CLUSTAL format seed alignment for MF_01965

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NNRD_DICDI       ------------------------------------------------------------
NNRD_POLPP       MFCIIHFGNPKNDKFLGSSTLYSQKLKTNNIKILCLQVFYYNIYESTNNNNNNKNKNKTL
NNRD_ARATH       ------------------MLVKPSIISGLVRLTSHSPSSSSSVLRRQEFLVRTLCGSP--
NNRD_VITVI       ------------------------------------MLASSAVFRRQEFLIRCLGVGG--
NNRD_SORBI       --------------MSRPTGACPHAWRHQQQPLRGRMWAASPAFRRQLVLLRSLLPSPPA
NNRD_PHYPA       ------------------------------------MGGNSTELQK--------------
NNRD_ENTHI       ------------------------------------MGGQLS------------------
NNRD_BOVIN       ---------------------------------------------MALGPGCRAVRGCRP
NNRD_CANLF       ---------------------------------------------MAARAGPRAALAGAA
NNRD_HUMAN       ---------------------------------------------MVTRAGAGTAVAGAV
NNRD_MACMU       ---------------------------------------------MVTRAGAGAAVAATA
NNRD_MOUSE       -------------------------------------------------MAVHACGAAAA
NNRD_RAT         -------------------------------------------------MAVCPYGAAAV
NNRD_DANRE       ---------------------------------------------MNLLKRATFIFSEQP
NNRD_IXOSC       ------------------------------------------------------------
NNRD_AEDAE       ------------------------------------------------MVLKLFLSKRPI
NNRD_ANODA       ------------------------------------------------------------
NNRD_DROME       ------------------------------------------------------------
NNRD_DROPS       ------------------------------------------------------------
NNRD_CIOIN       ---------------------------------MSTILFYTRALIIGATKSQGVFGKTGT
NNRD_NEMVE       -----------------------------------MGAWRNTRFIRSLSSVKRYRARFSY
NNRD_PEDHC       ------------------------------------------------------------
NNRD_CAEBR       ------------------------------------------------------------
NNRD_CAEEL       ------------------------------------------------------------
NNRD_BATDJ       ------------------------------------------------------------
NNRD_EMENI       ------------------------------------------------------------
NNRD_ASPFU       ------------------------------------------------------------
NNRD_AJECG       ------------------------------------------------------------
NNRD_FUSV7       ------------------------------------------------------------
NNRD_NEUCR       ------------------------------------------------------------
NNRD_PHANO       ------------------------------------------------------------
NNRD_SCHPO       ------------------------------------------------------------
NNRD_CANAL       ------------------------------------------------------------
NNRD_CANAW       ------------------------------------------------------------
NNRD_YEAST       ------------------------------------------------------------
NNRD_COPC7       ------------------------------------------------------------
NNRD_CRYNJ       ------------------------------------------------------------
NNRD_USTMA       ------------------------------------------------------------
