGIIHKNM-PPEMQARAVSKVKRHESGVV--
Q9HXM5_PSEAE          IELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNM-GIEQQAAEVRKVKKHETAIV--
Q83BZ5_COXBU          ITLNIPLLSAAMDTVTEARLAIALAEAGGIGILHKNM-SPTYQANEVRKVKKFESGVV--
Q8P8Q5_XANCP          LRLKLPILSAAMDTVTEHRLAVAMAQLGGIGIIHKNL-TPAQQAGEVAKVKKFESGVI--
Q5NFC2_FRATT          IQLNIPLVSAAMDTVTESRLAIAIAQEGGIGIIHKNM-SIQAQAQEVKKVKRFENGMV--
IMDH_ECOLI            IRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNM-SIERQAEEVRRVKKHESGVV--
Q32D54_SHIDS          IRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNM-SIERQAEEVRRVKKHESGVV--
Q8ZN59_SALTY          IRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNM-SIERQAEEVRRVKKHESGVV--
IMDH_YERPE            IRLNIPMLSAAMDTVTESRLAIALAQEGGLGFIHKNM-SIERQAEEVSRVKKHESGVV--
IMDH_HAEIN            IRLNIPMLSAAMDTVTETKLAISLAQEGGIGFIHKNM-TIERQADRVRKVKKFESGIV--
Q9KTW3_VIBCH          IALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNM-SIEQQAAQVHQVKIFEAGVV--
Q5E764_ALIF1          ISLNIPMISASMDTVTEARLAIALAQEGGIGFIHKNM-SIEQQAEEVRLVKIFEAGVV--
Q8EC51_SHEON          IELNIPLVSAAMDTVTEARLAIAMAQEGGLGFIHKNM-SIEKQAEEVRKVKIYEAGVV--
Q89N70_BRADU          IPLNIPIMASAMDTVTEARMAIAMAQAGGLGVIHRNF-DPEGQAAQVRQVKRYESGMV--
Q9A7V2_CAUVC          ISLNIPLVSAAMDTVTESRLAIAMAQAGGMGVLHRNL-SNEEQADQVREVKRYESGMV--
Q2RXU6_RHORT          ITLGIPLISSAMDTVTESQMAILMAQSGGIGVIHKNM-TIAAQAEEVRKVKRFESGMV--
Q3J2F5_RHOS4          IRMNIPLLSSAMDTVTEGRMAIAMAQAGGIGVIHRNL-GIEEQAREVSRVKRFESGIV--
IMDH_CHLTE            IEVNIPLVSAAMDTVTEAELAIALARAGGIGIIHKNL-SIDEQARQVAKVKRFESGII--
A0A4Y7QN78_9BACI      LQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNM-SIEQQAEQVDKVKRSESGVI--
Q81JC8_BACCR          LQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNM-SIEQQAEQVDKVKRSESGVI--
IMDH_BACSU            LKLNIPVISAGMDTVTESAMAIAMARQGGLGIIHKNM-SIEQQAEQVDKVKRSERGVI--
Q926Y9_LISMO          LKLNVPIWSAGMDTITEAKMAIAIARQGGIGVVHKNM-SIEQQAEEIEKVKRSESGVI--
IMDH_STAA8            VKLNIPVISAGMDTVTESKMAIAMARQGGLGVIHKNM-GVEEQADEVQKVKRSENGVI--
Q8DMX2_STRR6          LTLNIPIITAAMDTVTESQMAIAIARAGGLGVIHKNM-SIAQQADEVRKVKRSENGVI--
IMDH_STRPY            LTLNIPIITAAMDTVTGSKMAIAIARAGGLGVIHKNM-SITEQAEEVRKVKRSENGVI--
Q9CIY6_LACLA          LTLNIPIISAAMDTVTDSKMAISMARQGGLGVVHKNM-SVEEQAEEIHKVKRSESGVI--
Q82YY8_ENTFA          IKLNIPLMSASMDTVTDSNMAIAMARQGGLGVVHKNM-TVAQQADEVRKVKRSESGVI--
Q97FM8_CLOAB          IKLNIPLMSAGMDTVTESKMAIAMAREGGIGIIHKNM-TIAEQASEVDRVKRQENGVI--
A5I721_CLOBH          IKLNIPLMSAGMDTVTESKMAIAMAREGGMGIIHKNM-TIAEQASEVDKVKRQENGVI--
Q8RE86_FUSNN          ITLNLPILSAAMDTVTESDLAIALARQGGMGFIHKNM-SIEEQAAEVDRVKRSESGMI--
Q2RJG7_MOOTA          IRLNTPLVSAAMDTVTEARTAISMAREGGIGVIHKNM-TIERQAREVDRVKRSEHGVI--
D1B5E0_THEAS          IGLNIPIVSAAMDTVTESRLAIAMAREGGMGVIHRNM-PIDRQAAEVDKVKRSESGVI--
Q8A126_BACTN          IELKIPFVTAAMDTVTEAKMAIAIAREGGIGVIHKNM-SIEEQARQVAIVKRAENGMI--
A6H0L3_FLAPJ          ITLNTPIVSAAMDTVTESAMAIAMAQEGGIGVLHKNM-TIEQQAAKVRKVKRAESGMI--
Q2S2G2_SALRD          IKLNVPVLSAAMDTVTEADMAIALARQGGAGVLHKSM-SIEDQAAEVRRVKRSENGMI--
Q72D85_DESVH          IRLNIPLLSAAMDTVTESGMAISMARNGGIGVIHKNV-PIHRQRLEVEKVKKSESGMI--
Q1IS88_KORVE          ITINIPLISAAMDTVTESRMAIALAQQGGLGIVHRNL-TIEQQAGEIDKVKRSESGMI--
Q74B47_GEOSL          ITLNIPLVSAAMDTVTEARTAICMAREGGLGIIHKNL-TIEEQAMEVDKVKKSESGMI--
Q9RT87_DEIRA          VRLNIPFVSAAMDTVTETNMAIAMAREGGIGVVHKNM-SIDAQAEMIRKVKRSESGMI--
Q5SL61_THET8          LFLNIPILSAAMDTVTEAEMAIAMAREGGLGVIHKNL-SIEAQAAMVRKVKRSEAGMI--
A9WEU7_CHLAA          IRLNIPIVSAAMDTVTEHRLAIALAREGGIGIIHKNM-PIASQAEMVRKVKRSESGMI--
IMDH_AQUAE            IKLNIPIVSAAMDTVTEARLAIALAREGGIGIIHRNL-PIKKQAEEVEKVKKSESGMI--
Q9X168_THEMA          IRINIPLVSAAMDTVTEAALAKALAREGGIGIIHKNL-TPDEQARQVSIVKKTENGII--
B8DZU8_DICTD          IHLNIPILSAAMDTVTEARMAIAIAREGGLGIIHRNM-SIERQAEEVDKVKRSEHGMI--
B5YHZ0_THEYD          IQLNIPIVSAAMDTVTDANLAIAIAREGGIGVIHRNM-LPEKQALEVDKVKKSESGMI--
Q0P9J4_CAMJE          ITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNM-DIASQVREVKRVKKSESGVI--
IMDH_HELPY            IRLNIPFISAAMDTVTEHKTAIAMARLGGIGIVHKNM-DIQTQVKEITKVKKSESGVI--
IMDH_RHOBA            IRLQIPLISSPMDTVTESEMAIALAKEGGLGIVHKNL-SVRRQTEEVLKVKRSANGII--
IMDH_TRIFO            INLKIPLVSAIMQSVSGEKMAIALAREGGISFIFGSQ-SIESQAAMVHAVKNFKAGFVV-
                        :  *  :   :.::    :   *  *.  .:. .          :             

A8X1T4_CAEBR          -QPHCLSRDSTAFDMIQI--KKKYGYTGAPVTEDGRVG--SKLIGMVTSRDFDFITMDVA
IMDH_CAEEL            -QPHCLSRDSTAFDMIQI--KKKYGYTGAPVTEDGRVG--SKLIGMVTSRDFDFITMDVA
IMDH_LEIDO            -KPKSVPPNTPISNIIRI--KEEKGISGILVTENGDPH--GKLLGIVCTKDIDYVK----
A4HYI5_LEIIN          -KPKSVPPNTPISNIIRI--KEEKGISGILVTENGDPH--GKLLGIVCTKDIDYVK----
Q4QD53_LEIMA          -KPKSVPPNTPISNIIRI--KEEKGISGILVTENGDPH--GKLLGIVCTKDIDYVK----
A4HAA5_LEIBR          -KPKSVTPNTPISEIIRI--KEGKGISGILVTENGDPH--GKLLGIVCTKDIDYVK----
K2NRC9_TRYCR          -KPKSVGPDTPISVIHEI--NAEKGISGILVTENGRHD--GKLLGIVCSKDIDFVK----
IMDH1_MOUSE           -DPVVLSPSHTVGDVLEA--KIQHGFSGIPITATGTMG--SKLVGIVTSRDIDFLAEKD-
IMDH1_RAT             -DPVVLSPSHTVGDVLEA--KIQHGFSGIPITATGTMG--SKLVGIVTSRDIDFLAEKD-
IMDH1_BOVIN           -DPVVLSPSHTVGDVLEA--KIRHGFSGIPITETGTMG--SKLVGIVTSRDIDFLAEKD-
IMDH1_HUMAN           -DPVVLSPSHTVGDVLEA--KMRHGFSGIPITETGTMG--SKLVGIVTSRDIDFLAEKD-
IMDH3_DANRE           -DPVVLSPHHTVGDVLEA--KVRHGFSGIPITETGKMG--SKLVGIVTSRDIDFLSEKD-
IMDH1_DANRE           -DPVVMSPRHTVGDVFEA--KVRHGFSGIPVTETGKMG--SKLVGIVTSRDIDFLSEKD-
IMDH1_XENTR           -DPVVMSLNHTVGDVFEA--KNRHGFSGIPVTETGKMG--SKLVGIVTSRDIDFLTEKD-
IMDH2_HUMAN           -DPVVLSPKDRVRDVFEA--KARHGFCGIPITDTGRMG--SRLVGIISSRDIDFLKEEE-
IMDH2_MOUSE           -DPVVLSPKDRVRDVFEA--KARHGFCGIPITDTGRMG--SRLVGIISSRDIDFLKEEE-
IMDH2_RAT             -DPVVLSPKDRVRDVFEA--KARHGFCGIPITDTGRMG--SRLVGIISSRDIDFLKEEE-
IMDH2_BOVIN           -DPVVLSPRDRVRDVFEA--KARHGFCGIPITDTGRMG--SHLVGIISSRDIDFLKEEE-
Q5F4A4_CHICK          -DPVVLSPNDRVRDVFEA--KARHGFCGIPITDNGKMG--GKLVGIISSRDIDFLKESE-
IMDH2_XENTR           -DPVVLSPKHRVRDVFEA--KARHGFCGIPITENGKMG--SKLAGIISSRDIDFLKSEE-
IMDH2_DANRE           -DPVVMSPNERVRDVFQA--KARHGFCGIPITDNGQMG--GRLVGIISSRDIDFLKESE-
A7RG06_NEMVE          -APLVLSATNTVADVIDA--KQRHGFSGIPITENGQLG--GILQGIVTSRDIDFLHGVE-
A7REY1_NEMVE          -DPLVLSPRHTVKDVIEI--KKKNGFSGIPLTENGCMG--GVLAGIITSRDIDFLGPEQ-
A9VB34_MONBE          -DPVVLSPEDSVERVMEI--KANRGFGGIPITATGKVG--GKLLGIVTSRDIDYLNAES-
Q16WB3_AEDAE          -DPMVMSPENNVADVLEA--KKKNGFTGYPITEHGRLG--ERLLGIVTSRDIDFREEDV-
W5JN05_ANODA          -DPLVMGPENTVADVLEA--KRQNGFTGYPITENGKLG--TRLVGIVTSRDIDFREHDV-
IMDH_DROME            -DPSVMSPTNTVGDVLEA--RRKNGFTGYPVTENGKLG--GKLLGMVTSRDIDFRENQP-
Q29IQ0_DROPS          -DPSVMSPTNTVGDVLEA--RRKNGFTGYPVTENGKLG--GKLLGMVTSRDIDFRENQP-
E0VEZ4_PEDHC          -NPVVMSPDNTVADVFKV--KRDQGFCGVPITHNGKLG--GKLVGIVTSRDVDFLNETQS
E0VCU3_PEDHC          -DPVVMSPHHTVADVFRI--KKDQGFCGIPITQNGKLG--GKLVGIVTSRDIDFLEESLH
C0NBC7_AJECG          -EPVVLSPKTTVAEAKAL--KEKWGFGGFPVTENGTLP--SKLIGMITSRDIQFHPTGE-
IMDH_ASPFU            -DPVVLSPKATVGEAKAL--KAKWGFGGFPVTENGTLR--SKLVGMVTSRDIQFHTNLD-
Q0V6E3_PHANO          -DPVVISPTTTVAEAKAL--KERWGFGGFPVTEDGSLR--SKLVGIITPRDIQFHDKLD-
I1RBE4_GIBZE          -DPIVIDQNTTVGEAKAL--KEKWGFGGFPVTEDGKLG--SKLVGIVTNRDLQFEEDLD-
C7YID4_NECH7          -DPIVIARNTTVGEAKAL--KEKWGFGGFPVTEDGKLG--SKLLGIVTNRDIQFEDDHD-
IMDH_NEUCR            -DPVVITRDTTVGEAKAL--KEKWGFGGFPVTESGNLG--SKLVGIVTNRDIQFETDLD-
A7F2A7_SCLS1          -DPVVLSPQATVAEVKAL--KEKWGFGGYPVTETGKLG--SKLVGIVTNRDIQFEDDDS-
D5GG57_TUBMM          -DPVVMSPKNTVGDVRAV--KEKQGFAGIPITEDGHLH--SKLIGIVTMRDIQFHRDNS-
IMDH_CANAL            -DPVVISPEVTVGEVKKM--GEVLGFTSFPVTENGKVG--GKLVGIITSRDIQFHEDNK-
IMDH_CANAX            -DPVVISPEVTVGEVKKM--GEVLGFTSFPVTENGKVG--GKLVGIITSRDIQFHEDNK-
C4YIV3_CANAW          -DPVVISPEVTVGEVKKM--GEVLGFTSFPVTENGKVG--GKLVGIITSRDIQFHEDNK-
IMDH3_YEAST           -NPIVISPTTTVGEAKSM--KERFGFSGFPVTEDGKRN--GKLMGIVTSRDIQFVEDNS-
IMDH2_YEAST           -NPIVISPTTTVGEAKSM--KEKYGFAGFPVTTDGKRN--AKLVGVITSRDIQFVEDNS-
IMDH4_YEAST           -SPIVISPTTTVGEVKVM--KRKFGFSGFPVTEDGKCP--GKLVGLVTSRDIQFLEDDS-
Q6C897_YARLI          -DPVVVSPKHTVKEVFAL--KAKLGFAGFPVTETGCMS--GKLVGIITSRDIQFLDLDD-
A8NJG1_COPC7          -DPVVLSPTHKVEDVLDI--KARLGFCGIPITDTGVLG--GKLVGIVTARDVQF-RDPA-
IMDH_CRYNJ            -DPLCLGPDATVGDVLEI--KAKFGFCGVPITETGAPN--SKLLGIVTGRDVQF-QDAE-
IMDH_PNECA            -SPIVLSLNHRVRDVRRI--KEELGFSGIPITDTGQLN--GKLLGIVTSRDIQFHNNDE-
IMDH_SCHPO            -DPVVFSPQHTVGDVLKI--KETKGFSGIPITENGKLR--GKLVGIVTSRDVQFHKDTN-
IMDH_LEPIN            -DPVILGPKNVIRDLDAI--KERKGFTGIPVTEDGTRN--SKLIGIVTNRDIDFEKNRE-
IMDH_DICDI            -DPIVLSPTHKLSDVDMI--KQKYGFSGIPITDTGRIG--GKLVGIVTSRDTDFIKD---
D0N723_PHYIT          -DPKCLSPEDTLADVDRI--KAEFGFAGIPITESGKVG--SVLAGIVSNRDIDFIED---
B8BZC2_THAPS          -DPICLSPSSTVGDVIEL--KEKHGYSGIPITDNGRMG--GKLVGIVSNRDITFVDD---
IMDH1_ARATH           -DAGVKFPEYEITSLDAF--GPS---SFVFVEQTGTMTT-PKLLGYVTKSQWKRMNYEQ-
IMDH2_ARATH           -DAVFKCPEHQIGSVDDF--GPS---SFVFVSQTGTLT--PKLLGYVSKSEWSSMKDDQ-
IMDH_VIGUN            -EPAFAAPSAVIEHEDDF--AAS---PFLLVTDIGAAG--GKLLGYVAKRDWTNQKD---
C5WZ26_SORBI          -SVPFFSPSS-APTLNDF--AGN---EYALVTQHGDSL--STLVGVAVAADAASREV---
C5X9F2_SORBI          -STQFFAPSA-APSAADF--AGC---AYAVVTERGDAL--SRLVGIAAAADHRPG-----
A9RU40_PHYPA          -DPACVRPSDPISRIDAL--RARRGFSSVVVTEDGAVG--SALLGVVTSRDVDFVRD---
A9TN21_PHYPA          -NPVCVSPSDTISVIDSL--KASKGFSSVVVTEDGKVG--SRLVGIVTSRDVDFVRD---
Q4UCL4_THEAN          -NPVCLKPTSTVSDWVEI--RDKLGFTSVPITSDGNPG--SKLLGIVTKTDMYFVESKN-
Q4N0C9_THEPA          -NPLCLKPTSTVSDWVQI--RDKFGFTSVPITSDGNAG--SKLLGIVTKTDMYFVESKN-
A7AR77_BABBO          -DPYTLTPNHTVEDWMAI--RDKYGYRSIPITTDGRCG--SKLEGIVTSGDVCFVQDKC-
A0A113RHB4_PLABE      -DPYTFSPEHTVADVLCV--KNKVGYKSYPITSDGKVG--SKLVGIITGIDYLYLTNPD-
Q7RIL8_PLAYO          -DPYTFSPEHTVADVLCV--KNKVGYKSYPITSDGKVG--SKLVGIITGIDYLYLTNPD-
A0A384L7F5_PLAKH      -DPYTFSPEHTVADVIAT--KNKVGYKSYPITVDGKVG--SKLVGIITGVDYLYLTDKT-
A5K6S2_PLAVS          -DPYTFSPEHTVADVIAT--KNKVGYKSYPITVDGKVG--SKLVGIITGVDYLYLTDKT-
Q8I2U5_PLAF7          -DPYTFSPEHTVADVLET--KNRVGYKSYPITVDGKVG--SKLVGIITGVDYLYLTNKS-
IMDH_HALSA            ENVVTAAPEQTVEAVDEM--MDRSDVSGAPVVDDDD-----TVRGIISATDIRPYLEVGE
Q2FS86_METHJ          REVLTVTPDSLIADVDRM--MTYHGIGGVPVVEDG------KVIGIVSRRDLRAMVSRIG
IMDH_METJA            KDVITVSPDDTVGEAINV--METYSISGLPVVDNED-----KLVGIITHRDVKAI--EDK
O26245_METTH          RDVITISPDSTLREAHEI--MDQEEISGLPVVE-DG-----VLIGIISRRDIEPIFNSDA
IMDH_PYRFU            EDVITIAPDETIDYALFL--MEKHGIDGLPVVEED------RVVGIITKKDIAAREGR--
IMDH_PYRHO            EDVITIAPDETVDFALFL--MEKHGIDGLPVVEDE------KVVGIITKKDIAAREGK--
Q5JFM0_THEKO          EDVISIKPDESLDYALFL--MERNGVDGLPVVDDEG-----RVVGVITKKDIAAKQGS--
Q8TV01_METKA          RDVVTISPDESVKRAVEL--MEKHDVGGLPVVDEEG-----KVVGIITRRDVGLLSEEEI
IMDH_THEAC            RDVYTISPETPIEVARTL--MATRNIAGLPVVKDD------KLVGIVTKRDLEFVKKGS-
A0QSU3_MYCS2          TDPVTCSPDNTLAEVDAM--CARFRISGLPVVDDTG-----ELVGIITNRDMRFEVDQ--
IMDH_MYCTU            TDPVTCRPDNTLAQVDAL--CARFRISGLPVVDDDG-----ALVGIITNRDMRFEVDQ--
Q8NSR5_CORGL          TDPVTCTPDMSIQEVDDL--CARFRISGLPVVDEAG-----KLVGICTNRDMRFESDM--
Q9L0I7_STRCO          ANPITIHPDATLGEADAL--CAKFRISGVPVTDGAG-----KLLGIVTNRDMAFETDR--
IMDH_BIFLO            TDPLTVNPEVTLADLDKL--CGKFHISGLPVVDKEN-----KLVGIITNRDMRFIASEDY
Q7VVM3_BORPE          IDPVTVTPDMKVRDAIAL--QRQHGISGLPVVE-G-----RKLVGIVTNRDLRFED--RL
Q63T40_BURPS          RDPITVPPSMKVRDVIAL--SRQHGISGFPVVE-G-----PKLVGIVTNRDLRFET--RL
Q5F8H4_NEIG1          KDPVTVAPTTLIREVLEMRAQRKRKMSGLPVVE-N-----GKVVGIVTNRDLRFEN--RV
Q9JZB5_NEIMB          KDPVTVAPTTLIREVLEMRAQRKRKMSGLPVVE-N-----GKVVGIVTNRDLRFEN--RV
Q9HXM5_PSEAE          RDPVTVTPSTKIIELLQM--AREYGFSGFPVVE-Q-----GELVGIVTGRDLRVKP--NA
Q83BZ5_COXBU          FDPITVSPESTIGELKKI--TSEYNISGLPVVE-G-----EQLIGIITSRDIRFET--DM
Q8P8Q5_XANCP          TEPFTVSPDTTIGEVIAL--TRARNISGVPVVD-G-----SELVGIVTSRDMRFEK--KL
Q5NFC2_FRATT          IDPITIKQESSIKEIMQL--AKEHNFSGFPVVDDN-----NKIIGIVTRRDFRFAK--DL
IMDH_ECOLI            TDPQTVLPTTTLREVKEL--TERNGFAGYPVVTEE-----NELVGIITGRDVRFVT--DL
Q32D54_SHIDS          TDPQTVLPTTTLREVKEL--TERNGFAGYPVVTEE-----NELEGIITGRDVRFVT--DL
Q8ZN59_SALTY          TDPQTVLPTTTLHEVKAL--TERNGFAGYPVVTED-----NELVGIITGRDVRFVT--DL
IMDH_YERPE            TEPQTVTPTTTLRQVKEL--TARNGFAGYPVVTED-----YELVGIITGRDVRFVT--DL
IMDH_HAEIN            SEPVTVLPNLTLAELAEM--VKKNGFAGYPVVDGE-----NNLIGIITGRDTRFVK--DL
Q9KTW3_VIBCH          THPVTVRPEQTIADVMEL--THYHGFAGFPVVTEN-----NELVGIITGRDVRFVT--DL
Q5E764_ALIF1          SAPVTVRPDATIQDVKEL--TEKHGFAGFPVVTET-----NELVGIITGRDVRFVT--DL
Q8EC51_SHEON          QQPVTVTPSTTLADLKVL--TAKNGFAGYPVVNDA-----NELIGIITGRDVRFVT--DW
Q89N70_BRADU          VNPLTISPEATLDDALKL--MSDHGISGIPVVTGAGKSTPGKLVGILTNRDVRFAT--DR
Q9A7V2_CAUVC          INPLTIHPDTTLAEIREI--KARRKISGFPVVERG----SGKLVGILTNRDMRFEG--DD
Q2RXU6_RHORT          VNPVTINPDASLSTALDL--MAHHKISGIPVTENG----SGKLVGILTNRDVRFAE--NT