NNRD1_PUCGT      ------------------MVLTTRHHLDGFRSIQVMLGALEHPLDVMKASKGRSCSENDH
NNRD2_PUCGT      ------------------------------------------------------------
NNRD_PHATC       ------------------------------------------------------------
NNR_MYCTU        ------------------------------------------------------------
NNR_SYNY3        ------------------------------------------------------------
NNRD_NEIG1       ------------------------------------------------------------
NNRD_NEIMB       ------------------------------------------------------------
NNRD_BORPE       ------------------------------------------------------------
NNR_ECOLI        ------------------------------------------------------------
NNRD_ENTFA       ------------------------------------------------------------
NNRD_LACPL       ------------------------------------------------------------
NNRD_STAA8       ------------------------------------------------------------
NNRD_LACLA       ------------------------------------------------------------
NNRD_STRR6       ------------------------------------------------------------
NNRD_LISMO       ------------------------------------------------------------
NNRD_CENSY       ------------------------------------------------------------
NNRD_NITMS       ------------------------------------------------------------
NNRD_HALTV       ------------------------------------------------------------
NNRD_NATMM       ------------------------------------------------------------
NNRD_FLAPJ       ------------------------------------------------------------
NNRD_RHOBA       ------------------------------------------------------------
NNRD_BACSU       ------------------------------------------------------------
NNRD_XANCP       ------------------------------------------------------------
NNR_THEMA        ------------------------------------------------------------
NNR_HELPY        ------------------------------------------------------------
                                                                             

NNRD_DICDI       ----------------------------------MTHLIDLFKPMIPSLLNNLHKGQSG-
NNRD_POLPP       LLNNIRTYSTLSKGALSTTTTATTKKMSMDDSFELPTNLNHFLSYVPSLEYHMHKGQCG-
NNRD_ARATH       ------------------IIRAMSSTS-------EADAESVLRTVTPSLDLKRHKGQAG-
NNRD_VITVI       ------------------QSQQFYRKSIPRTMALEADAENILRAITPTLDLARHKGQAG-
NNRD_SORBI       PSSVAGFPPSCPSCSSFLRVRTNHAMAASAGTVYEADAEAVVRRITPPLDRARHKGQAG-
NNRD_PHYPA       -------------------------------------ILPALEKVVPVLAPGRHKGQAG-
NNRD_ENTHI       -------------------------------------IEARLKSIIPQLTFDSHKGACG-
NNRD_BOVIN       ------------------VLKRAFSLHKAHSVKDMESILQLVRSVVPALTTKKHKGQDG-
NNRD_CANLF       AVALLSAALVLYELPPGAVLQRAFSLHKAHSVEDMENTLQLVRNIIPPLTTKKHKGQDG-
NNRD_HUMAN       VVALLSAALALYGPPLDAVLERAFSLRKAHSIKDMENTLQLVRNIIPPLSSTKHKGQDG-
NNRD_MACMU       VVALLSAALALYRPPLDAVLERAFSLRKVHSIKDMENTLQLVRNIIPPLSSTKHKGQDG-
NNRD_MOUSE       VVALLSAAIALQWSPLYAVLQRALSLHTAHATKDMENLFQLVRNIVPALTSKKHKGQDG-
NNRD_RAT         VMALLSAAIAFHCSPLLAVLQRALSLHTAHATKDMDNLFQLVRNIVPALTSKKHKGQDG-
NNRD_DANRE       -------------LSLAIVIERSFSLGSS----GMDNVIPLVRNTIPPLTSKKHKGQDG-
NNRD_IXOSC       --------------------------MVPHVPEGCSVQQQLVCSVIPPLNSERRKGQAG-
NNRD_AEDAE       FLHPHCVSSSCRNSDTTIRLSRRIATMSEN----KSPLLERARNIVPHLETHRHKGQAG-
NNRD_ANODA       -------------------------MSSEN----KSPLLERARNLVPHLETERHKGQAG-
NNRD_DROME       --------------------MAAVSDIPVH----LPKLLALFKTVVPKLVNNKHKGQYG-
NNRD_DROPS       --------------------MSAIKEIPVN----LPKLLTLFKTIVPKLTNDKYKGQYG-
NNRD_CIOIN       LVANISSNRGIISIVPRTNPPQKLLKMQEE----ENSLLEEARKVVPALSFGKHKGQAG-
NNRD_NEMVE       YSLFGGEPRACMAEKRSRSPLPAQRQIHVHNRQQEAQLLQSAKNVIPSLEETFHKGVAG-
NNRD_PEDHC       --------------------------------MSNCKYAGKIKEFIPKLTPTLHKGQCG-
NNRD_CAEBR       --------------------------------------MDHFLKLLPKLTPQLRKGDCG-
NNRD_CAEEL       --------------------------------------MDHFIKLLPKLTPHLRKGDCG-
NNRD_BATDJ       -----------------------------------MAAREVFKRVIPPLSTRLHKGQSG-
NNRD_EMENI       ------------------------MANVHHISVPSKVLFQKARKLVPPMLEKFHKGQQG-
NNRD_ASPFU       -------------------------MEPVHVSTSSKVLFKKVRKIVPPLLEKFHKGQHG-
NNRD_AJECG       ------------------------------MSSPSKKLLANVRRIVPPMLERFHKGQLG-
NNRD_FUSV7       --------------------MSTED---LNMSAATKNVLAKVRRIIPPMLESFHKGQLG-
NNRD_NEUCR       --------------------MSSESSTGPEMSATTKQMLARVRQMVPPMLEKFHKGQLG-
NNRD_PHANO       -----------------------------MASATRKDLLKKVYNMVPPMLESFHKGQLG-
NNRD_SCHPO       ---------------------------MTSGSPKITNLLTRVKRIIPPLLDTFHKGQAG-
NNRD_CANAL       ---------------------------MLRNKSQKELLHLS-RQLIQPLLPNFHKGQAG-
NNRD_CANAW       ---------------------------MLRNKSQKELLHLS-RQLIQPLLPNFHKGQAG-
NNRD_YEAST       ---------------------------MLAELSHRELIKLAQKRCIPPLLPKFHKGQSGG
NNRD_COPC7       -------------------------------MPIPRTIIEQIKRIIPPLDGSLHKGQSG-
NNRD_CRYNJ       -----------------------------MASKQHAHILSLARSMIPPLHPKLHKGQAG-
NNRD_USTMA       ---MSTSAAPGKLATTLGANVSSLASKVRSTSSTQQSLMQSVKRIIPPLSSAKHKGQAG-
NNRD1_PUCGT      RMYRFSKNLPRGVCSPLTTGPHPTTHLEPTMHQPHRSLLRKAFQMIPPLDGSLHKGQAG-
NNRD2_PUCGT      ----------MMVHSPLATGPHPTTHLEPTMHQPHRSLLRKAFQMIPPLDGSLHKGQAG-
NNRD_PHATC       ------------------------------MKTWNDGKTIAIERCVLPLDASLHKGSSG-
NNR_MYCTU        --------------------------------------<DVAARWPVPGPR-DDKYTQG-
NNR_SYNY3        ------------------------------<PVQVLGADQAQQTLPLSRPLVTHKYQQG-
NNRD_NEIG1       --------------------MFPVFHLSGESRRRMLQTALRFPHVFKARAEDSHKGTFG-
NNRD_NEIMB       --------------------MFPVFHLSGESRRQMLQTALRFPHVFKARAEDSHKGTFG-
NNRD_BORPE       -------------------------MDTPTSSSLPAIERQHLPALFAARPTDAHKGSCG-
NNR_ECOLI        -----------------------------------<FSAEQLSHWLKPRRPTSHKGDHG-
NNRD_ENTFA       --------------------------------MRYLSKDILEEV-ITQRPSDSYKSNFG-
NNRD_LACPL       --------------------------------MQPITTEIVSRT-IIKRPADSHKGNYG-
NNRD_STAA8       -------------------------------MGGYITMETLNSINIPKRKEDSHKGDYG-
NNRD_LACLA       --------------------------------MIELTDEILAKV-IKKRKKASYKGTYG-