Q3J2F5_RHOS4          YAPITLRPDQTLADAKAL--QERYNVTGFPVVDES-----GRVVGIVTNRDMRFAN--DD
IMDH_CHLTE            RNPIHLFEDATIQDAIDL--MIRHSISGIPVVEHPTPEGCLLLKGIVTNRDLRMTA--SS
A0A4Y7QN78_9BACI      SDPFFLTPEHQVYDAEHL--MGKYRISGVPVVNNLDE---RKLVGIITNRDMRFIQ--DY
Q81JC8_BACCR          SDPFFLTPEHQVYDAEHL--MGKYRISGVPVVNNLDE---RKLVGIITNRDMRFIQ--DY
IMDH_BACSU            TNPFFLTPDHQVFDAEHL--MGKYRISGVPIVNNEED---QKLVGIITNRDLRFIS--DY
Q926Y9_LISMO          IDPFYLTPDHQVFAAEHL--MGKYRISGVPIVNNEKE---RKLVGILTNRDLRFIS--DY
IMDH_STAA8            SNPFFLTPEESVYEAEAL--MGKYRISGVPIVDNKED---RNLVGILTNRDLRFIE--DF
Q8DMX2_STRR6          IDPFFLTPEHTIAEADEL--MGRYRISGVPVVETLEN---RKLVGILTNRDLRFIS--DY
IMDH_STRPY            IDPFFLTPEHKVSEAEEL--MQRYRISGVPIVETLAN---RKLVGIITNRDMRFIS--DY
Q9CIY6_LACLA          TDPFFLTPNHKIEEAENL--MATYRISGVPIVDTLEN---RKLVGIITNRDLRFIT--DY
Q82YY8_ENTFA          IDPFFLTPTNLVADAEEL--MSRYRISGVPIVETMEN---RKLVGIITNRDMRFVT--DY
Q97FM8_CLOAB          TNPISLSKDNSVQEALDL--MKRYRISGVPITDNA-----GKLIGIITNRDIVFET--DY
A5I721_CLOBH          ADPFYLAPNNTIQDALNL--MSRYRISGVPITKE------GKLVGIITNRDILFEN--NY
Q8RE86_FUSNN          TNPITLNKDSRVYQAEEL--MSRYKISGLPVIED--D---GKLIGIITNRDIKYRK--DL
Q2RJG7_MOOTA          TDPISLSPDHKVREAIAL--MEHYHISGVPITDNG------KLVGIITNRDIRFED--NH
D1B5E0_THEAS          VDPFYLYPQDKIQDAVDL--MSHYHISGVPIVDEKL-----RLVGIITNRDLRFVT--DY
Q8A126_BACTN          YDPVTIKRGSTVSDALGI--MAEYKIGGIPVVDDE-----GYLVGIVTNRDLRFER--DM
A6H0L3_FLAPJ          IDPVTLLMTATVADAKMA--MKEFGIGGIPIVDEN-----KTLKGIVTNRDLRFEK--NG
Q2S2G2_SALRD          LDPITISPHDTVADARNM--MAHYSIGGIPVVDES-----DKLVGIVTNRDVRFEL--DG
Q72D85_DESVH          IDPVTIAPGLTVRQALEV--MAEYRVSGLPVVEND------KLVGILTNRDVRFVK--DL
Q1IS88_KORVE          VDPITMSPENKISEALDV--MKRYRISGVPVTKNK------KLVGILTNRDLRFET--RT
Q74B47_GEOSL          VDPITMRPNQKIHEALAI--MEKYRISGVPVTNSKG-----KLVGILTNRDLRFET--NL
Q9RT87_DEIRA          VDPITLPPSATVRDADRL--MGEYRISGVPVTAPDG-----KLLGIITNRDMRFID--DL
Q5SL61_THET8          QDPVTLPPTATLEDAERL--MREYRIGGLPVVDVYG-----RLLGLVTNRDLRFER--DL
A9WEU7_CHLAA          TDPITLPPDRTVGDALDL--MAEYKISGVPVTTADG-----DLVGIITNRDLRFET--DR
IMDH_AQUAE            INPVTVKPDTRVKEALDI--MAKYKISGVPVVDEER-----KLIGILTNRDLRFIKPEDY
Q9X168_THEMA          YDPITVTPDMTVKEAIDL--MAEYKIGGLPVVDEEG-----RLVGLLTNRDVRFEK--NL
B8DZU8_DICTD          TDPIFLYPDQTVGEALSI--MAKYHISGLPVVERDG-----KLVGIVTNRDLRFES--DM
B5YHZ0_THEYD          VDPITISPDAPLSEALAL--MERYRISGVPVTV-NG-----KLVGIITNRDLKFER--DF
Q0P9J4_CAMJE          IDPIFVSPKASVAEALEI--MAEYRISGVPVVDEDK-----KLIGILTNRDLRFES--DF
IMDH_HELPY            NDPIFIHAHRTLADAKVI--TDNYKISGVPVVDDKG-----LLIGILTNRDVRFET--DL
IMDH_RHOBA            VNPVTLNPAQKVSAAAEL--MDRANVSGIPIVEDDR-----TLAGILTRRDLRFLE--DP
IMDH_TRIFO            -SDSNVKPDQTFADVLAI--SQRTTHNTVAVTDDGTPH--GVLLGLVTQRDYPIDLTQTE
                                                    :           : *     :         

A8X1T4_CAEBR          GQKGTPISDTNDVTPTTPITKIMVAVDQLHLG---HINDAPELSQKKLKEHRLGK-LPIV
IMDH_CAEEL            GQKGTPISDTNDVTPTTPITRIMVSVDQLHLG---HINDAPELSQKKLKEHRLGK-LPIV
IMDH_LEIDO            -------------NKDTPVSAVMTRREKMTVE---RAPIQLEEAMDVLNRSRYGY-LPIV
A4HYI5_LEIIN          -------------NKDTPVSAVMTRREKMTVE---RAPIQLEEAMDVLNRSRYGY-LPIV
Q4QD53_LEIMA          -------------NKDTPVSAVMTRREKMTVE---RAPIQLEEAMDVLNRSRYGY-LPIV
A4HAA5_LEIBR          -------------KKETPVSAVMTRRDKMTVE---RAPIQLEEAMDVLNRSRHGY-LPIV
K2NRC9_TRYCR          -------------DVSLPVSQFMTKRESMTVE---RYPIRLEEAMDVLNRSRHGY-LPVL
IMDH1_MOUSE           --------------HTTLLSEVMTPRVELVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH1_RAT             --------------HTTLLSEVMTPRIELVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH1_BOVIN           --------------HTTLLSEVMTPRNELVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH1_HUMAN           --------------HTTLLSEVMTPRIELVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH3_DANRE           --------------NNKYLEEAMTKREDLVVA---PAGVTLKEANDILQRSKKGK-LPIV
IMDH1_DANRE           --------------YDRPLEESMTKREDLVVA---PAGVTLKEANDILQRSKKGK-LPIV
IMDH1_XENTR           --------------YSTYLSEVMTKRDELVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH2_HUMAN           --------------HDCFLEEIMTKREDLVVA---PAGITLKEANEILQRSKKGK-LPIV
IMDH2_MOUSE           --------------HDRFLEEIMTKREDLVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH2_RAT             --------------HDRFLEEIMTKREDLVVA---PAGVTLKEANEILQRSKKGK-LPIV
IMDH2_BOVIN           --------------HDRLLGEIMTKREDLVVA---PAGITLKEANEILQRSKKGK-LPIV
Q5F4A4_CHICK          --------------HDLPLGEIMTKREDLVVA---PSGVMLKEANEILQRSKKGK-LPIV
IMDH2_XENTR           --------------HDLALSEIMTRREDLVVA---PAGVTLKEANEILQRSKKGKLLPIV
IMDH2_DANRE           --------------HDLPLSEVMTKREDLVVA---PAGVTLKEANEILQRSKKGK-LPIV
A7RG06_NEMVE          --------------NHKQLGEVMTRLEDLVVA---KAGITLNEANKILQMSKKGK-LPIV
A7REY1_NEMVE          --------------IDEPLSEFMTPLNDLVVA---KDDCTLQEANRILQQSKKGK-LPIV
A9VB34_MONBE          --------------YATPVSEVMTPAERLMVG---NTEMSLDDANAVMQDARKGK-LPIV
Q16WB3_AEDAE          ---------------ALKLKDIMTKVEDMVTA---PSGVTLQEANHILEKSKKGK-LPIV
W5JN05_ANODA          ---------------EIKLKDIMTKVEDMITA---PNGVTLMEANHILEKSKKGK-LPIV
IMDH_DROME            ---------------EVLLADIMTT--ELVTA---PNGINLPTANAILEKSKKGK-LPIV
Q29IQ0_DROPS          ---------------EIVLADIMTT--ELVTA---PNGITLPTANAILEKSKKGK-LPII
E0VEZ4_PEDHC          --------------HSMKLESVMTKFEDLVTA---KAGVTLEQANKILEKSKKAK-LPIV
E0VCU3_PEDHC          --------------NSLKLDSVMTKFEDLVTS---NAGVTLQQANSILEKSKKGK-LPII
C0NBC7_AJECG          ----------------DPVTAVMT--TDLVTA---PSGTTLAEANEVLRSSKKGK-LPIV
IMDH_ASPFU            ----------------DPVTAIMS--TDLVTA---PAGTTLAEANDVLRSSKKGK-LPIV
Q0V6E3_PHANO          ----------------DPVTAVMS--TDLVTA---PYGIDLKEANDILNKSKKGK-LPIV
I1RBE4_GIBZE          ----------------QAVSNVMV--KDLVTA---PETVTLLEANKILSKSKKGK-LPIV
C7YID4_NECH7          ----------------HDISSVMV--TDLITA---PDGVTLAEANKILAKSKKGK-LPIV
IMDH_NEUCR            ----------------KPVSEVMV--TDLITA---TAGVNLLEANKILAESKKGK-LPII
A7F2A7_SCLS1          ----------------ATVASVMV--TDLVTA---SYGTELVEANAILAKSKKGK-LPIV
D5GG57_TUBMM          ----------------TALSEVMT--TELLTA---PEGINLSEANEILRSSKKGK-LPIV
IMDH_CANAL            ----------------SPVSEVMT--KDLVVG---KKGISLTDGNELLRSSKKGK-LPIV
IMDH_CANAX            ----------------SPVSEVMT--KDLVVG---KKGISLTDGNELLRSSKKGK-LPIV
C4YIV3_CANAW          ----------------SPVSEVMT--KDLVVG---KKGISLTDGNELLRSSKKGK-LPIV
IMDH3_YEAST           ----------------LLVQDVMT--KNPVTG---AQGITLSEGNEILKKIKKGK-LLIV
IMDH2_YEAST           ----------------LLVQDVMT--KNPVTG---AQGITLSEGNEILKKIKKGR-LLVV
IMDH4_YEAST           ----------------LVVSEVMT--KNPVTG---IKGITLKEGNEILKQTKKGK-LLIV
Q6C897_YARLI          ----------------TPVGEVMTPGSELVTA---PKTIGLSAANDLLKKSKKGK-LPIV
A8NJG1_COPC7          ----------------TSLSEVMT--TDLVTA---PQGVTLSEANDILRDSKKGK-LPII
IMDH_CRYNJ            ----------------TPIKSVMT--TEVVTG---SSPITLEKANSLLRETKKGK-LPIV
IMDH_PNECA            ----------------SFLSEVMT--KDLVTG---SEGIRLEEANEILRSCKKGK-LPIV
IMDH_SCHPO            ----------------TPVTEVMTPREELITT---AEGISLERANEMLRKSKKGK-LPVV
IMDH_LEPIN            ----------------ITLDKVMT--TNLITG---KEGITLQDANEIIKKSKIGK-LPIV
IMDH_DICDI            --------------RSTTLSEVMTT--DLITG---QQNCTLEEANSILKSCKKGK-LPIV
D0N723_PHYIT          --------------RQTKLKEVMST--NLVTA---PEGVSLTEANRILRESKKGK-LPIV
B8BZC2_THAPS          --------------RTMKLEEIMTPRDKLSVA---KQGVELIEANEILKETKKGK-LPVV
IMDH1_ARATH           --------------REMKIYDYMKS--CDSSDYCVPWEIDFEKLEFVLEDKQKGF-VVLE
IMDH2_ARATH           --------------KEVKIYDYMKS--CENKDYYVPWDIDLDKIEAVLEDKQKGF-VVLE
IMDH_VIGUN            --------------KSLRVGDYMAP--PPRR---APWNADLNKIHEIMENEKSGA-VALE
C5WZ26_SORBI          ---------------PVSVYEYMRP--APRL---ASASFDFEKAAAFLADEGLDY-APLV
C5X9F2_SORBI          ----------------VPVSEYMTP--APRT---ASAAFDFEQAAAFLADEGLDF-APLV
A9RU40_PHYPA          --------------RSTEVREVMSR--DLVT---APAGSTMEEAAGVLIRSKKSL-LPLV
A9TN21_PHYPA          --------------RSTQVREVMST--DLLI---APAGTTLEEATKILTRNKKSL-LPLV
Q4UCL4_THEAN          ----------------VSLEEIMST--NLVVG---KHPMKLNDANELLFMSKKGV-LPIV
Q4N0C9_THEPA          ----------------VVLEDIMST--DLVVG---NHPMKLHDANELLFMSKKGV-LPIV
A7AR77_BABBO          ----------------TKIEEIMTR--DPIVG---HHPLTLQDANNILYKSRKGI-LPIV
A0A113RHB4_PLABE      ----------------VKIKDIMTT--ELVTG---KYPISLSDANKVLCNEKKSI-LPIV
Q7RIL8_PLAYO          ----------------VKIKEIMTT--ELVTG---KYPISLSDANKVLCDEKKSI-LPIV
A0A384L7F5_PLAKH      ----------------RKIKDIMTT--DVVTG---KYPINLSDANKVLCEEKKSV-LPIV
A5K6S2_PLAVS          ----------------RKIKDIMTT--EVVTG---NYPINLSDANKVLCEEKKSV-LPIV
Q8I2U5_PLAF7          ----------------MKIGDIMTT--DVVTG---SYPINLSDANKVLCDEKKSV-LPIV
IMDH_HALSA            SD-A--------------VREAMT--DEVITA---PEDITARD-ALELMYEHKIERVPIV
Q2FS86_METHJ          NQ-P--------------VKSIMT--HEPIVA---KEGISIDD-AFDLMYSRKVERLPVV
IMDH_METJA            TK-K--------------VKDVMT--KDVVCA---KEDVEEEE-ALELMYANRVERLPIV
O26245_METTH          DK-K--------------VDQVMT--RDVVTV---DESITPNE-ALDIAYENKVERLPVV
IMDH_PYRFU            ---T--------------VKELMT--REVITV---PESVDVEE-ALKIMMENRIDRLPVV
IMDH_PYRHO            ---L--------------VKELMT--KEVITV---PESIEVEE-ALKIMIENRIDRLPVV
Q5JFM0_THEKO          ---K--------------VSEVMT--GEVITV---PETVTAEE-AVQIMFDHRIDRLPVV
Q8TV01_METKA          GELD--------------VKSVMT--EEPVVI---EEGEDLEERALRVMREEKIERVPVV
IMDH_THEAC            ---S--------------VSDVMV--RDVITA---PENVDIDE-AIEILHKNRIEKLPLV
A0QSU3_MYCS2          -SKP--------------VSEVMT-KAPLITA---KEGVSAEA-ALGLLRRHKIEKLPIV
IMDH_MYCTU            -SKQ--------------VAEVMT-KAPLITA---QEGVSASA-ALGLLRRNKIEKLPVV
Q8NSR5_CORGL          -NRR--------------VAEVMT-PMPLVVA---EEGVTKEQ-ALALLSANKVEKLPII
Q9L0I7_STRCO          -SRQ--------------VREVMT-PMPLVTG---QVGISGVD-AMELLRRHKIEKLPLV
IMDH_BIFLO            DTLK--------------VKDVMT-KENLVTG---PSNISKDD-AHRLLAQHKVEKLPLV
Q7VVM3_BORPE          DQP---------------LRNIMTPQDRLVTM---KEGATLDE-AQALMHKHRLERVLIV
Q63T40_BURPS          DEP---------------VKSIMTPRERLVTV---AEGTPLAE-AKALMHSHRLERVLVV
Q5F8H4_NEIG1          DLP---------------VSAIMTPRERLVTV---PEGTSIDE-ARELMHTYKVERVLVL
Q9JZB5_NEIMB          DLP---------------VSAIMTPRERLVTV---PEGTSIDE-ARELMHTHKVERVLVL
Q9HXM5_PSEAE          GDT---------------VAAIMTPKDKLVTA---REGTPLEE-MKAKLYENRIEKMLVV
Q83BZ5_COXBU          QQK---------------VVNLMTPKDRLITI---KEGASRDE-IINLFRQHRVEKLLVI
Q8P8Q5_XANCP          DDP---------------VRHIMTKKDRLITV---REGASDEE-VLELLHRNRIEKILVV
Q5NFC2_FRATT          DEP---------------VSSIMTPREKLVTV---PEDASQGA-IKKKLHEHKIEKLLVV
IMDH_ECOLI            NQP---------------VSVYMTPKERLVTV---REGEAREV-VLAKMHEKRVEKALVV
Q32D54_SHIDS          NQP---------------VSVYMTPKERLVTV---REGEAREV-VLAKMHEKRVEKALVV
Q8ZN59_SALTY          NQP---------------VSVYMTPKERLVTV---REGEAREV-VLAKMHEKRVEKALVV
IMDH_YERPE            DQP---------------VTAVMTPKERLVTV---KEGETREV-VLQKMHEKRVEKVLVV
IMDH_HAEIN            SKT---------------VSQVMTKKEDLVTV---KEGASREE-ILELMHQHRVEKVLVV
Q9KTW3_VIBCH          TKS---------------VAAVMTPKERLATV---KEGATGAE-VQEKMHKARVEKILVV
Q5E764_ALIF1          SKK---------------VDVVMTPKSRLASV---KEGATREE-VQEKMHEARVEKVLVV
Q8EC51_SHEON          SKT---------------VEEVMTPKARLVTV---AEGTKLDE-VQKLMHSHRIEKVLVV
Q89N70_BRADU          RQK---------------VSELMT-HEGLVTV---RENVSQDE-ARRMLHQHRIEKLLVV
Q9A7V2_CAUVC          KVP---------------ASQLMT-RDNLITV---SEGVDHRE-ARELLRRHKIERLIVV
Q2RXU6_RHORT          AKP---------------VSDFMT-RDNLITV---GEGVSQGE-ARRLLHTNRIEKLIVV
Q3J2F5_RHOS4          RTP---------------VKVMMT-SDNLAIL---QEPADRDT-AISLMKARRIEKLLVT
IMDH_CHLTE            DEK---------------ITTIMT--TNLVTA---KEGIDLLT-AEDILMRNKIEKLLII
A0A4Y7QN78_9BACI      SIK---------------ISDVMT-KEQLITA---PVGTTLSE-AEKILQKYKIEKLPLV
Q81JC8_BACCR          SIK---------------ISDVMT-KEQLITA---PVGTTLEE-AEKILQKYKIEKLPLV
IMDH_BACSU            SMK---------------ISDVMT-KEELVTA---SVGTTLDE-AEKILQKHKIEKLPLV
Q926Y9_LISMO          STV---------------IKDVMT-KENLVTA---PVGTTLKQ-AEQILQKHRIEKLPLV
IMDH_STAA8            SIK---------------IVDVMT-QENLITA---PVNTTLEE-AEKILQKHKIEKLPLV
Q8DMX2_STRR6          NQP---------------ISNHMT-SENLVTA---PVGTDLAT-AESILQEHRIEKLPLV
IMDH_STRPY            NAP---------------ISEHMT-SEHLVTA---AVGTDLET-AERILHEHRIEKLPLV
Q9CIY6_LACLA          NQQ---------------IKNMMT-SENLITA---PVGTTLDT-AARILQEHKIEKLPLV
Q82YY8_ENTFA          QIK---------------IEEVMT-KDHLVTA---PVGTSLKD-AEKILQKHKIEKLPIV
Q97FM8_CLOAB          SKK---------------IEELMT-TENLVTA---PQGTTIDE-AKNLLKKHKIEKLPLV
A5I721_CLOBH          EKK---------------IEEVMT-KENLITA---PENTTIGE-AKDILKSHKIEKLPLV
Q8RE86_FUSNN          DQP---------------VGDIMT-SKGLITA---PVGTTLEQ-AKEILLANRIEKLPIT
Q2RJG7_MOOTA          ERP---------------IKEVMT-KDNLVTA---PVGTTLAE-AMAILRAHKIEKLPLV
D1B5E0_THEAS          GQA---------------ISEVMT-KDGLVTA---PVGTTLDD-AKDILMRHKIEKLPIV
Q8A126_BACTN          TKH---------------IDLVMTPKERLVTT---NQSTDLES-AAQILQKHKIEKLPIV
A6H0L3_FLAPJ          SRP---------------IVEIMT-KENLVTV---AEGTSLQE-AEVVLQGHKIEKLPVI
Q2S2G2_SALRD          DTP---------------IREMMT-ADDLVTV---PVGTTLDE-AIEILQAHKVEKLPVV
Q72D85_DESVH          ETTC--------------VSEVMTS-KNLVTV---PVGTTLEE-AKHHLHQHRIEKLLVV
Q1IS88_KORVE          DIP---------------ISEVMTK-ENLITV---PVGTTLED-AEEILHQHRVEKLLVV
Q74B47_GEOSL          DLP---------------ISARMTK-RRLVTV---AVGTTLEE-AKEHLKHTRVEKLLVV
Q9RT87_DEIRA          DVP---------------LGDVMTR-EHLVTV---PVGTDLEQ-ARELFKLNRIEKL-LV
Q5SL61_THET8          KRP---------------VTEVMTPVERLVTA---RPGTTLEE-AEELLRRHKVEKLPLV
A9WEU7_CHLAA          NRP---------------IRDLMTS-RNLVTV---PEGTTLEE-AKEVLHRHRIEKVLVV
IMDH_AQUAE            SKP---------------VSEFMT-KENLITA---PEGITLDE-AEEIFRKYKIEKLPIV
Q9X168_THEMA          SKK---------------IKDLMTPREKLIVA---PPDISLEK-AKEILHQHRIEKLPLV
B8DZU8_DICTD          NKK---------------VSEIMT-KDNLIVA---QVGITIKD-AQEILQRYKIEKLPIV
B5YHZ0_THEYD          TRK---------------VEEVMT-KERLITA---HVGITLEE-AQEILHRYKIEKLPIV
Q0P9J4_CAMJE          SNL---------------VENVMT-KMPLITA---PKGCTLDD-AEKIFSTNKVEKLPIV
IMDH_HELPY            SKK---------------VGDVMT-KMPLVTA---HVGISLDE-ASDLMHKHKIEKLPIV
IMDH_RHOBA            DMP---------------ISQVMT-RENLVTA---VGNVTLAQ-AEKILTEKRVEKLLLI
IMDH_TRIFO            TK----------------VSDMMTPFSKLVTA----HQDTKLSEANKIIWEKKLNALPII
                                            *                                   : 

A8X1T4_CAEBR          NDKGE---LCALLCRSDLLKARDYPMAS---Y-DSKGQLLCGAAVNTRG--------ESQ
IMDH_CAEEL            NDNGE---LCALLCRSDLLKARDYPMAS---Y-DSKGQLLCGAAVNTRG--------ESQ
IMDH_LEIDO            NENDE---VVNLCSRRDAVRARDYPHST---L-DKSGRLICAAATSTRP--------EDK
A4HYI5_LEIIN          NENDE---VVNLCSRRDAVRARDYPHST---L-DKSGRLICAAATSTRP--------EDK
Q4QD53_LEIMA          NENGE---VVNLCSRRDAVRARDYPHST---L-DKSGRLICAAATSTRP--------EDK
A4HAA5_LEIBR          NGNDE---IVYLCSRRDAVRARDYPHST---L-DKSGRLICAAATSTRP--------EDK
K2NRC9_TRYCR          NDKGE---VMCLCSRRDAVRARVYPNSS---L-DRNGHLLCAAATSTRE--------EDK
IMDH1_MOUSE           NDQDE---LVAIIARTDLKKNRDYPLAS---K-DSHKQLLCGAAVGTRE--------DDK
IMDH1_RAT             NDQDE---LVAIIARTDLKKNRDYPLAS---K-DSHKQLLCGAAVGTRE--------DDK
IMDH1_BOVIN           NDRDE---LVAIIARTDLKKNRDYPLAS---K-DSHKQLLCGAAVGTRE--------DDK
IMDH1_HUMAN           NDCDE---LVAIIARTDLKKNRDYPLAS---K-DSQKQLLCGAAVGTRE--------DDK
IMDH3_DANRE           NDKDE---LVAIIARTDLKKNRDYPLAS---K-DSRKQLLCGAAIGTRE--------DDK
IMDH1_DANRE           NDSDE---LVAIIARTDLKKNRDYPLAS---K-DSRKQLLCGAAIGTRE--------DDK
IMDH1_XENTR           NDSDE---LVAIIARTDLKKNRDYPLAS---K-DCRKQLLCGAAIGTRE--------DDK
IMDH2_HUMAN           NEDDE---LVAIIARTDLKKNRDYPLAS---K-DAKKQLLCGAAIGTHE--------DDK
IMDH2_MOUSE           NENDE---LVAIIARTDLKKNRDYPLAS---K-DAKKQLLCGAAIGTHE--------DDK
IMDH2_RAT             NESDE---LVAIIARTDLKKNRDYPLAS---K-DTKKQLLCGAAIGTHE--------DDK
IMDH2_BOVIN           NENDE---LVAIIARTDLKKNRDYPLAS---K-DAKKQLLCGAAIGTHE--------DDK
Q5F4A4_CHICK          NEDDE---LVAIIARTDLKKNRDYPLAS---K-DSKKQLLCGAAIGTHE--------DDK
IMDH2_XENTR           NGNDE---LVAIIARTDLKKNRDYPLAS---K-DAKKQLLCGAAIGTHE--------DDK
IMDH2_DANRE           NEEGC---LVAIIARTDLKKNRDFPLAS---K-DSRKQLLCGAAIGTHN--------DDK
A7RG06_NEMVE          NEKGE---LVSLIARTDLKKNRDYPLAS---K-DENKQLLVGAAIGTRE--------DDK
A7REY1_NEMVE          NENGE---LVSLIAYSDLRKNREFPLAS---K-DSKKQLLVGAAIGTRA--------EDK
A9VB34_MONBE          NDDFE---LVALISRSDLKKSREYPDSS---K-DAKGQLLVGAAIGTRE--------HDR
Q16WB3_AEDAE          NKNGE---LVALIARTDLKKARSYPNAS---K-DSNKQLLVGAAISTRD--------DDK
W5JN05_ANODA          NTNGE---LVALIARTDLKKARSYPNAS---K-DSNKQLLVGAAISTRD--------EDK
IMDH_DROME            NQAGE---LVAMIARTDLKKARSYPNAS---K-DSNKQLLVGAAIGTRS--------EDK
Q29IQ0_DROPS          NQAGE---LVAMIARTDLKKARSYPNAS---K-DSNKQLLVGAAIGTRG--------EDK
E0VEZ4_PEDHC          NDNSE---LVALMARTDLKKNRSFPNAS---K-DENKQLLVGAAIGTRE--------EDL
E0VCU3_PEDHC          NDDHE---LVALIARTDLKKSRNFPNAS---K-DENKQLLVGAAIGTRE--------EDK
C0NBC7_AJECG          DSEGN---LVSLLSRSDLMKNLHYPLAS---KLPHSKQLICAAAIGTRP--------EDK
IMDH_ASPFU            DADGN---LVSLLSRSDLMKNLHYPLAS---KLPDSKQLICAAAIGTRE--------EDK
Q0V6E3_PHANO          DGDFN---LIALLSRSDLMKNLNFPLAS---KLPHSKQLIAAAAIGTRP--------EDK
I1RBE4_GIBZE          DKDSN---LVSMISRSDLTKNQHFPNAS---KLPDSKQLLCAAAIGTRP--------EDK
C7YID4_NECH7          DKDFN---LVSMISRSDLTKNQHFPFAS---KLPDSKQLLCAAAIGTRP--------EDK
IMDH_NEUCR            DKEGN---LVSMISRSDLTKNLHFPLAS---KTKDSKQLICAAAIGTRP--------EDK
A7F2A7_SCLS1          DKNGN---LVSMISRSDLNKNIHYPLAS---KLPDSKQLICAAAIGTRP--------EDK
D5GG57_TUBMM          DQAGN---LTALLSRSDLMKNLHFPLAS---KRPYSKQLLCAAAIGTRE--------DDK
IMDH_CANAL            DAEGN---LVSLISRTDLQKNQDYPNAS---KSFHSKQLLCGAAIGTID--------ADR
IMDH_CANAX            DAEGN---LVSLISRTDLQKNQDYPNAS---KSFHSKQLLCGAAIGTID--------ADR
C4YIV3_CANAW          DAEGN---LVSLISRTDLQKNQDYPNAS---KSFHSKQLLCGAAIGTID--------ADR
IMDH3_YEAST           DDNGN---LVSMLSRTDLMKNQNYPLAS---KSATTKQLLCGAAIGTID--------ADK
IMDH2_YEAST           DEKGN---LVSMLSRTDLMKNQNYPLAS---KSANTKQLLCGASIGTMD--------ADK
IMDH4_YEAST           DDNGN---LVSMLSRADLMKNQNYPLAS---KSATTKQLLCGAAIGTIE--------ADK
Q6C897_YARLI          DKEGN---LVALLSLTDLQKNHDYPNSS---KSPETKQLLCGAAIGTRP--------DDR
A8NJG1_COPC7          DTQGR---LVSLLARSDLLKNQSYPLAS---KNPESKQLYAAAAIGTRP--------SDR
IMDH_CRYNJ            DSNGH---LVSLVARSDLLKNQNYPYAS---KVPESKQLYCGAAIGTRP--------GDK
IMDH_PNECA            DKEGN---LTALLSRSDLMKNLHFPLAS---KLPDSKQLICAAAVGTRP--------DDR
IMDH_SCHPO            DKDDN---LVALLSLTDLMKNLHFPLAS---KTSDTKQLMVAAAIGTRD--------DDR
IMDH_LEPIN            DSQGK---LVSLVSRSDLKKNKEFPDAS---K-DERKRLRCGAAVSTLL--------ESR
IMDH_DICDI            NDKGE---LVALASRDDLVKNRDFPMAT---KDHENKKLLVGAALGTRE--------TDK
D0N723_PHYIT          NAKGE---FVSLISRRDLVKNRDFPHAS---KDA-NKQLLVGAAIGTRP--------NDR
B8BZC2_THAPS          NDADE---LVALIARTDLLKNIEFSQAS---KDHVTKQLLVGAAIGTRL--------EDR
IMDH1_ARATH           R-DGE---TVNVVTKDDIQRVKGYPKSG-PGTVGPDGEWMVGAAIGTRE--------SDK
IMDH2_ARATH           K-EGE---TVNVVTKDDVERVKGYPKLG-SGTVGADKKWMVGAAIGTRE--------SDK
IMDH_VIGUN            R-DGE---VVDLVVREEVERVKGYPKLAAPATVGPDGEFMVGAAMGTRE--------DDK
C5WZ26_SORBI          SDDGE---VVDLITAKDVERIRSYPKLG-KPSLGADGKFVVAASIGTRE--------DDK
C5X9F2_SORBI          SDDGAGEVVVDLVTAQDVERIRSYPKLG-TPSLGADGRFVVAAAIGTRE--------EDK
A9RU40_PHYPA          TESGD---FVELLCRTDLKAYRELPPLG-APSVGPDGKILVGAAIGTRD--------SDK
A9TN21_PHYPA          SESGS---FVELLCRTDLKAYHALPPIG-APSLGSDDKILVGAAIGTRE--------SDK
Q4UCL4_THEAN          NEDYE---LMSIVTRSDFYKSKLYPYASK----DDNKQLLVGAAISTNNFANGFDRVNGL
Q4N0C9_THEPA          NENYE---LMSIVTRSDFYKNKLYPNASK----DDNKQLLVGAAISTRG--------NGL
A7AR77_BABBO          NASGE---LVSIVSRSDIKRNRRFPKASH----NENMQLLVGVAISTQP--------GSI
A0A113RHB4_PLABE      NDNYE---LIALVCRNDMHKNRIFPHASK----RENKQLIVGASISTRG--------SDL
Q7RIL8_PLAYO          NDNYE---LIALVCRNDMHKNRIFPHASK----RENKQLIVGASISTRE--------SDL
A0A384L7F5_PLAKH      NNNYE---LIALVCRNDMHKNKIFPHASK----SQNKQLIVGASISTRE--------HDL
A5K6S2_PLAVS          NSNYE---LIALVCRNDMHKNKIFPHASK----SQNKQLIVGASISTRE--------HDL
Q8I2U5_PLAF7          NKNNE---LIALVCRNDMHKNRIFPHASK----SQNKQLIVGASISTRE--------HDL
IMDH_HALSA            NDEQH---LVGLVTMQGILERREHGSAA----RDQNGRLRVGVAVGPFD----------T
Q2FS86_METHJ          DSEGI---LTGIISMQELLEKRQFPQAI----RDDNGNLRVAAAVGPFD----------H
IMDH_METJA            DDENR---LIGIITLRDILKRRKYPQAA----RDKKGRLLVAAACGPHD----------F
O26245_METTH          KD-GR---IVGMLTMKDILERKRYPNAS----RDSEGYLRVAAATGPFD----------L
IMDH_PYRFU            NEDGK---LVGLITMSDLVARKKYKNAV----RNEKGELLVAAAVSPFD----------L
IMDH_PYRHO            DERGK---LVGLITMSDLVARKKYKNAV----RDENGELLVAAAVSPFD----------I
Q5JFM0_THEKO          DGEGR---LVGIITMSDLAKRRKYRNAV----RDENGDLLVAAAVGPFD----------L
Q8TV01_METKA          DDEGR---LLGIVTAKDVTELREETEAA----TDEERRYLAAAAVGPKD----------P
IMDH_THEAC            DSSGH---LVGLITAKDIITRQKFPDAS----RDSEGQLMVGAAVGPFD----------L
A0QSU3_MYCS2          DGHGK---LTGLITVKDFVKTEQFPLST----KDSDGRLLVGAAVGVGDD--------AW
IMDH_MYCTU            DGRGR---LTGLITVKDFVKTEQHPLAT----KDSDGRLLVGAAVGVGGD--------AW
Q8NSR5_CORGL          AKDGK---LVGLITVKDFVKTEQHPNAS----KDASGRLLVAAGIGTGEE--------SF
Q9L0I7_STRCO          DGDGI---LKGLITVKDFVKAEQYPHAA----KDAKGRLLVGAAVGASPE--------AL
IMDH_BIFLO            DEEGH---LTGLITVKDFVKTEQYPDAT----KDEQGRLRVAAGVGFLGD--------AW
Q7VVM3_BORPE          NDAFE---LRGLATVKDIVKNTEHPYAC----KDSQGQLRVGAAVGVGAG--------TE
Q63T40_BURPS          NDAFE---LRGLMTVKDITKQTEHPEAC----KDEHGKLRVGAAVGVGAD--------NE
Q5F8H4_NEIG1          NEKDE---LKGLITIKDILKTTEFPNAN----KDSEGRLRVGAAVGTGGD--------TD
Q9JZB5_NEIMB          NEKDE---LKGLITVKDILKTTEFPNAN----KDSEGRLRVGAAVGTGGD--------TE
Q9HXM5_PSEAE          DENFY---LRGLVTFRDIEKAKTYPLAS----KDEQGRLRVGAAVGTGAD--------TG
Q83BZ5_COXBU          NDRFE---LRGLITVKDILRSERNPNAC----KTKSGQLRVGAAVGTGGE--------TP
Q8P8Q5_XANCP          NDSFE---LRGLITVKDIQKKTDNPNAA----KDGAKRLLVGAAVGVGGD--------TE
Q5NFC2_FRATT          NEQGE---LVGLITTKDIERSQNKPNAC----KDSLGRLRVGAAVGTAAN--------TK
IMDH_ECOLI            DDEFH---LIGMITVKDFQKAERKPNAC----KDEQGRLRVGAAVGAGAG--------NE
Q32D54_SHIDS          DDEFH---LIGMITVKDFQKAERKPNAC----KDEQGRLRVGAAVGAGAG--------NE
Q8ZN59_SALTY          DDNFH---LLGMITVKDFQKAERKPNSC----KDEQGRLRVGAAVGAGAG--------NE
IMDH_YERPE            DDSFH---LRGMITVKDFQKAERKPNAC----KDEHGRLRVGAAVGAGAG--------NE
IMDH_HAEIN            NDSFK---LKGMITVKDFQKAEQKPNAC----KDEFGRLRVGAAVGAGAG--------NE
Q9KTW3_VIBCH          NDEFQ---LKGMITAKDFHKAESKPNAC----KDEQGRLRVGAAVGAAPG--------NE
Q5E764_ALIF1          NDEFQ---LTGMITAKDFHKAERKPNAC----KDERGRLRVGAAVGAGAG--------NE
Q8EC51_SHEON          DDNFK---LKGLITVKDFEKAERKPNAC----KDELGRLRVGAAVGAGAG--------NE
Q89N70_BRADU          DEQYR---CVGLVTVKDMEKAVAHPLAC----KDAQGRLRVAAATTVGDT--------GF
Q9A7V2_CAUVC          DEAYR---AVGLITVKDIEKAQAHPLAA----KDDKGRLLVGAASTVGDA--------GF
Q2RXU6_RHORT          DESYR---CIGLITVKDMEKAQTYPNAC----KDEKGRLRVAAATGVGAD--------GL
Q3J2F5_RHOS4          DGQGK---LTGLLTLKDTEKSVLNPNAC----KDELGRLRVAAASTVGEA--------GF
IMDH_CHLTE            DDNGY---LKGLITFKDIQKRKQCPDAC----KDSQGRLRAGAAVGIRAN--------TM
A0A4Y7QN78_9BACI      DNNGV---LQGLITIKDIEKVIEFPNSA----KDKQGRLLVGAAVGVTAD--------AM
Q81JC8_BACCR          DNNGV---LQGLITIKDIEKVIEFPNSA----KDKQGRLLVGAAVGVTAD--------AM
IMDH_BACSU            DDQNK---LKGLITIKDIEKVIEFPNSS----KDIHGRLIVGAAVGVTGD--------TM
Q926Y9_LISMO          DEAGI---LKGLITIKDIEKVIEFPNSA----KDKHGRLLAAAAVGITND--------TF
IMDH_STAA8            KD-GR---LEGLITIKDIEKVIEFPNAA----KDEHGRLLVAAAIGISKD--------TD
Q8DMX2_STRR6          DEEGS---LSGLITIKDIEKVIEFPNAA----KDEFGRLLVAGAVGVTSD--------TF
IMDH_STRPY            DNSGR---LSGLITIKDIEKVIEFPHAA----KDEFGRLLVAAAVGVTSD--------TF
Q9CIY6_LACLA          DEAGK---LAGLITIKDIERVIEFPNAA----KDEQGRLLVAGAVGVSSD--------TF
Q82YY8_ENTFA          DEAGR---LSGLITIKDIEKVIEFPNAA----KDEHGRLLVAAAVGVTSD--------TF
Q97FM8_CLOAB          DENFV---LKGLITIKDIEKIRKFPNAA----KDSQGRLLCGAGVGVTKD--------MM
A5I721_CLOBH          DKDNN---LRGLITIKDIEKVKKFPNSA----KDYRGRLLCGAAVGVTKD--------MM
Q8RE86_FUSNN          DQNGY---LKGLITIKDIDNIIQYPNAC----KDELGKLRCGAAVGVAPD--------TI
Q2RJG7_MOOTA          DADYN---LKGLITIKDIEKTRRYPQAA----KDERGRLRVAAAVGTSAD--------TM
D1B5E0_THEAS          DGEGK---LKGLITIKDIQKAKEFPNAA----KDEHGRLRVGAAIGVGSD--------SL
Q8A126_BACTN          GMDGK---LIGLVTYKDITKAKDKPMAC----KDAKGRLRVAAGVGVTAD--------TL
A6H0L3_FLAPJ          NHKNE---LVGLITFRDITKLTQKPNAN----KDKFGRLRVAAALGVTAD--------AV
Q2S2G2_SALRD          DEEGY---LKGLITFKDIRKRRKHPNAC----KDEHGRLRVGAAVGVTPD--------VM
Q72D85_DESVH          DGNNR---LQGLITMKDIDKVVKYPNAC----KDENGRLRVGAAIGIGRD--------CE
Q1IS88_KORVE          DDRYE---LKGLITVKDIQKKLKYPNAA----KDPQGRLRVGAAIGATGD--------FL
Q74B47_GEOSL          DEEKN---LKGLITIKDIEKVRKYPNAC----KDALGRLRVGAAVGPSGD--------ME
Q9RT87_DEIRA          TEGEY---LRGLITIKDIEKSVKYPNAA----KDDLGRLRVAAAIGVSAD--------LM
Q5SL61_THET8          DESGR---LKGLITLKDIVKRRQYPNAV----KDAQGRLLVGAAVGASKD--------LP
A9WEU7_CHLAA          DERGK---LSGMITVKDIMKRIEYPHAC----KDDMGRLRVGAAVGVSGD--------YI
IMDH_AQUAE            DKEGK---IKGLITIKDIVKRKKYPNAC----KDELGRLRVGAAVGTGEE--------TL
Q9X168_THEMA          SKDNK---LVGLITIKDIMSVIEHPNAA----RDEKGRLLVGAAVGTSPE--------TM
B8DZU8_DICTD          DKDFK---LKGLITIKDIQKMRQYPNAA----KDKKGRLLAGAAIGVGDE--------AI
B5YHZ0_THEYD          DEDFN---LKGLITIKDIEKRRKYPNAC----KDHLGRLRVAAAVGVGEP--------AI
Q0P9J4_CAMJE          DEQGR---LEGLITIKDLKKRKEYPDAN----KDNFGRLRVGAAIGVGQ----------M
IMDH_HELPY            DKDNV---LKGLITIKDIQKRIEYPEAN----KDDFGRLRVGAAIGVGQ----------L
IMDH_RHOBA            DEERK---LTGLITIRDIDMMKRYPRAC----KDPQGRLRVGAAIGVGD----------Y
IMDH_TRIFO            DDDQH---LRYIVFRKDYDRSQVCHNEL----VDSQKRYLVGAGINTRDF---------R
                                 :                             .                  