NNRD_STRR6       --------------------------------MKVINQTLLEKV-IIERSRSSHKGDYG-
NNRD_LISMO       --------------------------------MKKITPKAMCAW-IPKREDETHKGDYG-
NNRD_CENSY       -------------------------------MAARMIGEDDVRKFVPSRRRDSRKGENG-
NNRD_NITMS       -------------------------------MARKTLTTALVKKFIPSRKSKSRKGENG-
NNRD_HALTV       ---------------------------------------MGRLQRTLSNISEE-EIDNG-
NNRD_NATMM       ---------------------------------------MGRLQRTLSNISEESDTDNG-
NNRD_FLAPJ       ------------------------------MRDFCQIDTQEIIKRYKPIDKYTHKGLQG-
NNRD_RHOBA       ------------------------------MPSIETQSTSPPPLRIPHREASAHKGNFG-
NNRD_BACSU       -------------------------------MNVPFWTEEHVRATLPERDAESHKGTYG-
NNRD_XANCP       -----------------------------MTGPRVRTVTAAALRAQPLPAPGGDKEQRG-
NNR_THEMA        ------------------------------------<TREMVRSLLPERPRDSHKGTYG-
NNR_HELPY        ------------------------------------<LEKSDLKLPLRDRKNAHKGDYGH
                                                                       .   * 

NNRD_DICDI       RIAIMGGSKEYTGAPFFSGISSLKIGSDICHIFAPTEGGTATALKTMSPDLIVHPIEKN-
NNRD_POLPP       RIGVFGGSAEYTGAPFFAGITSLRLGADIVHIFAPSEGGTATAIKTLSPELIVHPLDQQM
NNRD_ARATH       KIAVIGGCREYTGAPYFAAISALKIGADLSHVFCTKD--AAPVIKSYSPELIVHPVLEES
NNRD_VITVI       KIAVIGGCREYTGAPYFSAISALKIGADLSHVFCTKD--AAPVIKSYSPELIVHPLLEES
NNRD_SORBI       KIAVIGGCREYTGAPYFAAISALKVGADLSHVFCTKD--AATVIKSYSPELIVHPILEES
NNRD_PHYPA       KIAVIGGCREYTGAPYFAAISALKMGADLAHVFCTSG--AATVIKSYSPELIVHPVLHES
NNRD_ENTHI       KVAIIGGSVEYTGAPYFSGISALRVGCDLAHIFCHQD--AAIAIKSYSPELIVHPFFKED
NNRD_BOVIN       RIGVVGGCREYTGAPYFAAISALKVGADLSHVFCTQE--AAPVIKAYSPELIVHPVLDSP
NNRD_CANLF       RIGVVGGCQEYTGAPYFAAISAHKVGADLSHVFCTRE--AAPVIKSYSPELIVHPVLDSP
NNRD_HUMAN       RIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASA--AAPVIKAYSPELIVHPVLDSP
NNRD_MACMU       RIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASA--AAPVIKAYSPELIVHPVLDSP
NNRD_MOUSE       RIGIVGGCQEYTGAPYFAGISALKVGADLTHVFCARE--AAPVIKSYSPELIVHPVLDSS
NNRD_RAT         RIGIVGGCQEYTGAPYFAGISALKVGADLTHVFCARE--AAPVIKSYSPELIVHPVLDSS
NNRD_DANRE       RIGIIGGCQEYTGAPFFAAISALKVGADLSHVFCTKD--AAPVIKSYSPELIVHPVLDSP
NNRD_IXOSC       RVGIVGGSAEYTGAPYFAAMAALRTGADLVHVFCHPS--AATAIKAYSPELIVHPTLDAA
NNRD_AEDAE       RIGIVGGSLEYTGAPYFAAISALKVGADLVHVFCLQA--AAQVIKSYSPELIVHPLLDSN
NNRD_ANODA       RIGIVGGSLEYTGAPYFAAISALKVGADLVHVFCPQA--AAQVIKGYSPELIVHPLLDSN
NNRD_DROME       RIGVIGGSLEYTGAPYFAAISSIRVGADLAHVFCHSN--ASAIIKSYSPDLIVHPVLDCV
NNRD_DROPS       RIGVIGGSLEYTGAPFFAAISSMKVGADLSHVFCQAN--AAPVIKSYSPDLIVHPVLDCL
NNRD_CIOIN       RVGVIGGSEEYTGAPYFAAISAMKAGADLAHVFCSKS--ASTVIKSYSPELIVHPLLDVP
NNRD_NEMVE       RIGVIGGCQEYTGAPYFAAISALKTGADLSHVFCTSD--SASVIKSYSPELIVHPLLDRT
NNRD_PEDHC       RIGIIGGSAEYTGAPYFAAISALKLGADLVYVFCCKE--AGPVIKSYSPELIVLPILDSG
NNRD_CAEBR       KIAVIGGSLEYTGAPYYAASSVSRLGADLIHVFCAPD--AAPVIKGYSPDLIVHPGMNA-
NNRD_CAEEL       KMGVIGGSLEYTGAPYFAASSASRLGADLIHIFCDPD--AAQVIKGYSPDLIVHPGMTA-
NNRD_BATDJ       RIGVVGGSLEYTGAPYYAAMAALYTGVDLCHVFCAQD--AAPAIKCYSPELVVHPSIVSK