A8X1T4_CAEBR          YTVDCIVEAGADVLIIDSSNGSSTYQISMLRYIKEKH--PHVQVIAGNVVTRAQAKLLID
IMDH_CAEEL            YTVDRVVEAGVDVLIIDSSNGSSTYQISMLRYIKEKH--PHVQVIAGNVVTRAQAKLLID
IMDH_LEIDO            RRVAALADVGVDVLVLDSSQGNTIYQIAFIKWVKSTY--PHLEVVAGNVVTQDQAKNLID
A4HYI5_LEIIN          RRVAALADVGVDVLVLDSSQGNTIYQIAFIKWVKSTY--PHLEVVAGNVVTQDQAKNLID
Q4QD53_LEIMA          RRVAALADVGVDVLVLDSSQGNTIYQIAFIKWVKSTY--PHLEVVAGNVVTQDQAKNLID
A4HAA5_LEIBR          RRVAALAEVGVDVLVLDSSQGNTIYQIAFIKWIKSTY--PHLEVVAGNVVTQDQAKNLID
K2NRC9_TRYCR          ARVAALAGAGVDVLLLDSSQGNTIYQVSFIKWVKKTF--PHLEVVAGNVVTQDQAKNLID
IMDH1_MOUSE           YRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKY--PHLQVIGGNVVTAAQAKNLID
IMDH1_RAT             YRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKY--PHLQVIGGNVVTAAQAKNLID
IMDH1_BOVIN           YRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKY--PHLQVIGGNVVTAAQAKNLID
IMDH1_HUMAN           YRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKY--PHLQVIGGNVVTAAQAKNLID
IMDH3_DANRE           YRLDLLTQSGVDMVVLDSSQGNSVYQINMIHYIKQKY--PELQVVGGNVVTAAQAKNLID
IMDH1_DANRE           YRLDLLMQAGVDVIVLDSSQGNSVFQISMINYIKQKY--PELQVVGGNVVTAAQAKNLID
IMDH1_XENTR           YRLDLLTQAGVDVVVLDSSQGNSVYQINMIHYIKQKY--PELQVVGGNVVTAAQAKNLID
IMDH2_HUMAN           YRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKY--PNLQVIGGNVVTAAQAKNLID
IMDH2_MOUSE           YRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKY--PSLQVIGGNVVTAAQAKNLID
IMDH2_RAT             YRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKY--PNLQVIGGNVVTAAQAKNLID
IMDH2_BOVIN           YRLDLLSQAGVDVVVLDSSQGNSIFQINMIKYIKEKY--PSIQVIGGNVVTAAQAKNLID
Q5F4A4_CHICK          YRLDLLVQAGVDAVVLDSSQGNSIFQINMIKYIKEKY--PNLQVIGGNVVTAAQAKNLID
IMDH2_XENTR           YRLDLLVQAGVDAVVLDSSQGNSIFQINMIKFIKEKY--QDLQVIAGNVVTAAQAKNLID
IMDH2_DANRE           YRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKEKY--PNVQVIGGNVVTAAQAKNLID
A7RG06_NEMVE          ARLHALVEAGVDVVVIDSSQGNSIYQLSLISHIKENY--PNLQIVGGNVVTASQAKNLID
A7REY1_NEMVE          LRVEALIHAGVDVIILDSSQGNSAYQIDMIKNIKELC--PRLQVVAGNVVTACQAKNLID
A9VB34_MONBE          ERLRLLVEAGVDVVVLDSSQGNSVFQIGMIRFIKDNF--PQVDVIAGNVVTAAQAKNLID
Q16WB3_AEDAE          ERLELLVQNGVDVVVLDSSQGNSSFQINMIKYIKQKY--PDLQVIAGNVVTRQQAKTLID
W5JN05_ANODA          ERLELLHQNGVDVIVLDSSQGNSIYQIDMIKYIKQKY--PSLQVIAGNVVTRQQAFNLIQ
IMDH_DROME            ARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETY--PELQVIGGNVVTRAQAKNLID
Q29IQ0_DROPS          ARLQLLVANGVDVIILDSSQGNSIYQVEMIKFIKETY--PDLQVIGGNVVTRAQAKNLIE
E0VEZ4_PEDHC          YRLKGLIQAGVDAVVLDSSQGNSVYQIKMIHEIKKAY--PNLQVVGGNVVTAAQAKSLID
E0VCU3_PEDHC          VRLKLLVQAGVDVVVLDSSQGNSIYQLDMIKYIKNEY--PELQVIGGNVVTAAQAKNLID
C0NBC7_AJECG          ERLQKLVEAGLDIVILDSSQGNSIYQIEMIKYVKETY--PELDVIAGNVVTRDQAAALIA
IMDH_ASPFU            HRLKLLVEAGLDIVVLDSSQGNSIYQIEMIKWVKKTF--PEIDVIAGNVVTREQAAALIA
Q0V6E3_PHANO          IRLQKLVDAGLDIVILDSSQGNSMYQVDMIKYIKEKY--PQLDVIGGNVVTRDQAAALIA
I1RBE4_GIBZE          LRLKKLVEAGLDIVILDSSQGNSMYQIEMIKWVKKEF--PDVDVIGGNVVTREQAASLIA
C7YID4_NECH7          LRLQKLVDAGLDIVILDSSQGNSMYQIEMIKWIKNEF--PGLDVIGGNVVTREQAASLIA
IMDH_NEUCR            DRLAKLVDAGLDIVILDSSQGNSMYQIEMIKWIKKEF--PDLDVIGGNVVTREQAAALIA
A7F2A7_SCLS1          IRLQKLVDAQLDIVILDSSQGNSMYQIEMVKYIKEKY--PDLDVIGGNVVTREQAASLIA
D5GG57_TUBMM          ARLKKLVEAGLDIVILDSSQGNSMYQVSMIKWIKQEF--PGIDVIAGNVVTREQAANLIA
IMDH_CANAL            ERLDKLVEAGLDVVVLDSSNGSSVFQLNMIKWIKEKY--PELQVIAGNVVTREQAALLIE
IMDH_CANAX            ERLDKLVEAGLDVVVLDSSNGSSVFQLNMIKWIKEKY--PELQVIAGNVVTREQAALLIE
C4YIV3_CANAW          ERLDKLVEAGLDVVVLDSSNGSSVFQLNMIKWIKEKY--PELQVIAGNVVTREQAALLIE
IMDH3_YEAST           ERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETF--PDLEIIAGNVATREQAANLIA
IMDH2_YEAST           ERLRLLVKAGLDVVILDSSQGNSIFELNMLKWVKESF--PGLEVIAGNVVTREQAANLIA
IMDH4_YEAST           ERLRLLVEAGLDVVILDSSQGNSVFQLNMIKWIKETF--PDLEIIAGNVATREQAANLIA
Q6C897_YARLI          ERLEKLVAAGLDVVILDSSQGNSIFQIEMIQWIKKTF--PDLQVVAGNVVTREQAASLIE
A8NJG1_COPC7          DRLALLVEAGLDIVILDSSQGNSIYQIEMIHWIKETY--PRLEVIAGNVVTREQAAALIV
IMDH_CRYNJ            DRLKLLAEAGLDVVVLDSSQGDSVYQIEFIKWIKQTY--PKIEIIAGNVVTREQAAQLIA
IMDH_PNECA            IRLKHLVEAGLDIVVLDSSQGNSIYQINMIKWIKKEF--PNLEVIAGNVVTREQAANLIS
IMDH_SCHPO            TRLALLAEAGLDAVVIDSSQGNSCFQIEMIKWIKKTY--PKIDVIAGNVVTREQTASLIA
IMDH_LEPIN            DRVAALYEAGVDVIIIDSAQGNSNYQIEMIQFIKKEF--KNLDIVAGNVVTRAQAENLIR
IMDH_DICDI            ERLAALSDAGVDVVILDSSQGDSTYQREMIRFIKRNY--PKIDVIGGNVVTTSQCESLIQ
D0N723_PHYIT          ERCTELVKAGVNLIVIDSSQGDSTFQVDLIKWIKVTY--PQIDVIGGNVVTRMQCKRLID
B8BZC2_THAPS          DRAAALVEAGVDVIVVDSSQGDSLYQLDIVKHLKASH--PKLQVIAGNIVTPLQAIHLIQ
IMDH1_ARATH           ERLEHLVNVGVNAVVLDSSQGNSIYQLEMIKYVKKTY--PELDVIGGNVVTMYQAQNLIQ
IMDH2_ARATH           ERLEHLVKAGANVVVLDSSQGNSIYQLEMIKYVKNTY--PELDVVGGNVVTMYQAENLIK
IMDH_VIGUN            ERLKHLVKAGVNVVVLDSSQGNSIYQLEMVKYVKSVY--PELDVIGGNVVTMYQAENLIQ
C5WZ26_SORBI          GRLEQLVKAGANAIVIDSSQGNSIYQLDMIKFAKKMY--PEVDLIGGNVVTIAQAQNLIQ
C5X9F2_SORBI          RRLEMLVKEGANAIVIDSSQGNSVYQLDMIKYAKRMY--PEVDLIGGNVVTVAQAQNLIA
A9RU40_PHYPA          ERLKLLVDAGVNVVILDSSQGDSMYQRQMIEFIKRAY--PELDVIGGNVVTAYQAKNLID
A9TN21_PHYPA          DRLKLLVEAGVNVVILDSSQGDSMYQRQMIEYIKKSH--AGLDVIGGNVVTAYQAKNLIE
Q4UCL4_THEAN          EVAKKLIDAKVDVILVDSSQGNSVFQIDLIKQLKSAY--PNVQIIGGNVVSAQQAKNVLE
Q4N0C9_THEPA          DTAKKLIDAKVDILVVDSSQGNSVFQIDLIKQLKSVY--PDFQVMAGNVVTAQQAKNLLE
A7AR77_BABBO          EKAKKLMDAGADVLVIDSSQGNSVYQIDLIKQLRQSY--PNVQIIGGNVVTGSQAKNLID
A0A113RHB4_PLABE      EKVNKLVQNMIDIICIDSSQGNSIYQIDMIKKIKSAY--PDIPIIAGNVVTSNQAKNLID
Q7RIL8_PLAYO          EKVNKLAQNMIDIICIDSSQGNSIYQIDMIKKIKSAY--PDMPIIAGNVVTSNQAKNLID
A0A384L7F5_PLAKH      ERADQLIKNMIDIICIDSSQGNSIYQIDTIKKIKGAH--PHIPIIAGNVVTCDQAKNLID
A5K6S2_PLAVS          ERANQLIKNMIDIICIDSSQGNSIYQIDTIKKIKGAH--PDIPIIGGNVVTCDQAKNLID
Q8I2U5_PLAF7          ERANQLIKNMIDVICIDSSQGNSIYQIDTIKKIKSAH--PDIPIIGGNVVTSQQAKNLID
IMDH_HALSA            ERATAVDEAGADVLFIDCAHAHNLNVIDSAREIKASVDA---DVVVGNVGTREAAEAVVD
Q2FS86_METHJ          ARAMLLVEAGVDAIVVDCAHGHNLNVVRSVRDIKGSVQV---DVVAGNIATKQAAEALVD
IMDH_METJA            ERAKALIEAEVDAIAIDCAHAHNMRVVENVKKFKEMLEGTDIKLIVGNIATKEAAEDLIK
O26245_METTH          ERARALDEAGADVLAIDSAHGHNMNLVKSAGAMKKEIEA---DLIVGNIATREAAEDLIA
IMDH_PYRFU            RRAIELDRAGVDVIVVDTAHAHNLKAIKAMKEMRQKVSA---DFIVGNIANPKAVDDLTF
IMDH_PYRHO            KRAIELDKAGVDVIVVDTAHAHNLKAIKSMKEMRQKVDA---DFIVGNIANPKAVDDLTF
Q5JFM0_THEKO          ERAKALDNAGADVIVVDTAHAHNLKAIKAMKEIRNAVDA---DLIVGNIANPKAVDDLTF
Q8TV01_METKA          DRAIALDEAGADILVVDCAHAHTETVINFVKEIKREVDA---DIIAGNIATAEAAEDLIA
IMDH_THEAC            DRAVEVEKAGADFIVVDTAHADNENVLSSLKKMRKQISV---DIVAGNIATAQAAEDLIS
A0QSU3_MYCS2          TRAMTLVDAGVDVLIVDTAHAHNRGVLDMVSRLKQAVG-ERVDVVGGNVATRAAAAALVE
IMDH_MYCTU            VRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVG-DRVEVVGGNVATRSAAAALVD
Q8NSR5_CORGL          QRAGALADAGVDILVVDSAHAHSRGVLDMVSRVKKSF--PKVDIVGGNLATREAAQAMIE
Q9L0I7_STRCO          DRAQALAEAGVDFLVVDTSHGHNSNALSWMSKIKSSV---GIDVVGGNVATRDGAQALID
IMDH_BIFLO            QRASALMEAGVDVLVVDTANGEARLALDMISRLKHDSAFDGVQIIGGNVGTRSGAQAMIE
Q7VVM3_BORPE          ERVEKLVAAGVDVIIVDTAHGHSAGVLERVRWVKQNY--PKVEVIGGNIATAAAARALVE
Q63T40_BURPS          ERVELLVQAGVDVIVVDTAHGHSKGVLERVRWVKQNF--PKVEVIGGNIATAAAAKALVE
Q5F8H4_NEIG1          ERVKALVEAGADVIVVDTAHGHSQGVIDRVRWVKETY--PHIQVIGGNIATAKAALDLVT
Q9JZB5_NEIMB          ERVKALVEAGVDVIVVDTAHGHSQGVIDRVRWVKETY--PHIQVIGGNIATAKAALDLVA
Q9HXM5_PSEAE          ERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTF--PDVQVIGGNIATAEAAKALAE
Q83BZ5_COXBU          DRVTALAAGGVDVIVVDTAHGHSKGVIEQVKWIKKNY--PHIPVIAGNIATASAARALAD
Q8P8Q5_XANCP          QRIELLAAAGVDVVIVDTAHGHSQGVIDRVAWVKKTY--PHLQVIGGNIVTGDAALALMD
Q5NFC2_FRATT          ERVAALAAEGVDIIVVDTAHGHSQGVLDTVKWVKENY--PHIQVIGGNIATAEAAKDLVK
IMDH_ECOLI            ERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKY--PDLQIIGGNVATAAGARALAE
Q32D54_SHIDS          ERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKY--PDLQIIGGNVATAAGARALAE
Q8ZN59_SALTY          ERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKY--PDLQIIGGNVATGAGARALAE
IMDH_YERPE            ERIDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKY--PNLQIVGGNVATGAGAKALAD
IMDH_HAEIN            ERIDALVKAGVDVLLIDSSHGHSEGVLQRVRETRAKY--PNLPIVAGNVATAEGAIALAD
Q9KTW3_VIBCH          ERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAY--PHLEIIGGNVATAEGARALIE
Q5E764_ALIF1          ERVKALVEAGVDVLLIDSSHGHSEGVLNRIRETRAAY--PDLDIIGGNVATAAGAKALIE
Q8EC51_SHEON          ERVDALVKAGVDVLLIDSSHGHSEGVLQRIRETRAKH--PDLQIIGGNVATAEGALALVE
Q89N70_BRADU          ERTERLIDAGVDLVVVDTAHGHSRHVLHAVNRIKRLS--NSVQVVAGNVATSEGAQALID
Q9A7V2_CAUVC          ERSMALVDAGVDVVVIDTAHGHSSQVAAAVTRLKREA--NRVQIVAGNIATYDAARALID
Q2RXU6_RHORT          ARAEALLDAGVDVVVVDTAHGHSRGVLDAVTAVKKIS--NYTQVIAGNVATPDGAKALID
Q3J2F5_RHOS4          ERSQALIEAGVDMVVIDTAHGHSEGVSLAVERIKAFS--NSVQVVAGNVATAEATRALIG
IMDH_CHLTE            SRVDALVAAGVDVVAVDTAHGHSQAVLDMVATIKQKY--PELQVIAGNVATPEAVRDLVK
A0A4Y7QN78_9BACI      TRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKY--PSLNIIAGNVATAEATKALIE
Q81JC8_BACCR          LRIDALVKASVDAIVLDTAHGHSKGVIDKVKEVRAKY--PSLNIIAGNVATAEATKALIE
IMDH_BACSU            TRVKKLVEANVDVIVIDTAHGHSQGVLNTVTKIRETY--PELNIIAGNVATAEATRALIE
Q926Y9_LISMO          VRVEKLIEAGVDAIVIDTAHGHSAGVINKISEIRQTF--KDVVIVAGNVATAEGARALFE
IMDH_STAA8            IRAQKLVEAGVDVLVIDTAHGHSKGVIDQVKHIKKTY--PEITLVAGNVATAEATKDLFE
Q8DMX2_STRR6          ERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHF--PDRTLIAGNIATAEGARALYE
IMDH_STRPY            ERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIRAHF--PNRTLIAGNIATAEGARALYD
Q9CIY6_LACLA          ERAEALFAAGADAIVIDTAHGHSAGVLRKIREIRNHF--PDRTLIAGNIATGEGARALFE
Q82YY8_ENTFA          ERAEALLEAGADAIVIDTAHGHSAGVIRKIKEIRETF--PEATLIAGNVATAEATKALYD
Q97FM8_CLOAB          DRVKALVDASVDVIVLDTAHGHSQGVLEAVKTIKKAY--PELQVIAGNVATAAAVHDLIE
A5I721_CLOBH          ERVDALVKAQVDIITVDTAHGHSKGVIEGVKKIKEKY--PDIQIIAGNVATAEATRDLIN
Q8RE86_FUSNN          ERVSALVKAGVDIITVDSAHGHSQGVINMIKEIKKNF--PDLDIVGGNIVTAEAAKELIE
Q2RJG7_MOOTA          TRVEALVAAGVDAIVVDTAHGQSRSVIETVKRIKAAF--PAVELVAGNVATYDGARALAE
D1B5E0_THEAS          ARAEALVKAGVDLIVVDTAHGHSVAVLNTVRELRSRY--PELQIVGGNIATGEAARDLID
Q8A126_BACTN          DRMQALVDAGADAIVIDTAHGHSMYVIEKLKEAKKRF--PNIDIVVGNIATGEAAKALAE
A6H0L3_FLAPJ          ERATALVNAGVDAVIIDTAHGHTKGVVDVLKLVKAKF--PDLDVIVGNIATPEAALYLVE
Q2S2G2_SALRD          DRVAALVEVGVDFVVVDTAHGHAEGVLETVRQVAARFE-SEVEIVAGNVGTADGARALID
Q72D85_DESVH          ERASELIAAGVDVLVLDSAHGHSRNVLRAIEMVKTSFP--QCQLIAGNVATYEGAKAILK
Q1IS88_KORVE          ERAAELIRAKVDVLAIDSAHGHSTRVLEAITAVKNKFP--EVDLLAGNVGTYEGALEVGQ
Q74B47_GEOSL          ARVDALVKAGVDVIVVDTAHGHSQGVLDAIRTVKANFP--GVELIAGNIATAEAAEALIK
Q9RT87_DEIRA          DRAGALVQAGADVLVLDSAHGHSQGILNALSRVKEQFD---VDVIAGNVATRSGARDLIL
Q5SL61_THET8          ERAQALVEAGVDVLVLDSAHGHSKGILEALAYLKETFG-ERVEVIAGNVATREGARALAE
A9WEU7_CHLAA          ERATELVRAGVDVLVIDTAHGHSRGVLNAVVKLRELFP--RVQIIGGNVSTAAATIALIE
IMDH_AQUAE            DRVAALVEAGVDVIVVDTAHGHSKRVLETVEKIKANFP--EVDVIAGNVATAEGTKALIE
Q9X168_THEMA          ERVEKLVKAGVDVIVIDTAHGHSRRVIETLEMIKADYP--DLPVVAGNVATPEGTEALIK
B8DZU8_DICTD          RRAKALVEAEVDVIVIDTAHGHHKKVLETVKELKKLFS-KEVVIVAGNVATAEGTKALID
B5YHZ0_THEYD          YRAELLVKAGVDAIVIDTAHGHSKGVIETLKELKRRF---DIDIVAGNIATQEAAEELIE
Q0P9J4_CAMJE          DRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKA-KY-PNLDLIAGNIATAAAAKALCE
IMDH_HELPY            DRAEMLVKAGVDALVLDSAHGHSANILHTLEEIK--KS-LVVDVIVGNVVTKEATSDLIS
IMDH_RHOBA            ERAESLIGKGVDVLVVDSAHGHSRNVIETVREIKQNKS-WDIDVVAGNVATAEGAADLIA
IMDH_TRIFO            ERVPALVEAGADVLCIDSSDGFSEWQKITIGWIREKYG-DKVKVGAGNIVDGEGFRYLAD
                           :     : : :* :..                      .  **:        :  

A8X1T4_CAEBR          QGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYAN------QRGIPVVADGGIRD
IMDH_CAEEL            QGADGLRIGMGSGSICITQDVMAVGRAQGTAVYDVARYAN------QRGIPIVADGGIRD
IMDH_LEIDO            AGADGIRIGMGSGSICITQEVLACGRPQGTAVYKVAQYCA------SRGVPCTADGGLRQ
A4HYI5_LEIIN          AGADGIRIGMGSGSICITQEVLACGRPQGTAVYKVAQYCA------SRGVPCTADGGLRQ
Q4QD53_LEIMA          AGADGIRIGMGSGSICITQEVLACGRPQGTAVYKVAQYCA------SRGVPCTADGGLRQ
A4HAA5_LEIBR          AGADGIRIGMGSGSICITQEVLACGRPQGTAVFKVAQYCA------SRGVPCTADGGLRQ
K2NRC9_TRYCR          AGADAIRIGMGSGSICITQEVLACGRPQATAVYKVCRYAA------SRGVPCIADGGLRS
IMDH1_MOUSE           AGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYAR------RFGVPVIADGGIQT
IMDH1_RAT             AGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYAR------RFGVPVIADGGIQT
IMDH1_BOVIN           AGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYAR------RFGVPVIADGGIQT
IMDH1_HUMAN           AGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYAR------RFGVPIIADGGIQT
IMDH3_DANRE           AGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYAR------RFGVPVIADGGIQT
IMDH1_DANRE           AGVDALRVGMGCGSICITQEVMACGRPQGTSVYKVAEYAR------RFGVPVIADGGIQT
IMDH1_XENTR           AGVDALRVGMGCGSICITQEVMACGRPQGTAVYKVAEYAR------RFGVPVIADGGIQT
IMDH2_HUMAN           AGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQN
IMDH2_MOUSE           AGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQN
IMDH2_RAT             AGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQN
IMDH2_BOVIN           AGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQN
Q5F4A4_CHICK          AGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQT
IMDH2_XENTR           AGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQT
IMDH2_DANRE           AGADALRVGMGSGSICITQEVLACGRPQATAVYKVSEYAR------RFGVPVIADGGIQT
A7RG06_NEMVE          AGVDALRVGMGSGSICITQEVMAVGRPQGTAVYKVAEYAR------RFGVPVLADGGIQN
A7REY1_NEMVE          AGADALRVGMGSGSICITQEVMAVGRPQATAVFKVAEYAR------RFGIPVIADGGIRT
A9VB34_MONBE          AGADGLRIGMGSGSICITQEVMAVGRAQATAVYKVCEYAR------RFGIPCIADGGIKT
Q16WB3_AEDAE          AGCDALRVGMGSGSICITQEVMACGCPQATAVYQVSRIAR------EFGVPVIADGGIQS
W5JN05_ANODA          AGCDALRVGMGSGSICITQEVMACGCPQATAVYQVSNLAR------KYGVPVIADGGVQT
IMDH_DROME            AGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYAR------QFGVPVIADGGIQS
Q29IQ0_DROPS          AGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYAK------EFGVPVIADGGIQS
E0VEZ4_PEDHC          AGVDGLRVGMGSGSICITQEVMAVGRAQATAVHKVSEYAR------LYNVPVVADGGISS
E0VCU3_PEDHC          AGVDGLRVGMGSGSICITQEVMAVGRAQATAVFKVSNYAK------EFNVPVIADGGISS
C0NBC7_AJECG          AGADGLRIGMGSGSACITQEVMAVGRPQAAAVRSVSQFAA------RFGVPCIADGGIQN
IMDH_ASPFU            AGADGLRIGMGSGSACITQEVMAVGRPQAVAVRSVASFAA------RFGVPCIADGGIQN
Q0V6E3_PHANO          AGADGLRIGMGSGSACITQEVMAVGRPQATSVFNVTSFAK------RFGVPCIADGGIQN
I1RBE4_GIBZE          AGVDGLRIGMGSGSACITQEVMAVGRPQAAAVYSVSRFAA------RFGVPCIADGGIQN
C7YID4_NECH7          AGVDGLRIGMGSGSACITQEVMAVGRPQAAAVYSVSRFAA------RFGVPCIADGGVQN
IMDH_NEUCR            AGVDGLRIGMGSGSACITQEVMAVGRPQATAVYNVSSFAA------RFGVPCIADGGIQN
A7F2A7_SCLS1          AGVDGLRIGMGSGSACITQEVMAVGRPQAAAVYNVASFAA------RFGVPCMADGGIQN
D5GG57_TUBMM          AGADGLRIGMGSGSACITQEVMAVGRPQAAAVHSICEFAS------RFGVPCIADGGIQN
IMDH_CANAL            AGADALRIGMGSGSICITQEVMACGRPQGTAVYGVTEFAN------KFGVPCIADGGIGN
IMDH_CANAX            AGADALRIGMGSGSICITQEVMACGRPQGTAVYGVTEFAN------KFGVPCIADGGIGN
C4YIV3_CANAW          AGADALRIGMGSGSICITQEVMACGRPQGTAVYGVTEFAN------KFGVPCIADGGIGN
IMDH3_YEAST           AGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCEFAN------QFGIPCMADGGVQN
IMDH2_YEAST           AGADGLRIGMGTGSICITQEVMACGRPQGTAVYNVCEFAN------QFGVPCMADGGVQN
IMDH4_YEAST           AGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCQFAN------QFGVPCMADGGVQN
Q6C897_YARLI          AGADGLRIGMGSGSICITQEVMAVGRPQGTAVYSVTQFAN------QFGVPCIADGGVQN
A8NJG1_COPC7          AGADGLRVGMGSGSICITQEVMAVGRPQATAVYKVAEFAN------KFGVPVIADGGIGN
IMDH_CRYNJ            AGADGLRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFAS------RFGIPCIADGGIGN
IMDH_PNECA            AGADALRVGMGSGSICITQEIMAVGRPQATAVYAVSEFAS------KFGVPTIADGGIEN
IMDH_SCHPO            AGADGLRVGMGSGSACITQEVMACGRPQATAIAQVAEFAS------QFGIGVIADGGIQN
IMDH_LEPIN            AGADGLRIGMGPGSICITQDTMAVGRAQATAIYQTAKHSA------KYDVPVIADGGISN
IMDH_DICDI            AGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSS------QYNVPIIADGGIRT
D0N723_PHYIT          AGADGLKVGMGVGSICTTQEVCAVGRAQASAVYNTARYAR------QFGVPVIADGGIAS
B8BZC2_THAPS          AGADGLRVGMGIGSICTTQEVCAVGRAQASAVYHVAKFAR------KHGVPILADGGIKS
IMDH1_ARATH           AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVCSIAA------QSGIPVIADGGISN
IMDH2_ARATH           AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSTLAA------QHGVPVIADGGISN
IMDH_VIGUN            AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSIAY------KSGVPVIADGGISN
C5WZ26_SORBI          AGADGLRVGMGSGSICTTQEVCAVGRGQATAVYKVSSYAK------DHNVPVIADGGISN
C5X9F2_SORBI          AGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVGQYAK------DHGVPVIADGGISN
A9RU40_PHYPA          AGVDGLRVGMGSGSICTTQEVCAVGRGQGTAVYKTAAVAN------ALGVPVIADGGISN
A9TN21_PHYPA          AGVDGLRVGMGSGSICTTQEVCAVGRGQGTAVYKTAAVAN------ALGVPIIADGGISN
Q4UCL4_THEAN          AGCDSIKVGMGIGSICTTQNICGVGRGQATSVYYVSRYTFE----HWNGVPVIADGGIKT
Q4N0C9_THEPA          AGCDSIKVGMGIGSICTTQNICGVGRGQASAVYYVSRYAFE----HWNGIPIIADGGIKS
A7AR77_BABBO          AGVDALRVGMGSGSICSTQGVVGVGRPQATAVYHVAKYANE----YGNGCPIIADGGIRS
A0A113RHB4_PLABE      AGADVLRIGMGSGSICTTQDVCAVGRAQGTAVYHVSNYA------HTRNIKTIADGGIKN
Q7RIL8_PLAYO          AGADVLRIGMGSGSICTTQDVCAVGRAQGTAVYHVSNYA------HTRNIKTIADGGIKN
A0A384L7F5_PLAKH      AGADVLRIGMGSGSICTTQDVCAIGRAQGTAVYHVSNYA------HTRNIKTIADGGIKN
A5K6S2_PLAVS          AGADVLRIGMGSGSICTTQDVCAIGRAQGTAVYHVSNYA------HTRNIKTIADGGIKN
Q8I2U5_PLAF7          AGADVLRIGMGSGSICTTQDVCAVGRAQGTAVYHVSKYA------HTRNIKTIADGGIKN
IMDH_HALSA            F-ADGIKVGIGPGSICTTRVVTGSGMPQITAVSQVADVAA------PAGVPVIADGGIRY
Q2FS86_METHJ          S-VDGLKVGIGPGSICTTRVVAGVGVPQVTAIASVAEVAK------DADVPIIADGGIRF
IMDH_METJA            AGADVLKVGIGPGSICTTRVVAGVGVPQLTAVAEVADVAK------EHNVPIIADGGIRY
O26245_METTH          QDVDGLKVGIGPGSMCTTRIIAGVGVPQLTAIAEVADVAA------EYGVPVIADGGIRY
IMDH_PYRFU            A--DAVKVGIGPGSICTTRIVAGVGVPQITAIAMVADRAQ------EYGLYVIADGGIKY
IMDH_PYRHO            A--DAVKVGIGPGSICTTRIVAGVGVPQITAVAMVADRAQ------EYGLYVIADGGIRY
Q5JFM0_THEKO          A--DAVKVGIGPGSICTTRVVAGVGVPQITAIALVADKAQ------EYGLHVIADGGIRY
Q8TV01_METKA          AGADALKVGIGPGSICTTRIVAGVGVPQITAVAWVADVAE------EHDIPVIADGGIRY
IMDH_THEAC            CDVDGLRVGIGPGSICTTRIVAGVGVPQLTAISDVAEAAK------DSGIPVIADGGIRY
A0QSU3_MYCS2          AGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACK------PYGVPVIADGGLQY
IMDH_MYCTU            AGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACR------PAGVPVIADGGLQY
Q8NSR5_CORGL          AGADAIKVGIGPGSICTTRVVAGVGAPQITAIMEAAVPAH------KAGVPIIADGGMQF
Q9L0I7_STRCO          AGVDGIKVGVGPGSICTTRVVAGIGVPQVTAIYEASLAAR------AAGVPLIGDGGLQY
IMDH_BIFLO            AGADAVKVGIGPGSICTTRIVAGVGVPQLTAVYEAAQACR------AAGVPCIADGGIHY
Q7VVM3_BORPE          AGADGVKVGIGPGSICTTRIVAGVGVPQISAISDVAKALE------GTGVPLIADGGIRY
Q63T40_BURPS          YGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVSDALR------GTGVPCVADGGIRF
Q5F8H4_NEIG1          VGADAVKVGIGPGSICTTRIVAGVGVPQLTAIHNVAEALK------GTGVPLIADGGIRF
Q9JZB5_NEIMB          AGADAVKVGIGPGSICTTRIVAGVGVPQLTAIHNVAEALK------GTGVPLIADGGIRF
Q9HXM5_PSEAE          AGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALE------GTGVPLIADGGIRF
Q83BZ5_COXBU          AGVDAVKVGMGPGSICITRVVAGIGVPQITAINAVAAELK------KEDISIIADGGIRF
Q8P8Q5_XANCP          AGADAVKVGVGPGSICTTRVVAGVGVPQITAVDMVAEALQ-------DRIPLIADGGIRY
Q5NFC2_FRATT          AGADAVKVGIGPGSICTTRIVAGVGVPQITAIANVAEALK------GTGVPVIADGGIRY
IMDH_ECOLI            AGCSAVKVGIGPGSICTTRIVTGVGVPQITAVADAVEALE------GTGIPVIADGGIRF
Q32D54_SHIDS          AGCSAVKVGIGPGSICTTRIVTGVGVPQITAVADAVEALE------GTGIPVIADGGIRF
Q8ZN59_SALTY          AGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALE------GTGIPVIADGGIRF
IMDH_YERPE            AGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAVEALE------GTGIPVIADGGIRF
IMDH_HAEIN            AGASAVKVGIGPGSICTTRIVTGVGVPQITAIADAAAALK------DRGIPVIADGGIRF
Q9KTW3_VIBCH          AGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVAN------EYGIPVIADGGIRF
Q5E764_ALIF1          AGVSAVKVGIGPGSICTTRIVTGVGVPQVTAIADAASAAA------EYGIPVIADGGIRF
Q8EC51_SHEON          AGVNAVKVGIGPGSICTTRIVTGVGVPQITAVSDAAEAVK------GLGIPVIADGGVRF
Q89N70_BRADU          AGADCIKVGIGPGSICTTRIVAGVGVPQLTAIMDAVEAAK------KADIPVIADGGIKF
Q9A7V2_CAUVC          AGADAVKVGIGPGSICTTRIVAGVGVPQLTAIMEAVRAAK------ESNTPVIADGGIKY
Q2RXU6_RHORT          AGADAVKIGIGPGSICTTRIVAGVGVPQFSAITEVAEAVR------HTGVPIIADGGIKY
Q3J2F5_RHOS4          AGADAVKVGIGPGSICTTRIVAGVGVPQLTAIMDAAGAA--------GDVPVIADGGIKF
IMDH_CHLTE            AGADAVKVGIGPGSICTTRIVAGVGMPQLTAIMKCAEEAK------KTDIPLIADGGIKY
A0A4Y7QN78_9BACI      AGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEAR------KHGIPVIADGGIKY
Q81JC8_BACCR          AGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEAR------KHGIPVIADGGIKY
IMDH_BACSU            AGADVVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEAR------KHGKTIIADGGIKF
Q926Y9_LISMO          VGVDIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATVAR------EFGKTIIADGGIKY
IMDH_STAA8            AGADIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEAR------KHGKAIIADGGIKF
Q8DMX2_STRR6          AGVDVVKVGIGPGSICTTRVIAGVGVPQVTAIYDAAAVAR------EYGKTIIADGGIKY
IMDH_STRPY            AGVDVVKVGIGPGSICTTRVVAGVGVPQVTAIYDAAAVAR------EYGKTIIADGGIKY
Q9CIY6_LACLA          AGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDAANVAR------EFGKTIIADGGIKY
Q82YY8_ENTFA          VGVDVVKVGIGPGSICTTRVVAGVGVPQLTAIYDAASVAR------EYGKAIIADGGIKY
Q97FM8_CLOAB          AGADCVKVGIGPGSICTTRVVAGIGVPQLTAVMDCVEEAN------KYGVPIIADGGIKY
A5I721_CLOBH          AGADCIKIGIGPGSICTTRVVAGVGVPQLTAVMDCVEEAN------KYGISVVADGGIKY
Q8RE86_FUSNN          AGVAAVKVGIGPGSICTTRVVAGVGVPQLTAVNDVYEYCK------DKNIGVIADGGIKL
Q2RJG7_MOOTA          AGFDAVKVGVGPGSICTTRVIAGIGVPQITAVMECARAAA------EFGIPVIADGGIKY
D1B5E0_THEAS          AGADAVKVGIGPGSICTTRVVAGIGVPQVAAIMNVARVAH------QMGRMVIADGGIRY
Q8A126_BACTN          AGADAVKVGIGPGSICTTRVVAGVGVPQLSAVYDVAKALK------GTGVPLIADGGLRY
A6H0L3_FLAPJ          NGADAVKVGIGPGSICTTRVVAGVGFPQFSAVLEVAAALK------GTGVPVIADGGIRY
Q2S2G2_SALRD          AGVDCIKVGIGPGSICTTRVVAGVGVPQLTAIMECAEEAR------PDGVPVIADGGIKQ
Q72D85_DESVH          AGADAVKVGIGPGSICTTRIVAGVGVPQVTAIMEAVKAAN------EMDRCLIADGGIKF
Q1IS88_KORVE          AGADGVKVGIGPGSICTTRIVTGAGVPQITAVAEAYRALK------DKGIPVIADGGIKY
Q74B47_GEOSL          AGVDAIKVGIGPGSICTTRVVAGVGVPQISAIAQCAKVAR------KYDVPLIADGGVKY
Q9RT87_DEIRA          AGADAVKVGIGPGSICTTRVVTGVGVPQVTAIFEASAAAM------EAGIPVIADGGIKQ
Q5SL61_THET8          RGADAVKVGIGPGSICTTRVVTGVGVPQITAILEAVAGVK------DLDVPVIADGGIKY
A9WEU7_CHLAA          RGVDGVKVGQGPGSICTTRVVTGAGMPQITAIFDCARAAE------PYGIPIIADGGIKY
IMDH_AQUAE            AGADAVKVGVGPGSICTTRIVAGVGVPQLTAIMEAASAAR------EYDIPIIADGGIRY
Q9X168_THEMA          AGADAVKVGVGPGSICTTRVVAGVGVPQLTAVMECSEVAR------KYDVPIIADGGIRY
B8DZU8_DICTD          AGADVVKVGIGPGSICTTRVVAGIGVPQFSAIWECAKEAQ------KHNVPIIADGGIKF
B5YHZ0_THEYD          AGADAVKVGIGPGSICTTRIVAGAGVPQLTAIMNCYSVTS------KYNIPLIADGGIKY
Q0P9J4_CAMJE          AGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEAN------KFGVPVIADGGIKY
IMDH_HELPY            AGADAIKVGIGPGSICTTRIVAGVGMPQVSAIDNCVEVAS------KFDIPVIADGGIRY
IMDH_RHOBA            AGADAVKVGIGPGSICTTRVISGIGVPQVTAILSAVKVAQ------EKNIPVIADGGIRF
IMDH_TRIFO            AGADFIKIGIGGGSICITREQKGIGRGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVY
                           :::* * ** * *    . *  :  ::                     .***:  

A8X1T4_CAEBR          VGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGS-----LDAMEAH
IMDH_CAEEL            VGYITKAISLGASAVMMGGLLAATTEAPGEYFWGPGGVRVKKYRGMGS-----LDAMEAH
IMDH_LEIDO            VGDICKALAIGANCAMLGGMLSGTTETPGEYFF-KGGVRLKVYRGMGS-----LEAMSQG
A4HYI5_LEIIN          VGDICKALAIGANCAMLGGMLSGTTETPGEYFF-KGGVRLKVYRGMGS-----LEAMSQG
Q4QD53_LEIMA          VGDICKALAIGANCAMLGGMLSGTTETPGEYFF-KGGVRLKVYRGMGS-----LEAMSQG
A4HAA5_LEIBR          VGDICKALAIGANCAMLGGMLSGTTETPGEYFF-KGGVRLKVYRGMGS-----LEAMSQG
K2NRC9_TRYCR          VGDICKALAIGANTAMLGSMLAGTSETPGSYFF-KEGLRLKTYRGMGS-----LEAMSQG
IMDH1_MOUSE           VGHVVKALALGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKS
IMDH1_RAT             VGHVVKALALGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKS
IMDH1_BOVIN           VGHVVKALALGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKS
IMDH1_HUMAN           VGHVVKALALGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKS
IMDH3_DANRE           VGHVVKALSLGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKN
IMDH1_DANRE           VGHVVKALALGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKN
IMDH1_XENTR           VGHVVKALALGASTVMMGSLLAATTEAPGEYFF-SDGVRLKKYRGMGS-----LDAMEKN
IMDH2_HUMAN           VGHIAKALALGASTVMMGSLLAATTEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKH
IMDH2_MOUSE           VGHIAKALALGASTVMMGSLLAATTEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKH
IMDH2_RAT             VGHIAKALALGASTVMMGSLLAATTEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKH
IMDH2_BOVIN           VGHIAKALALGASTVMMGSLLAATTEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKH
Q5F4A4_CHICK          VGHIAKALALGASTVMMGSLLAATTEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKN
IMDH2_XENTR           VGHIAKALALGASTVMMGSLLAATTEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKN
IMDH2_DANRE           VGHIAKALALGASTVMMGSLLAATSEAPGEYFF-SDGIRLKKYRGMGS-----LDAMDKN
A7RG06_NEMVE          VGHITKALSLGASTVMMGSLLAGTSEAPGEYFF-ADGVRLKKYRGMGS-----LSAMEKN
A7REY1_NEMVE          VGHITKALSVGASTVMMGSLLAGTSEAPGEYYFSNDGVRLKKYRGMGS-----LDALE-N
A9VB34_MONBE          VGHITKALALGSSCVMMGSLLAGTSEAPGEYFF-QDGVRLKKYRGMGS-----LNAMEKD
Q16WB3_AEDAE          IGHIMKALSLGASSVMMGSLLAGTSEAPGEYFF-SDGVRLKKYRGMGS-----LEAMERK
W5JN05_ANODA          IGHIMKALSLGASAVMMGSLLAGTSEAPGEYYF-SDGVRLKKYRGMGS-----LEAMERK
IMDH_DROME            IGHIVKAIALGASAVMMGSLLAGTSEAPGEYFF-SDGVRLKKYRGMGS-----LEAMERG
Q29IQ0_DROPS          IGHIVKALALGASAVMMGSLLAGTSEAPGEYFF-SDGVRLKKYRGMGS-----LEAMERG
E0VEZ4_PEDHC          TGSIVKALSLGASSVMMGSLLAGTSEAPGEYFF-SDGVRLKKYRGMGS-----IEAMNTK
E0VCU3_PEDHC          IGHIVKALALGASSVMMGSLLAGTSEAPGGYFF-SGGVRLKKYRGMGS-----LEAMNKR
C0NBC7_AJECG          IGHIVKGLAMGATTVMMGGLLAGTTESPGSYFVSREGQLVKAYRGMGS-----IDAMEDK
IMDH_ASPFU            VGHIVKGLAMGASTVMMGGLLAGTTESPGEYFVSNEGQLVKAYRGMGS-----IAAMEDK
Q0V6E3_PHANO          VGHIVKGLAMGASSVMMGGLLAGTTESPGEYFVSRDGQLVKAYRGMGS-----IAAMEDK
I1RBE4_GIBZE          VGHIVKGLALGASTIMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGS-----IDAMQDK
C7YID4_NECH7          VGHIVKGLALGASTVMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGS-----IDAMQDK
IMDH_NEUCR            VGHIVKGLALGASTVMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGS-----IDAMQDK
A7F2A7_SCLS1          VGHIVKGLALGATTIMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGS-----IDAMQDK
D5GG57_TUBMM          VGHIVKGLALGASTVMMGGLLAGTTESPGKYFLSAEGKLVKAYRGMGS-----IDAMESM
IMDH_CANAL            IGHITKALALGASCVMMGGLLAGTAETPGDYFYR-DGKRLKTYRGMGS-----IDAMQ--
IMDH_CANAX            IGHITKALALGASCVMMGGLLAGTAETPGDYFYR-DGKRLKTYRGMGS-----IDAMQ--
C4YIV3_CANAW          IGHITKALALGASCVMMGGLLAGTAETPGDYFYR-DGKRLKTYRGMGS-----IDAMQ--
IMDH3_YEAST           IGHITKALALGSSTVMMGGMLAGTTESPGEYFYQ-DGKRLKAYRGMGS-----IDAMQ--
IMDH2_YEAST           IGHITKALALGSSTVMMGGMLAGTTESPGEYFYQ-DGKRLKAYRGMGS-----IDAMQ--
IMDH4_YEAST           IGHITKALALGSSTVMMGGMLAGTTESPGEYFYK-DGKRLKAYRGMGS-----IDAMQ--
Q6C897_YARLI          IGHITKAVALGASVVMMGGLLAGTLESPGQYFYR-DGQRLKSYRGMGS-----IEAME--
A8NJG1_COPC7          VGHIVKALALGAGAVMMGGLLAGTEEAPGEYFYH-EGKRVKAYRGMGS-----LEAMEQG
IMDH_CRYNJ            IGHIAKALALGASAVMMGGLLAGTTESPGEYFYH-EGKRVKVYRGMGS-----IEAMEHT
IMDH_PNECA            IGHITKALALGASAVMMGNLLAGTTESPGQYYYR-DGQRLKSYRGMGS-----IDAMEHL
IMDH_SCHPO            VGHMVKSLSLGATAVMMGGLLAGTTESPGEYYVR-EGQRYKSYRGMGS-----IAAME--
IMDH_LEPIN            IGDIANSLAIGASTCMMGFMFAGTTEAPGEYFY-ENGIRLKKYRGMAS-----IEAMKAG
IMDH_DICDI            IGHIIKGLSLGASSVMMGSMLAGTEEAPGDYFY-KDGMRLKKYRGMGS-----LEAMVKG
D0N723_PHYIT          SGHIVKALTVGASAVMCGSLFAGTEESPGQYFF-QDGVRLKKYRGMGS-----IEAMTAG
B8BZC2_THAPS          TGHITKALSLGASCVMMGSMLAGTDEAPGEYFY-QDGVRLKRYRGMGS-----IEAMSKG
IMDH1_ARATH           SGHIVKALVLGASTVMMGSFLAGSTEAPGGYEY-TNGKRIKKYRGMGS-----LEAMTKG
IMDH2_ARATH           SGHIVKALVLGASTVMMGSFLAGSTEAPGAYEY-RNGRRVKKYRGMGS-----LEAMTKG
IMDH_VIGUN            SGHIVKALSLGASTAMMGSFLAGSHEAPGAYVY-QNGQRVKKYRGMGS-----LEAMTKG
C5WZ26_SORBI          SGHIVKALSLGASTVMMGSFLAGSHEAPGTYEY-KDGRRVKKYRGMGS-----LEAMTKG
C5X9F2_SORBI          SGHIVKALTLGASTVMMGSFLAGSLEAPGVYEY-KDGHRVKKYRGMGS-----LEAMTKG
A9RU40_PHYPA          SGHIVKALSLGASTVMMGSFLAGTDEAPGSFFY-QDDVKLKSYRGMGS-----LEAMTKG
A9TN21_PHYPA          SGHIVKALSLGASTVMMGSFLAGTDEAPGDFYF-QDGVKLKRYRGMGS-----LEAMTKG
Q4UCL4_THEAN          SGDIVKALSLGASCVMGGSIFAGSKEAPGEYYF-NNGVRMKSYRGMGS-----KDAINDS
Q4N0C9_THEPA          SGDIVKALSLGASCVMGGSLFAGSKETPGEYYF-NNGVRMKSYRGMGS-----KDAIKDS
A7AR77_BABBO          SGDIMKALALGASCCMLGGAIAGTNESPGDFFY-HNGIRVKQYRGMGS-----KAAFMTA
A0A113RHB4_PLABE      SGNIVKALSLGADFVMLGNLLAATEESCSEYYF-ENNVRLKMYRGMGS-----MEAMYNK
Q7RIL8_PLAYO          SGNIVKALSLGADFVMLGNLLAATEESCSEYYF-ENNVRLKMYRGMGS-----MEAMYNK
A0A384L7F5_PLAKH      SGNIVKALSIGADFVMMGNLLAATEESCSDYYF-ENNVRLKIYRGMGS-----MEAMYNK
A5K6S2_PLAVS          SGNIVKALSIGADFVMMGNLLAATEESCSDYYF-ENNVRLKIYRGMGS-----MEAMYNK
Q8I2U5_PLAF7          SGNIVKALSLGADFVMLGNLLAATEESCSEYYF-ENNVRLKIYRGMGS-----MEAMYNK
IMDH_HALSA            SGDAAKAIAAGADAVMLGSYFAGTDEAPGRVIT-MNGKKYKQYRGMGS-----VGAMQSG
Q2FS86_METHJ          SGDVAKAIAAGADSVMMGNLFAGTDESPGQIVT-IQSRKYKQYRGMGS-----LGVMSTG
IMDH_METJA            SGDIAKAIAAGADAVMLGSLLAGTDEAPGQLMV-INGRKYKQYRGMGS-----LGAMTGG
O26245_METTH          SGDIAKAIAVGADCVMLGNLLAGTYEAPGDVVV-MNGRKYKQYRGMGS-----LGAMTGG
IMDH_PYRFU            SGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVI-INGRKYKQYRGMGS-----LGAMMKG
IMDH_PYRHO            SGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVI-INGRKYKQYRGMGS-----LGAMMKG
Q5JFM0_THEKO          SGDIVKAIAAGADAVMLGSLLAGTKEAPGKEVV-MNGRRYKQYRGMGS-----LGAMMKG
Q8TV01_METKA          SGDIAKAIAAGADAVMLGNLLAGTDEAPGRVIR-LRGRLYKQYRGMGS-----LGAMMKG
IMDH_THEAC            SGDIVKAIAAGADAVMLGSMLAGTEESPGQEMI-INGRKYKAYRGMGS-----IGALTTG
A0QSU3_MYCS2          SGDIAKALAAGASTAMLGSLLAGTAESPGELIF-VNGKQFKSYRGMGS-----LGAMQGR
IMDH_MYCTU            SGDIAKALAAGASTAMLGSLLAGTAEAPGELIF-VNGKQYKSYRGMGS-----LGAMRGR
Q8NSR5_CORGL          SGDIAKALAAGANSVMLGSMLAGTAEAPGETIT-INGKQYKRYRGMGS-----MGAMQGR
Q9L0I7_STRCO          SGDIGKALAAGADTVMLGSLLAGCEESPGELQF-INGKQFKSYRGMGS-----LGAMQSR
IMDH_BIFLO            SGDIAKALVAGASSVMLGGTLAGCEEAPGEKVL-LHGKQYKLYRGMGS-----LGAMAPR
Q7VVM3_BORPE          SGDVAKALAAGAFACMMGGMFAGTEEAPGEVVL-FQGRSYKSYRGMGS-----LGAMA--
Q63T40_BURPS          SGDVSKALAAGANAVMMGSMFAGTEEAPGDVFL-YQGRQYKSYRGMGS-----VGAMK--
Q5F8H4_NEIG1          SGDIAKALAAGAYSVMLGGMFAGTEEAPGEIEL-YQGRSYKSYRGMGS-----LGAMS--
Q9JZB5_NEIMB          SGDIAKALAAGAYSVMLGGMFAGTEEAPGEIEL-YQGRSYKSYRGMGS-----LGAMS--
Q9HXM5_PSEAE          SGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIEL-FQGRSYKSYRGMGS-----LGAMSGS
Q83BZ5_COXBU          SGDICKAIAAGAHAVMIGGLFAGTEEAPGEEVL-YQGRSYKAYRGMGS-----AGAMFGK
Q8P8Q5_XANCP          SGDIGKALVAGASTVMVGGLLAGTEEAPGEVEL-FQGRSYKSYRGMGS-----LGAM--E
Q5NFC2_FRATT          SGDIAKAIVAGASVVMIGGLFAGTEESPGEVEL-FQGRSYKSYRGMGS-----LGAME--
IMDH_ECOLI            SGDIAKAIAAGASAVMVGSMLAGTEESPGEIEL-YQGRSYKSYRGMGS-----LGAMS--
Q32D54_SHIDS          SGDIAKAIAAGASAVMVGSMLAGTEESPGEIEL-YQGRSYKSYRGMGS-----LGAMS--
Q8ZN59_SALTY          SGDIAKAIAAGASAVMVGSMLAGTEESPGEIEL-YQGRSYKSYRGMGS-----LGAMS--
IMDH_YERPE            SGDIAKAIAAGASCVMVGSMLAGTEESPGEIEL-YQGRSFKSYRGMGS-----LGAMS--
IMDH_HAEIN            SGDIAKAIAAGASCVMVGSMFAGTEEAPGEIEL-YQGRAFKSYRGMGS-----LGAMA--
Q9KTW3_VIBCH          SGDISKAIAAGASCVMVGSMFAGTEEAPGEVIL-YQGRSYKAYRGMGS-----LGAMS--
Q5E764_ALIF1          SGDICKAIVAGASCVMVGSMFAGTEEAPGEVIL-YQGRSYKAYRGMGS-----LGAMS--
Q8EC51_SHEON          SGDLAKALAAGASCIMAGSMFAGTDEAPGETEL-YQGRAYKSYRGMGS-----LGAMS--
Q89N70_BRADU          SGDLAKALAAGADIAMVGSLLAGTDETPGEVFL-WQGRSYKAYRGMGS-----VGAMA--
Q9A7V2_CAUVC          SGDLAKAIAAGASTAMMGSMFAGTEEAPGEVFL-YQGRSYKSYRGMGS-----VGAMA--
Q2RXU6_RHORT          SGDLAKAIAGGAETVMVGSLLAGTSEAPGEVFL-YQGRSYKAYRGMGS-----LGAMA--
Q3J2F5_RHOS4          SGDFAKAIAAGASCAMVGSAIAGTDESPGEVIL-YQGRSFKSYRGMGS-----LGAMA--
IMDH_CHLTE            SGDIAKALAAGADSVMMGSVFAGTDESPGETIL-YEGRRFKAYRGMGS-----LGAMSEP
A0A4Y7QN78_9BACI      SGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVYRGMGS-----VGAMEKG
Q81JC8_BACCR          SGDMVKALAAGAHVVMLGSMFAGVAESPGETEI-YQGRQFKVYRGMGS-----VGAMEKG
IMDH_BACSU            SGDITKALAAGGHAVMLGSLLAGTSESPGETEI-YQGRRFKVYRGMGS-----VAAMEKG
Q926Y9_LISMO          SGDIVKALAAGGNAVMLGSMLAGTDESPGETEI-FQGRQFKTYRGMGS-----LAAMEHG
IMDH_STAA8            SGDIIKALAAGGHAVMLGSLLAGTEESPGATEI-FQGRQYKVYRGMGS-----LGAMEKG
Q8DMX2_STRR6          SGDIVKALAAGGNAVMLGSMFAGTDEAPGETEI-FQGRKFKTYRGMGS-----IAAMKKG
IMDH_STRPY            SGDIVKALAAGGNAVMLGSMFAGTDEAPGETEI-YQGRKFKTYRGMGS-----IAAMKKG
Q9CIY6_LACLA          SGDIVKALAAGGDAVMLGSMLAGTDESPGEFEI-FQGRKFKTYRGMGS-----LAAMKKG
Q82YY8_ENTFA          SGDIVKALAAGGHAVMLGSMLAGTDESPGEFEI-YQGRRFKTYRGMGS-----LGAMEKG
Q97FM8_CLOAB          SGDIVKALAAGAKAVMMGSMFAGCEEAPGETEI-YQGRSYKVYRGMGS-----LAAMQCG
A5I721_CLOBH          SGDIVKALAAGAKAVMMGSMFAGCAEAPGETEI-YQGRSYKVYRGMGS-----LAAMACG
Q8RE86_FUSNN          SGDIVKALAAGGDCVMLGGLLAGTKEAPGEEII-LEGRRFKIYVGMGS-----IAAMKRG
Q2RJG7_MOOTA          SGDITKAIAAGANTVMIGSLLAGTEESPGEIEI-FQGRSFKSYRGMGS-----LAAMKEG
D1B5E0_THEAS          SGDIVKALAAGADVVMIGSLLAGTEESPGEVVI-SRGRSFKSYRGMGS-----LGAMKEG
Q8A126_BACTN          SGDVVKALAAGGYCVMIGSLVAGTEESPGDTII-FNGRKFKSYRGMGS-----LEAMENG
A6H0L3_FLAPJ          TGDIPKAIAAGADCVMLGSLLAGTKESPGETII-FEGRKFKSYRGMGS-----VEAMQEG
Q2S2G2_SALRD          TGDIPKALAAGASAVMIGSLFASVEESPGETII-YEGRKYKSYRGMGS-----VEAMQDG
Q72D85_DESVH          SGDVVKALCVGAHTVMIGSLFAGTDESPGETIL-YQGRTYKIYRGMGS-----IDAMKDG
Q1IS88_KORVE          SGDIVKALAAGADVVMIGSLLAGTEESPGETIL-YQGRTFKSYRGMGS-----LAAMAQG
Q74B47_GEOSL          SGDVTKAVAAGADVIMIGSLFAGTEESPGDTIL-YQGRAYKSYRGMGS-----IGAMKQG
Q9RT87_DEIRA          TGDVPKAIAAGASVVMMGSMLAGTDEAPGETIL-RDGRRYKSYRGMGS-----LGAMDQG
Q5SL61_THET8          TGDVAKAIAAGAHAVMLGSMLAGTDEAPGEEVL-KDGRRYKLYRGMGS-----LGAMKQG
A9WEU7_CHLAA          SGDIPKAIAAGAHSVMIGSIFAGTEESPGELIL-YEGRSYKSYRGMGS-----IGAMQRG
IMDH_AQUAE            SGDIVKALAAGASAVMLGNLLAGTEEAPGETIY-YQGRAYKVYRGMGS-----LGAMSSR
Q9X168_THEMA          SGDIVKALAAGAESVMVGSIFAGTEEAPGETIL-YQGRKYKAYRGMGS-----LGAMRSG
B8DZU8_DICTD          SGDITKAIAAGAHAVMLGSLLAGTEESPGEIEI-YQGRSFKVYRGMGS-----LSAMKEG
B5YHZ0_THEYD          SGDITKALAAGAHCVMIGSLFAGTDEAPGEIIL-YQGRSYKTYRGMGS-----IGAMQGG
Q0P9J4_CAMJE          SGDIAKALAVGASSVMIGSLLAGTDESPGELFT-YQGRQYKSYRGMGS-----LGAMQKG
IMDH_HELPY            SGDVAKALALGASSVMIGSLLAGTEESPGDFMI-YQGRQYKSYRGMGS-----IGAMTKG
IMDH_RHOBA            SGDITKAIAAGASTVMIGSLFAGLAESPGKMIL-YQGRTFKAYRGMGS-----MGAMVKG
IMDH_TRIFO            DYHMTLALAMGADFIMLGRYFARFEESPTRKVT-INGSVMKEYWGEGSSRARN-------
                            .:  *.   * *  .:   *:         .   * * * .*            

A8X1T4_CAEBR          ASSQ-----------------------DRYFTAESD--------------QIKVAQGVSA
IMDH_CAEEL            ASSQ-----------------------DRYFTAESD--------------QIKVAQGVSA
IMDH_LEIDO            KESG-----------------------KRYLS-ENE--------------AVQVAQGVSG
A4HYI5_LEIIN          KESG-----------------------KRYLS-ENE--------------AVQVAQGVSG
Q4QD53_LEIMA          KESG-----------------------KRYLS-ENE--------------VIQVAQGVSG
A4HAA5_LEIBR          KESG-----------------------KRYLS-ENE--------------VVQVAQGVSG
K2NRC9_TRYCR          KESG-----------------------KRYLS-EKE--------------TVQVAQGVSG
IMDH1_MOUSE           SSSQ-----------------------KRYFS-EGD--------------KVKIAQGVSG
IMDH1_RAT             SSSQ-----------------------KRYFS-EGD--------------KVKIAQGVSG
IMDH1_BOVIN           SSSQ-----------------------KRYFS-EGD--------------KVKIAQGVSG
IMDH1_HUMAN           SSSQ-----------------------KRYFS-EGD--------------KVKIAQGVSG
IMDH3_DANRE           TSSQ-----------------------KRYFS-EGD--------------KVKVAQGVSG
IMDH1_DANRE           NSSQ-----------------------KRYFS-EGD--------------KVKVAQGVSG
IMDH1_XENTR           TSSQ-----------------------KRYFS-EGD--------------KVKVAQGVSG
IMDH2_HUMAN           LSSQ-----------------------NRYFS-EAD--------------KIKVAQGVSG
IMDH2_MOUSE           LSSQ-----------------------NRYFS-EAD--------------KIKVAQGVSG
IMDH2_RAT             LSSQ-----------------------NRYFS-EAD--------------KIKVAQGVSG
IMDH2_BOVIN           LSSQ-----------------------NRYFS-EAD--------------KIKVAQGVSG
Q5F4A4_CHICK          LGSQ-----------------------NRYFS-ETD--------------KIKVAQGVSG
IMDH2_XENTR           VSSQ-----------------------KRYFS-EAD--------------KIKVAQGVSG
IMDH2_DANRE           LGSQ-----------------------TRYFS-ESD--------------KIKVAQGVSG
A7RG06_NEMVE          SSSA-----------------------SRYFS-END--------------KVKVAQGVSG
A7REY1_NEMVE          KSSQ-----------------------SRYFI-ESE--------------RIKVAQGVSG
A9VB34_MONBE          GSRH-----------------------RYFSQ-EKD--------------KIRVAQGVTG
Q16WB3_AEDAE          DAKGA-------------------AGARYFHT-DMD--------------KLRVAQGVSG
W5JN05_ANODA          DGKGA-------------------AGSRYFHT-EME--------------KLRVAQGVSG
IMDH_DROME            DAKGA-------------------AMSRYYHN-EMD--------------KMKVAQGVSG
Q29IQ0_DROPS          DAKGA-------------------AMSRYYHN-EMD--------------KMKVAQGVSG
E0VEZ4_PEDHC          ESSGS-------------------ASSRYFHN-EMD--------------NLKVAQGVSG
E0VCU3_PEDHC          -GSGT-------------------ASNRYFHD-ELD--------------NVKVAQGVSG
C0NBC7_AJECG          KAGGG-KGGQAN-----------NAGTARYFS-ESD--------------RLLVAQGVSG
IMDH_ASPFU            KAGAGSKDSKAS-----------NAGTARYFS-EKD--------------RVLVAQGVAG
Q0V6E3_PHANO          KAGAGSADAKAS-----------NAGTARYFS-EGD--------------RVLVAQGVSG
I1RBE4_GIBZE          KAGNGGKDSQKS-----------NAGTARYFS-EGD--------------SVLVAQGVSG
C7YID4_NECH7          KAGGGGKDSQKS-----------NAGTARYFS-EGD--------------SVLVAQGVSG
IMDH_NEUCR            KAGGGGKDAQKS-----------NAGTARYFS-EGD--------------SILVAQGVSG
A7F2A7_SCLS1          KAGSGAKDSQKS-----------NAGTARYFS-EGD--------------SVLVAQGVSG
D5GG57_TUBMM          KTG--------D-----------NAATGRYFS-EGD--------------KIRVAQGVSG
IMDH_CANAL            ------QTNTNA-----------NASTSRYFS-EAD--------------KVLVAQGVSG
IMDH_CANAX            ------QTNTNA-----------NASTSRYFS-EAD--------------KVLVAQGVSG
C4YIV3_CANAW          ------QTNTNA-----------NASTSRYFS-EAD--------------KVLVAQGVSG
IMDH3_YEAST           ------KTGTKG-----------NASTSRYFS-ESD--------------SVLVAQGVSG
IMDH2_YEAST           ------KTGTKG-----------NASTSRYFS-ESD--------------SVLVAQGVSG
IMDH4_YEAST           ------KTGNKG-----------NASTSRYFS-ESD--------------SVLVAQGVSG
Q6C897_YARLI          ------KQDNND-----------NAATSRYFS-ESD--------------SVLVAQGVSG
A8NJG1_COPC7          KSSIQSKPGQSSKYPTKKDNTVENAATSRYFS-ESS--------------AIKVAQGVSG
IMDH_CRYNJ            QR--GSASGKRS------ILNLDNAATARYFS-EAD--------------AVKVAQGVSG
IMDH_PNECA            -----SGKNKGD-----------NAASSRYFG-EAD--------------TIRVAQGVSG
IMDH_SCHPO            ------GTGVNK-----------NASTGRYFS-END--------------AVRVAQGVSG
IMDH_LEPIN            GD-------------------------KRYFN-EGQ--------------KVKVAQGVSG
IMDH_DICDI            GD-------------------------QRYFSETD---------------KIKVAQGVSG
D0N723_PHYIT          SS-------------------------KRYFATHA---------------AVKVAQGVSG
B8BZC2_THAPS          SE-------------------------KRYVWENNSAH------------SVKVAQGVSG
IMDH1_ARATH           SD-------------------------QRYLGDQT---------------KLKIAQGVVG
IMDH2_ARATH           SD-------------------------QRYLGDTA---------------KLKIAQGVVG