NNRD_EMENI       RVAVIGGSLDYTGAPYFSAMASARLGCDLSHVICESS--AATVIKSYSPNLMVHPILPSS
NNRD_ASPFU       RVAVIGGSLDYTGAPYFSSMASARLGMSSNHVICEKS--AATVIKSYSPNLMVHPLLPST
NNRD_AJECG       RVAVIGGSAEC--APHISLQWHLQ---GLSHVICEPS--SATVIKSYSPNLMVHPILQSS
NNRD_FUSV7       RVAVIGGSENYTGAPYFSAMASARLGCDMSHVICTPA--AATVIKSYSPNLMVHPLMRQS
NNRD_NEUCR       RVAVIGGSEDYTGAPYFSAMASARLGADLSHVICTPN--AAQVIKTYSPNLMVHPLMRSS
NNRD_PHANO       RVAVIGGSEDYTGAPYFSAMASAKLGCDMSHVICEPG--AGAVIKTYSPNLMVHPYMRQS
NNRD_SCHPO       RVGVFGGCQHYTGAPYYSSMSSMLFGSDQSHIFCEKE--AANVIKSYSPDLIVHPFLREK
NNRD_CANAL       KIVVIGGNEDYTGAPFFASHSAALVGADLSHVICEKA--AGPVIKSYSPDLMIHPYLMDL
NNRD_CANAW       KIVVIGGNEDYTGAPFFASHSAALVGADLSHVICEKA--AGPVIKSYSPDLMIHPYLMDL
NNRD_YEAST       RVCIIGGCEDYTGAPYFSANATALMGCDLTHVICEYN--AGTVIKSYTPNLMVHPYL-RM
NNRD_COPC7       RVGVLGGALDYTGAPFFAAFSALRFGVDLSHVICAPT--AAGAIKSYSPDLIVHPILNES
NNRD_CRYNJ       RIGVLGGSGDYSGAPYFSSMGAMRFGADLAHVICEPS--AGAVIKTYSPDLIVHTILDPQ
NNRD_USTMA       RIGIVGGSRDYTGAPFFASMSSMRFGCDMSYTICTPE--AGNVIKTYSPDLIVNRLLDAS
NNRD1_PUCGT      RIGIVGGSKDYTGAPFYSGYASLRLGSDLSHVICEPS--ASTVIKTYSPDLMVHSYLSSP
NNRD2_PUCGT      RIGIVGGSKDYTGAPFYSGYASLRLGSDLSHVICEPS--ASTVIKTYSPDLMVHSYLSSP
NNRD_PHATC       RVGVLGGSARYTGAPYYAAMASLQAGADLAFVFCAQE--ATLPIKSYSPELMVAPVYSAS
NNR_MYCTU        VTGVLAGSSTYPGAAVLCTGAAVAATSGMVRYAGTAH--AEVLAHW--------------
NNR_SYNY3        HLLLICGSQQYAGGALLTTLGARASGVGMVTVAVPMG--IKALLHSQCPEVLVKGL----
NNRD_NEIG1       TLAVVGGSAGMSGAPVLAASAAMYLGCGKVRAGF-NQ--DTLPFAVIAGFPEI-------
NNRD_NEIMB       TLAVVGGSAGMSGAPVLAASAAMYLGCGKVWAGF-NQ--DTLPFAVIAGFPEI-------
NNRD_BORPE       TLGVIGGGPGMVGAALLAARAGLKVGAGKVLVGL-VA--DTPPLPCDPMQPEL-------
NNR_ECOLI        RLVIIGGDHGTAGAIRMTGEAALRAGAGLVRVLTRSE--NIAPLLTARPELMV-------
NNRD_ENTFA       RVVLIGGNRQYGGAIIMSTEACINSGAGLTTVITDVK--NHGPLHARCPEAMV--V----
NNRD_LACPL       RIMLIGGNQNFGGAIIMAATAATYSGAGLVTVATDPS--NFTSLHARLPEAMV--I----
NNRD_STAA8       KILLIGGSANLGGAIMLAARACVFSGSGLITVATHPT--NHSALHSRCPEAMV--I----
NNRD_LACLA       RLLVIGGNRQYGGAAILVTTSAVYSGAGLVSVALAKE--NHSALQARLPEAMT--L----
NNRD_STRR6       RLLLLGGTYPYGGAIIMAALAAVKNGAGLVTVGTDRE--NIPALHSHLPEAMA--F----
NNRD_LISMO       RVLIVAGNKQFGGAAIMAAEACVKSGAGLTTVASDSV--NRPALQTRIPECMF--I----
NNRD_CENSY       KVLVVGGSYIYHGAPIFSSVAALRSGCDLVYTAVPKI--NAPATRAASPSMIVIPLADQK
NNRD_NITMS       IVLVVGGSYIYHGAPILSSIAALRSGTDLVYTSVPKI--NVASTRSVSPNLIVIPLVDQK
NNRD_HALTV       RIGIVAGAIEYPNQPALVGRAALRTGSDHVRALVADP--IYEIVAGQDPNLLVDRYAGEQ
NNRD_NATMM       RVAVVGGSIEYPNQPALVGRAALRTGTDHVRTLVPEA--LYAPVAGSSPNLLVSPYDGDQ
NNRD_FLAPJ       HALIIGGSYGKMGSVVLASKACIRSGAGLVTAYIPKC--GCDIVQISVPEVMVITDDYLE
NNRD_RHOBA       RVLLIGGSRGMAGSIALSSIAALHTGSGLVAAAVPDC--ILDCVAGFHPALMTIGLGDDG
NNRD_BACSU       TALLLAGSDDMPGAALLAGLGAMRSGLGKLVIGTSEN--VIPLIVPVLPEATYWRDGWKK
NNRD_XANCP       RVLIVGGSARVPGAVMLAGEAALRAGAGKLQLATAAS--VAPGMALAMPEALVLGLGENG
NNR_THEMA        KVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFP--QNLIATSRFPELISVPIDTEK
NNR_HELPY        AHVLLG---KHSGAGLLSALSALSFGSGVVSVQALEC----EITSNNKPLELVF------
                    :.                      .                                