IMDH_VIGUN            SD-------------------------ARYLGDTA---------------KLKIAQGVVG
C5WZ26_SORBI          SD-------------------------ARYLGDTL---------------KLKVAQGVVG
C5X9F2_SORBI          SD-------------------------VRYLGDTL---------------KLKVAQGVVG
A9RU40_PHYPA          SD-------------------------ARYLGDKT---------------RLKIAQGVSG
A9TN21_PHYPA          SD-------------------------ARYLGDKT---------------RLKIAQGVSG
Q4UCL4_THEAN          LQNTGL-----------------MGSLSRYHLVDDQK---------------IISQGVSG
Q4N0C9_THEPA          MQNLGL-----------------MGSLSRYHLIDEPN---------------ILSQGVSG
A7AR77_BABBO          RTKAAD-----------------SGSLRRYHMEEDQP---------------MVSQGVAG
A0A113RHB4_PLABE      HFNSKSRY---------------LVEDKIFGTVYDPTN------------DIKISQGVSA
Q7RIL8_PLAYO          QFNSKSRY---------------LVEDKIFGTVYDPTN------------DIKISQGVSA
A0A384L7F5_PLAKH      GFNSKSRY---------------LVEERKNDNLCDQNE------------EIKVSQGVSA
A5K6S2_PLAVS          GFNSKSRY---------------LVEERKNDGLCDQNE------------EIKVSQGVSA
Q8I2U5_PLAF7          GFNSKSRY---------------LVDERKNEYTDENID------------EIKVSQGVSA
IMDH_HALSA            ------------------------GS-DRYLKD-------------DDEDEEYVPEGVEA
Q2FS86_METHJ          ------------------------VSSDRYFQKK------------EIGKTKFVPEGVEG
IMDH_METJA            VG----------------------AGADRYFQAPA---------KSHMKHVKLVPEGVEG
O26245_METTH          IG----------------------AGTDRYFQEP----------RGHMKHTKVVPEGVEG
IMDH_PYRFU            -------------------------GAERYYQ------------GGYMKTRKFVPEGVEG
IMDH_PYRHO            -------------------------GAERYYQ------------GGYMKTRKFVPEGVEG
Q5JFM0_THEKO          -------------------------GAERYYQ------------KGHMKTKKFVPEGVEG
Q8TV01_METKA          E------------------------SADRYFKQPEQG-------GRHVAQTKFVPEGVEG
IMDH_THEAC            -------------------------LSDRYSK----------------LGNGFIAEGVEG
A0QSU3_MYCS2          ---GA----------------AKSYSKDRYFQDDVLS------------EDKLVPEGIEG
IMDH_MYCTU            ---GG----------------ATSYSKDRYFADDALS------------EDKLVPEGIEG
Q8NSR5_CORGL          GLSGE----------------KRSYSKDRYFQSDVKS------------EDKLVPEGIEG
Q9L0I7_STRCO          ---GQ----------------GRSYSKDRYFQAEVAS------------DDKLVPEGIEG
IMDH_BIFLO            ----G----------------KKSYSKDRYFQADVTS------------SDKVVPEGVEG
Q7VVM3_BORPE          DG-----------------------SADRYFQDPANN------------ADKLVPEGIEG
Q63T40_BURPS          DG-----------------------AADRYFQDNSAN------------IDKLVPEGIEG
Q5F8H4_NEIG1          QG-----------------------SADRYFQDKTDS------------TDKYVPEGIEG
Q9JZB5_NEIMB          QG-----------------------SADRYFQDKTDS------------TDKYVPEGIEG
Q9HXM5_PSEAE          QG-----------------------SSDRYFQDASAG------------AEKLVPEGIEG
Q83BZ5_COXBU          YG-----------------------SSDRYFQESFDK------------QEKYVPEGIEG
Q8P8Q5_XANCP          KG-----------------------SKDRYFQDASD-------------ADKLVPEGIEG
Q5NFC2_FRATT          KG-----------------------SSDRYFQSETE-------------AKKFVPEGVEG
IMDH_ECOLI            KG-----------------------SSDRYFQ-SDNA------------ADKLVPEGIEG
Q32D54_SHIDS          KG-----------------------SSDRYFQ-SDNA------------ADKLVPEGIEG
Q8ZN59_SALTY          KG-----------------------SSDRYFQ-SDNA------------ADKLVPEGIEG
IMDH_YERPE            KG-----------------------SSDRYFQ-TDNA------------ADKLVPEGIEG
IMDH_HAEIN            KG-----------------------SSDRYFQ-SDNA------------ADKLVPEGIEG
Q9KTW3_VIBCH          KG-----------------------SSDRYFQ-TDNA------------ADKLVPEGIEG
Q5E764_ALIF1          QG-----------------------SSDRYFQ-SDNA------------ADKLVPEGIEG
Q8EC51_SHEON          QG-----------------------SSDRYFQ-SDNA------------ADKLVPEGIEG
Q89N70_BRADU          RG-----------------------SADRYFQQDIKD------------TLKLVPEGIEG
Q9A7V2_CAUVC          RG-----------------------SADRYFQKEVTD------------NFKLVPEGIEG
Q2RXU6_RHORT          RG-----------------------SADRYFQEEVTN------------SLKLVPEGIEG
Q3J2F5_RHOS4          RG-----------------------SADRYFQKDAAS------------D-KLVPEGIEG
IMDH_CHLTE            EG-----------------------SSDRYFQDVSAE------------TKKYVPEGIEG
A0A4Y7QN78_9BACI      -------------------------SKDRYFQEG---------------NKKLVPEGIEG
Q81JC8_BACCR          -------------------------SKDRYFQEG---------------NKKLVPEGIEG
IMDH_BACSU            -------------------------SKDRYFQEE---------------NKKFVPEGIEG
Q926Y9_LISMO          -------------------------SKDRYFQAD---------------AKKLVPEGIEG
IMDH_STAA8            -------------------------SNDRYFQEDK-------------APKKFVPEGIEG
Q8DMX2_STRR6          -------------------------SSDRYFQGSV------------NEANKLVPEGIEG
IMDH_STRPY            -------------------------SSDRYFQGSV------------NEANKLVPEGIEG
Q9CIY6_LACLA          -------------------------SKDRYFQGAV------------NEANKLVPEGIEG
Q82YY8_ENTFA          -------------------------SSDRYFQGSV------------NEANKLVPEGIEG
Q97FM8_CLOAB          -------------------------SKDRYFQEG---------------NKKLVPEGVEG
A5I721_CLOBH          -------------------------SKDRYFQED---------------NKKLVPEGVEG
Q8RE86_FUSNN          -------------------------SKDRYFQAGE------------VDNSKLVPEGIEG
Q2RJG7_MOOTA          -------------------------SKDRYFQEEA---------------EKLVPEGIEG
D1B5E0_THEAS          C------------------------SKDRYFQEGT------------V-EDKLVPEGIEG
Q8A126_BACTN          -------------------------SKDRYFQSGT------------ADVKKLVPEGIAA
A6H0L3_FLAPJ          -------------------------SKDRYFQDVE------------DDIKKLVPEGIVG
Q2S2G2_SALRD          -------------------------SKDRYFQDAE------------DELRKLVPEGVEG
Q72D85_DESVH          -------------------------SSDRYFQ---------------EKSKKLVPEGIVG
Q1IS88_KORVE          -------------------------SSERYFQSVENETAGLAAEEDGNRLNKLVPEGIEG
Q74B47_GEOSL          -------------------------SKDRYFQS------------DVESEVKLVPEGIEG
Q9RT87_DEIRA          -------------------------SADRYFQG---------------GSRKFVPEGIEG
Q5SL61_THET8          -------------------------SADRYFQDPE---------KGETEAKKLVPEGIEG
A9WEU7_CHLAA          -------------------------GGDRYFQT------------NVTEARKLVAEGIEG
IMDH_AQUAE            L------------------------SSDRYGQE---------------KMEKFVPEGIEG
Q9X168_THEMA          -------------------------SADRYGQE---------------GENKFVPEGIEG
B8DZU8_DICTD          -------------------------SKDRYFQE---------------NSEKLVPEGIEG
B5YHZ0_THEYD          -------------------------SRDRYRQEMV-------------SPEKLVPEGVEG
Q0P9J4_CAMJE          -------------------------SSDRYFQQGT-------------AQDKLVPEGIEG
IMDH_HELPY            -------------------------SSDRYFQEGV-------------ASEKLVPEGIEG
IMDH_RHOBA            -------------------------SSDRYRQKGT-------------EAGKLVPEGVEG
IMDH_TRIFO            --------------------------WQRYDLGGKQ--------------KLSFEEGVDS
                                                                           . :.: .

A8X1T4_CAEBR          TMKDRGSCHKFIPYLVRGVQHGMQDIGVRSLREFREKVDGGIVKFERRSTNAQLEGGVHS
IMDH_CAEEL            TMKDRGSCHKFIPYLIRGVQHGMQDIGVRSLRDFREKVDNGIVKFERRSTNAQLEGGVHS
IMDH_LEIDO            NVVDKGSAAKLIAYVSKGLQQSAQDIGEISFDAIREKMYAGQVLFSRRSPTAQGEGGVHS
A4HYI5_LEIIN          NVVDKGSAAKLIAYVSKGLQQSAQDIGEISFDAIREKMYAGQVLFSRRSPTAQGEGGVHS
Q4QD53_LEIMA          NVVDKGSAAKLIAYVSKGLQQAAQDIGEISFDAIREKMYAGQVLFNRRSPTAQGEGGVHS
A4HAA5_LEIBR          NVVDKGSAEKLIAYIAKGLQQSAQDIGEISFDAIREKLYAGQVLFSRRSVTAQGEGGVHS
K2NRC9_TRYCR          TVLDKGSVTKLLAYIHKGLQQSAQDIGEISFDAVREKMYEGQVLFNRRSPIAQMEGGVHS
IMDH1_MOUSE           SIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHG
IMDH1_RAT             SIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHG
IMDH1_BOVIN           SIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHG
IMDH1_HUMAN           SIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHG
IMDH3_DANRE           SVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSVLRSMMYSGELKFEKRTMSAQVEGGVHG
IMDH1_DANRE           SVQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKFEKRTMSAQVEGGVHG
IMDH1_XENTR           SIQDKGSIHKFVPYLIAGIQHGCQDIGAKSLSILRSMMYSGELKLEKRTMSAQVEGGVHG
IMDH2_HUMAN           AVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHS
IMDH2_MOUSE           AVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHS
IMDH2_RAT             AVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHG
IMDH2_BOVIN           AVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHS
Q5F4A4_CHICK          AVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTTSAQVEGGVHG
IMDH2_XENTR           AVQDKGSIHKFIPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTMSAQVEGGVHG
IMDH2_DANRE           AVQDKGSIHKFVPYLLVGIQHSCQDIGAKSLTQLRAMMYSGELRFEKRTMSAQMEGGVHS
A7RG06_NEMVE          SVVDKGSIHKFVPYLTAGIQHGCQDLGAKSLTSLRSMMYSGELKFERRTTSSQIEGGVHG
A7REY1_NEMVE          AVVDKGSIHRFVPYLLSGLQHGCQDMGCQSLSVLRSMMYSGQLKFEKRSSAARIEGGIHS
A9VB34_MONBE          TVADKGSVLRFVPYLCAGVRHGLQDIGCRSTVSLRAAMYAGEIRFETRTVSAQMEGGVHG
Q16WB3_AEDAE          SIVDKGSVLRFLPYLQCGLQHSCQDIGTKSLQNLKKMIYSGELRFMRRTHSAQAEGNVHS
W5JN05_ANODA          SIVDKGSILRFVPYLQCGLRHSCQDIGTRSIANLRKMIYSGELRFMKRTHSAQLEGNVHG
IMDH_DROME            SIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHG
Q29IQ0_DROPS          SIVDKGSVLRYLPYLECGLQHSCQDIGANSVRKLKEMIYNGQLRFMKRTHSAQLEGNVHG
E0VEZ4_PEDHC          AIVDKGSVLKYLQYLQTGMKHSFQDIGAKSVTILRNMAQSGVLRVEKRTPSAQMEGSVHG
E0VCU3_PEDHC          AIVDKGTVLRFLPYLQCGMRHSCQDIGAKSIQMLRHMMYSEILRIEKRTPAAQIEGNVHV
C0NBC7_AJECG          SVLDRGSVTKFVPYLMAGIQHSLQDIGVKSLKELHDGVAAGTVRFEVRSVSAQAEGGVHG
IMDH_ASPFU            SVLDRGSVTKFVPYLVAGVQHSLQDIGVKSLDELHDGVNKGIVRFEMRSASAMAEGNVHG
Q0V6E3_PHANO          SVQDRGSITKFVPYLMAGVQHSLQDIGIKSLTELHEGVDNGTVRFELRTASAQAEGNVHG
I1RBE4_GIBZE          AVAHRGSIQKFVPYLAAGLKHSLQDSGMTSLSGMHHCAEVGELRFELRTASAQLEGNVN-
C7YID4_NECH7          AVAHRGSINKFIPYLAAGLKHSLQDSGMVSLEGMHSAAEAGDLRFELRTASAQLEGNVN-
IMDH_NEUCR            AVAHRGSINKFVPYLAAGLKHSLQDCGMTSLQELHECVENGTVRFEIRTASAQLEGGVN-
A7F2A7_SCLS1          AVAHRGSVTKFVPYLAAGLKHSLQDCGQMSLKALHEAVENGTTRFELRTASAQLEGGVN-
D5GG57_TUBMM          SVLDRGSVTKFVPYLQAGLQHSFQDIGVQSISELQQGVNYGIVRFEIRTVSAQAEGNVHG
IMDH_CANAL            SVVDKGSITKFVPYLYNGLQHSLQDIGIKSIDELRENVDNGEIRFEFRTASAQFEGGVHG
IMDH_CANAX            SVVDKGSITKFVPYLYNGLQHSLQDIGIKSIDELRENVDNGEIRFEFRTASAQFEGGVHG
C4YIV3_CANAW          SVVDKGSITKFVPYLYNGLQHSLQDIGIKSIDELRENVDNGEIRFEFRTASAQFEGGVHG
IMDH3_YEAST           AVVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENVQSGKVRFEFRTASAQLEGGVHN
IMDH2_YEAST           AVVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHN
IMDH4_YEAST           AVVDKGSIKKFIPYLYNGLQHSCQDIGCESLTSLKENVQNGEVRFEFRTASAQLEGGVHN
Q6C897_YARLI          SVIDRGSITKFIPYLTAGLQHGLQDIGVRSVAELREKVDNGDVRFEYRTASAQLEGGVHS
A8NJG1_COPC7          DVQDKGSVKAFLPYLHVGVQHSLQDVGVRSVAELQEGVRQSKVRFELRTASAQVEGGVHG
IMDH_CRYNJ            DVADKGSINKFVPYLFTGLQHSFQDAGVKSVSELHSCARSGSLRFELRTASAQLEGGVHG
IMDH_PNECA            SVIDKGSLHVYVPYLRTGLQHSLQDIGVQNLTELRKQVKEKNIRFEFRTVASQLEGNVHG
IMDH_SCHPO            LVVDKGSLLRFLPYLYTGLQHALQDIGTKSLDELHEAVDKHEVRFELRSSAAIREGDIQG
IMDH_LEPIN            SVVDRGSILNFIPYLSQGLRLSFQDMGYKSIPEIHKALRDGKLRFERRSESAQAQGSVHG
IMDH_DICDI            SVVDKGSVKKFVPYLIQGIKHGLQDLGCNSVTNLRESVYGGKVRFEVRTAAAQVEGSVHS
D0N723_PHYIT          AVVDKGSLMRYVPYLQQGIKHGLQDLGQVSLEAVHSALHTGELRFELRTPAAQREGNVHS
B8BZC2_THAPS          AVQDKGTLLRYIPYLVQGVRHGMQDAGVKSLDETWEKLYNDELRFEIRSPAAQKEGGVHG
IMDH1_ARATH           AVADKGSVLKLIPYTMHAVKQGFQDLGASSLQSAHGLLRSNILRLEARTGAAQVEGGVHG
IMDH2_ARATH           AVADKGSVLKFIPYTMHAVKQGFQDLGASSLQSAHELLRDNTLRLEARTGAAQIEGGIHG
IMDH_VIGUN            AVKDKGSVLNFIPYTLQAVRQGFQDIGASSLQSAHDLLRSRVLRLEVRTGAAQVEGGVHG
C5WZ26_SORBI          AVADKGSVLRFIPYTMQAVKQGFQDLGADSLQSAHDLLRSETLRLEVRTGAAQVEGGIHG
C5X9F2_SORBI          AVADKGSVLRFIPYTMQAVKQGFQDLGAASLQSAHDLLRSESLRLEVRTGAAQVEGGIHG
A9RU40_PHYPA          SVAAKGSVLRLVPYTLQAVKQGLQDLGVPSVKAAHVGLNAGAIRLEVRTGAAQREGGIHD
A9TN21_PHYPA          SVAAKGSVLQLLPYTMQAVKQGLQDLGVSSVKASHDGLNAGAIRLEVRTGAAQREGGIHD
Q4UCL4_THEAN          LVIDKGSVNNILPNLTQGVKHGLQNIGAFSVKELHEALYSGQLRLEQRTAQSIVDANVCR
Q4N0C9_THEPA          LVIDKGSVNNIIPNLTQGVKHGFQNLGVYSIKGLHEALYSGQLRMEQRTPQSINDGHVSK
A7AR77_BABBO          YTADKGSIHVLIPTMMQAVKHGMQNIGCNDIKSLHSGLYNGDVRFQIRSYNALVEGNVST
A0A113RHB4_PLABE      SLVDKGSVLNLIPHLVKAVKHGFQSIGIKNIQQLHSKLYSGDLKFDIRSINSIKEGKVSD
Q7RIL8_PLAYO          SLVDKGSVLNLIPHLVKAVKHGFQSIGIRNIQQLHSKLYSGDLKFDIRSINSIKEGKVSD
A0A384L7F5_PLAKH      SLVDKGSVLNLIPHLVKAVKHGFQSMGIKSIPELHSKLYSGDLKFDVRSFNTIKEGRISD
A5K6S2_PLAVS          SLVDKGSVLNLIPHLVKAVKHGFQSMGIRNIPELHSRLYSGDLKFDVRSFNTIKEGRISD
Q8I2U5_PLAF7          SLVDKGSVLNLIPHLFKAVKHGFQSMGIRNIPELHSKLYSGDIRFDVRSFNTIKEGKVSD
IMDH_HALSA            ATPYKGSLASELHQLVGGIQSGMGYVGAESIPAFKADAEFVRVSAAGQTEGHPHDVMITD
Q2FS86_METHJ          VTPYVGPVADVIYQMIGGLKSAMGYTGARNIQDMHEKTRFIRITQAGYHESHPHNITITD
IMDH_METJA            AVPYKGPVSEVVFQLIGGLRASMGYCGAKNLKEMQEKARFVIITPSGQVESHPHDIIITN
O26245_METTH          VVPYRGTVSEVLFQLIGGLRASMGYCGAANLSEMKERAKLVRITSSGYQGEPP-------
IMDH_PYRFU            VVPYRGTVSEVLYQLVGGLKAGMGYVGARNIKELKEKGEFVIITSAGLRESHPHDIIITN
IMDH_PYRHO            VVPYRGTVSEVLYQLVGGLKAGMGYVGARNIRELKEKGEFVIITHAGIKESHPHDIIITN
Q5JFM0_THEKO          VVPYKGPVGEVLYQLIGGLRAGMGYVGARNIPELKEKGEFVIITHAGYIESHPHDILITN
Q8TV01_METKA          VVPYKGPVSEVLYTLVGGLRSSMGYVGAKNIEEMKKKARFVRITRAGYEESHPHDIAITD
IMDH_THEAC            AVPYRGRVDEVLFQLVGGLRTGMGYVGAATIEDLKRNGKFVRITNNGLRESHPHDIRLIS
A0QSU3_MYCS2          RVPFRGPLGTVIHQLTGGLRAAMGYTGSATIEQLQ-QAQFVQITAAGLKESHPHDITMTV
IMDH_MYCTU            RVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQ-QAQFVRITPAGLKESHPHDVAMTV
Q8NSR5_CORGL          RVPFRGPIGDIIHQQVGGLRAAMGYTGSSTIEELH-NARFVQITSAGLKESHPHHIQQTV
Q9L0I7_STRCO          QVPYRGPLANVLHQLVGGLRQTMGYVGAATIEEMESKGRFVRITSAGLKESHPHDIQMTV
IMDH_BIFLO            EVPYRGPLNAVLYQMLGGLHQSMFYIGAHNIAEMPERGKFIRITDAGLRESHPHDIVMTT
Q7VVM3_BORPE          RVPYKGSVLAIIYQLVGGIRASMGYCGCASIDDMRTKTQFVEITSAGVRESHVHDVQITK
Q63T40_BURPS          RVAYKGSVNAIIFQLIGGVRASMGYCGCKTIAELHEKAEFVQITAAGMRESHVHDVQITK
Q5F8H4_NEIG1          RVPYKGPIVNIIHQLTGGLRSSMGYLGCANIAEMHEKAEFVEITSAGMSESHVHDVQITK
Q9JZB5_NEIMB          RVPYKGPIVNIIHQLTGGLRSSMGYLGCANIAEMHEKAEFVEITSAGMSESHVHDVQITK
Q9HXM5_PSEAE          RVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGAGMAESHVHDVQITK
Q83BZ5_COXBU          RVPYKGPLRGVVHQLIGGLRSGMGYTGCRTIDEMRTKTKFIRVTNAGVRESHVHDVTVTK
Q8P8Q5_XANCP          RVPYRGPVGGIIHQLIGGLRATMGYVGCATVEEMRTKPKFVKITGAGQRESHVHDVQITK
Q5NFC2_FRATT          RVPYKGLLSAVIHQLIGGLKSSMGYTGSKDIQTMRTEPTFVQITGAGFNESHVHNVTITK
IMDH_ECOLI            RVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDELRTKAEFVRISGAGIQESHVHDVTITK
Q32D54_SHIDS          RVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDELRTKAEFVRISGAGIQESHVHDVTITK
Q8ZN59_SALTY          RVAYKGRLKEIIHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIQESHVHDVTITK
IMDH_YERPE            RVAYKGLLKEIVHQQMGGLRSCMGLTGCGTINELRTKAEFVRISGAGIQESHVHDVTITK
IMDH_HAEIN            RIPYKGYLKEIIHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIKESHVHDVAITK
Q9KTW3_VIBCH          RIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITK
Q5E764_ALIF1          RIAYKGRLKEIVHQQMGGLRSSMGLTGSATIEDMRTKAEFVRISGAGMKESHVHDVQITK
Q8EC51_SHEON          RVPYKGKLKEIIHQHMGGLRSCMGLTGCATIQELNEKAQFVKVTSAGMGESHVHDVTITK
Q89N70_BRADU          QVPYKGAVGHVMHQLAGGLRAAMGYVGAKDMKELHDKAQFVRITGAGLRESHVHDVTITR
Q9A7V2_CAUVC          QTPFKGPISPVLHQLVGGLRAAMGYLGAPTIPELQKRARFVRITGAGLRESHVHDVMITR
Q2RXU6_RHORT          QVPYKGAAGTVIHQLIGGLKAAMGYTGNQTIPEMQKNARFRRITASGWRESHVHDVTITK
Q3J2F5_RHOS4          QVPYKGPAAAVIHQMVGGLRAAMGYTGNRTVAEMRQGCRFVRITGAGLKESHVHDVQITR
IMDH_CHLTE            RIPAKGKLDEVVYQLIGGLKSAMGYCGVRTITELKENTRFVRITSAGLRESHPHDVMITK
A0A4Y7QN78_9BACI      RVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENAQFIRMSGAGLLESHPHHVQITK
Q81JC8_BACCR          RVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENAQFIRMSGAGLRESHPHHVQITK
IMDH_BACSU            RTPYKGPVEETVYQLVGGLRSGMGYCGSKDLRALREEAQFIRMTGAGLRESHPHDVQITK
Q926Y9_LISMO          RVPYKGSVADIIFQLVGGIRSGMGYTGSPDLRHLREEAAFVRMTGAGLRESHPHDIQITK
IMDH_STAA8            RTAYKGALQDTIYQLMGGVRAGMGYTGSHDLRELREEAQFTRMGPAGLAESHPHNIQITK
Q8DMX2_STRR6          RVAYKGAAADIVFQMIGGIRSGMGYCGAANLKELHDNAQFIEMSGAGLKESHPHDVQITN
IMDH_STRPY            RVAYKGAASDIVFQMLGGIRSGMGYVGAGDIQELHENAQFVEMSGAGLIESHPHDVQITN
Q9CIY6_LACLA          RVAYKGTATDIVFQMLGGLKAGMGYTGAADITALHDSAQFIEMSGAGLKESHPHDVQITK
Q82YY8_ENTFA          RVAYKGSVSDIVFQLIGGLKSGMGYVGAADLKALREEAQFVQMSGNGLKESHPHDVQITK
Q97FM8_CLOAB          RVPFKGSVIETVFQILGGIRSGMGYLGSRNMTELFEKATFVVQTSAGLRESHPHDISITK
A5I721_CLOBH          RVPFKGSVMETIYQMLGGIRSGMGYLGSATLNDLYEKATFVIQTSSGIRESHPHDISITK
Q8RE86_FUSNN          RIAYKGSVKDVVFQLAGGIKAGMGYCGTKTIKDLQINGRFVKITGAGLIESHPHDITITK
Q2RJG7_MOOTA          RVPYKGPLSETIFQLVGGLRAGMGYCGARNIAELQARGRFIRITPAGLRESHPHDVMITK
D1B5E0_THEAS          LVPYKGPLSSVVYQMAGGIRAGMGYVGAPDIRTLQTRSRFIKITAASVKENHPHDVTITK
Q8A126_BACTN          RVPYKGTLYEVVYQLSGGLRAGMGYCGAANIEKLHDA-KFTRITNAGVMESHPHDVTITS
A6H0L3_FLAPJ          RVPYKGELNESMQQFIGGLRAGMGYCGAKDIATLQETGRFVRITTSGIGESHPHNVTITK
Q2S2G2_SALRD          RVPYSGTLSEVIHQMKGGLQAAMGYCGSEEVRDLYESAQFVRTTAAGLRESHPHDVEITK
Q72D85_DESVH          RVPVKGPVADSLYQLIGGLRAGMGYVGAANMEELREKSRFVEISAAGLRESHVHDVIITK
Q1IS88_KORVE          RVPYRGTVAMIVHQMVGGLRSGMGYVGCANVSELKERARFVRISGAGLRESHVHDVIITR
Q74B47_GEOSL          MVPLRGPLSANVHQLMGGLRAGMGYTGCRTVRELQEKGHFVRITGAGLKESHVHDVMITK
Q9RT87_DEIRA          IIAYRGTAGEVIYQFVGGLKSSMGYCGAPDLTTLRDTAQFVRITGASLVESHPHGVTITK
Q5SL61_THET8          MVPYKGPVADVLYQIVGGLRSAMGYVGAPDIETFRKKARFVRMTMAGLIESHPHDVVVVK
A9WEU7_CHLAA          MVPFKGPLSDTVYQLVGGLRAGMGYVGAANIEALRRDARFIRITTAGQIESHPHDVVITK
IMDH_AQUAE            RVPYKGKLADVVYQLVGGLRSGMGYVGARNIKELQEKAKFVRITWAGYRESHVHDVQITR
Q9X168_THEMA          MVPYKGTVKDVVHQLVGGLRSGMGYIGARTIKELQEKAVFVKITPAGVKESHPHDIIITK
B8DZU8_DICTD          RVPYRGPVSEVLFQLVGGLKSGMGYCGVKNLEELRTKTKFIKITNAGLRESHPHDIIITR
B5YHZ0_THEYD          RVPYRGPLAKSVHQLVGGLKSGMGYCGCRTLEELRAKAKFIKITNAGLRESHVHDVTITR
Q0P9J4_CAMJE          RVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITH
IMDH_HELPY            RVPYRGKVSDMIFQLVGGVRSSMGYQGAKNILELYQNAEFVEITSAGLKESHVHGVDITK
IMDH_RHOBA            RVPFKGPLSDYAYQLVGGLRAGMGYVGTRTIEELRRDAKFIRVSAATVRENHPHDIAITQ
IMDH_TRIFO            YVPYAGKLKDNVEASLNKVKSTMCNCGALTIPQLQSKAKITLVSSVSIVEGGAHDVIVKD
                           *            ::      *                                 

A8X1T4_CAEBR          LHSFEKRLY------------------------------
IMDH_CAEEL            LHSFEKRLY------------------------------
IMDH_LEIDO            LHSYEKKLFAAKM--------------------------
A4HYI5_LEIIN          LHSYEKKLFAAKM--------------------------
Q4QD53_LEIMA          LHSYEKKLFAAKM--------------------------
A4HAA5_LEIBR          LHSYEKKLFAAKM--------------------------
K2NRC9_TRYCR          LHSFEKNLFTSRL--------------------------
IMDH1_MOUSE           LHSYEKRLY------------------------------
IMDH1_RAT             LHSYEKRLY------------------------------
IMDH1_BOVIN           LHSYEKRLY------------------------------
IMDH1_HUMAN           LHSYEKRLY------------------------------
IMDH3_DANRE           LHSFEKRLY------------------------------
IMDH1_DANRE           LHSYSFLPFTRNGYIEPGSRGHPRAGPNVPSPAVTKHSS
IMDH1_XENTR           LHSYEKRLY------------------------------
IMDH2_HUMAN           LHSYEKRLF------------------------------
IMDH2_MOUSE           LHSYEKRLF------------------------------
IMDH2_RAT             LHSYEKRLF------------------------------
IMDH2_BOVIN           LHSYEKRLF------------------------------
Q5F4A4_CHICK          LHSYEKRLF------------------------------
IMDH2_XENTR           LHSYEKRLF------------------------------
IMDH2_DANRE           LHSYEKRLF------------------------------
A7RG06_NEMVE          LHSYEKRLF------------------------------
A7REY1_NEMVE          LHSYEKRLY------------------------------
A9VB34_MONBE          LHSYEKRLY------------------------------
Q16WB3_AEDAE          LFSYEKRLF------------------------------
W5JN05_ANODA          LFSYEKRLF------------------------------
IMDH_DROME            LFSYEKRLF------------------------------
Q29IQ0_DROPS          LFSYEKRLF------------------------------
E0VEZ4_PEDHC          LFSYEKMLF------------------------------
E0VCU3_PEDHC          LNFMSLIHSTL----------------------------
C0NBC7_AJECG          LHSFDKKLYS-----------------------------
IMDH_ASPFU            LHSYDKKLYS-----------------------------
Q0V6E3_PHANO          LHSFDKKLYS-----------------------------
I1RBE4_GIBZE          MESYEKKLYA-----------------------------
C7YID4_NECH7          MESYEKKLYA-----------------------------
IMDH_NEUCR            MESYEKKLYA-----------------------------
A7F2A7_SCLS1          MESYEKKLYA-----------------------------
D5GG57_TUBMM          LHDFNKKLYS-----------------------------
IMDH_CANAL            LHSYEKRLHN-----------------------------
IMDH_CANAX            LHSYEKRLHN-----------------------------
C4YIV3_CANAW          LHSYEKRLHN-----------------------------
IMDH3_YEAST           LHSYEKRLHN-----------------------------
IMDH2_YEAST           LHSYEKRLHN-----------------------------
IMDH4_YEAST           LHSYEKRLYN-----------------------------
Q6C897_YARLI          LHSYEKRLHN-----------------------------
A8NJG1_COPC7          LNSYTKRLFST----------------------------
IMDH_CRYNJ            LNSYTKRLFA-----------------------------
IMDH_PNECA            LDSYQKKLWS-----------------------------
IMDH_SCHPO            FATYEKRLY------------------------------
IMDH_LEPIN            LYSFSAPTMRAE---------------------------
IMDH_DICDI            LFSYEK------HFI------------------------
D0N723_PHYIT          LHTYEKPRFLYLQYIVHRAENCMVMKANT----------
B8BZC2_THAPS          LHSYQKRLF------------------------------
IMDH1_ARATH           LVSYEKKSF------------------------------
IMDH2_ARATH           LVSYEKKSF------------------------------
IMDH_VIGUN            LVSYEKKYY------------------------------
C5WZ26_SORBI          LVSYEKKAF------------------------------
C5X9F2_SORBI          LVSYEKKAF------------------------------
A9RU40_PHYPA          LVSYEKRRF------------------------------
A9TN21_PHYPA          LVSYEKRRF------------------------------
Q4UCL4_THEAN          TINNPK---------------------------------
Q4N0C9_THEPA          SITNPK---------------------------------
A7AR77_BABBO          KLMMINQS-------------------------------
A0A113RHB4_PLABE      NLIFNTKK-------------------------------
Q7RIL8_PLAYO          NLIFNTKK-------------------------------
A0A384L7F5_PLAKH      NLIFTNKKFTP----------------------------
A5K6S2_PLAVS          NLIFTNKKFTP----------------------------
Q8I2U5_PLAF7          NLIFNNKKFTT----------------------------
IMDH_HALSA            EAPNYSPQGE-----------------------------
Q2FS86_METHJ          EAPNYRI--------------------------------
IMDH_METJA            EAPNYPLGK------------------------------
O26245_METTH          --PRPPHNQ------------------------------
IMDH_PYRFU            EAPNYPLER------------------------------
IMDH_PYRHO            EAPNYPLEKF-----------------------------
Q5JFM0_THEKO          EAPNYPLGK------------------------------
Q8TV01_METKA          EAPNYPISNQ-----------------------------
IMDH_THEAC            EPPNYQISNISP---------------------------
A0QSU3_MYCS2          EAPNYYTR-------------------------------
IMDH_MYCTU            EAPNYYAR-------------------------------
Q8NSR5_CORGL          EAPNYH---------------------------------
Q9L0I7_STRCO          EAPNYSRSK------------------------------
IMDH_BIFLO            EAPNYSGFHNN----------------------------
Q7VVM3_BORPE          EAPNYRAD-------------------------------
Q63T40_BURPS          EAPNYHVD-------------------------------
Q5F8H4_NEIG1          EAPNYHR--------------------------------
Q9JZB5_NEIMB          EAPNYHR--------------------------------
Q9HXM5_PSEAE          EAPNYRVG-------------------------------
Q83BZ5_COXBU          ESPNYSVEE------------------------------
Q8P8Q5_XANCP          EPPNYRAG-------------------------------
Q5NFC2_FRATT          EPPNYQS--------------------------------
IMDH_ECOLI            ESPNYRLGS------------------------------
Q32D54_SHIDS          ESPNYRLGS------------------------------
Q8ZN59_SALTY          ESPNYRLGS------------------------------
IMDH_YERPE            ESPNYRMM-------------------------------
IMDH_HAEIN            EAPNYRMG-------------------------------
Q9KTW3_VIBCH          EAPNYRLG-------------------------------
Q5E764_ALIF1          EAPNYRLG-------------------------------
Q8EC51_SHEON          EAPNYRSGS------------------------------
Q89N70_BRADU          ESPNYPGGG------------------------------
Q9A7V2_CAUVC          EAPNYPSAV------------------------------
Q2RXU6_RHORT          EAPNYRGGM------------------------------
Q3J2F5_RHOS4          ESPNYRLG-------------------------------
IMDH_CHLTE            EAPNYSTSA------------------------------
A0A4Y7QN78_9BACI      EAPNYSL--------------------------------
Q81JC8_BACCR          EAPNYSL--------------------------------
IMDH_BACSU            ESPNYTIS-------------------------------
Q926Y9_LISMO          EAPNYSIS-------------------------------
IMDH_STAA8            ESPNYSF--------------------------------
Q8DMX2_STRR6          EAPNYSM--------------------------------
IMDH_STRPY            EAPNYSVH-------------------------------
Q9CIY6_LACLA          EAPNYSVQ-------------------------------
Q82YY8_ENTFA          EAPNYSVQ-------------------------------
Q97FM8_CLOAB          EAPNYSVNQ------------------------------
A5I721_CLOBH          EAPNYSVNQ------------------------------
Q8RE86_FUSNN          EAPNYSK--------------------------------
Q2RJG7_MOOTA          EAPNYRIS-------------------------------
D1B5E0_THEAS          EAPNYWLE-------------------------------
Q8A126_BACTN          ESPNYSRPE------------------------------
A6H0L3_FLAPJ          EAPNYSR--------------------------------
Q2S2G2_SALRD          ESPNYYSGPSKRSD-------------------------
Q72D85_DESVH          EAPNYRVEN------------------------------
Q1IS88_KORVE          EAPNYRVE-------------------------------
Q74B47_GEOSL          EAPNYRVENVR----------------------------
Q9RT87_DEIRA          EAPNYGGR-------------------------------
Q5SL61_THET8          EAPNYSR--------------------------------
A9WEU7_CHLAA          QAPNYGGRQ------------------------------
IMDH_AQUAE            EAPNYWVD-------------------------------
Q9X168_THEMA          ESPNYWVQA------------------------------
B8DZU8_DICTD          EAPNYSISTWENH--------------------------
B5YHZ0_THEYD          ESPNYWVED------------------------------
Q0P9J4_CAMJE          EAPNYKVNHQ-----------------------------
IMDH_HELPY            EAPNYYG--------------------------------
IMDH_RHOBA            EAPNYSPDVHSGDAG------------------------
IMDH_TRIFO            RINDYHPK-------------------------------