NNRD_DICDI       DPSD---------------------------------------IIPWLLSLHVIVVGPGL
NNRD_POLPP       DPST---------------------------------------IIPWLLSIHVLIIGPGL
NNRD_ARATH       YSISQLSEEDKREV----------------------QDKVLGEVGKWMERFDCLVIGPGL
NNRD_VITVI       YSVR---EEDKKAI----------------------SEKVLTEVVKWMERFDCLVVGPGL
NNRD_SORBI       YSVR---DDERASV----------------------SSKILTEVGKWMERFDCIVVGPGL
NNRD_PHYPA       YDVGEIGEEEISGL----------------------KDKVLAEVGKWLQRFDCIVIGPGL
NNRD_ENTHI       YDTN--------------------------------------EVLKWLDTVQALVVGPGL
NNRD_BOVIN       EAVR--------------------------------------DVEQWLPRLHALVVGPGL
NNRD_CANLF       SAVH--------------------------------------DVEEWLPRLHALVVGPGL
NNRD_HUMAN       NAVH--------------------------------------EVEKWLPRLHALVVGPGL
NNRD_MACMU       SAVD--------------------------------------EVEKWLPRLHALVFHCER
NNRD_MOUSE       NAVE--------------------------------------EVEKWLPRLHALVVGPGL
NNRD_RAT         DAVE--------------------------------------EVEKWLPRLHALVVGPGL
NNRD_DANRE       NAVE--------------------------------------EIEKWLPRLHSVVVGPGL
NNRD_IXOSC       --------------------------------------------VTCLPRLHAVVVGPGL
NNRD_AEDAE       DATM--------------------------------------QIEPWLERLHVLVIGPGL
NNRD_ANODA       NAII--------------------------------------QIEPWLERLHVLVIGPGL
NNRD_DROME       DAVE--------------------------------------RIAPWLERLHVVVIGPGL
NNRD_DROPS       DAVD--------------------------------------KIQPWLERLHVIVIGPGL
NNRD_CIOIN       NAVT--------------------------------------LLDEWLPRIHSHVIGPGL
NNRD_NEMVE       FAVN--------------------------------------EISEWLSRLHCLVVGPGL
NNRD_PEDHC       NVTE--------------------------------------KIENWLTRLHALVIGPGL
NNRD_CAEBR       -----------------------------------------SSILPKLNRMDAIVVGPGL
NNRD_CAEEL       -----------------------------------------NSIIPKLSRMDAIVIGPGL
NNRD_BATDJ       RDCEHLNPVAIDNC----------------------IETAVDRMSPLLCRLDSLVVGPGL
NNRD_EMENI       ASVKDPSS--------------------------IDAPSLASPIIAMLGRLHALVIGPGL
NNRD_ASPFU       DSVSNPGS--------------------------IDARALASPIVSMLSRLHALVIGPGL
NNRD_AJECG       NTVSSFSNS---------------------PLPHPHARALAEPVLSFLSRLHVLVIGPGL
NNRD_FUSV7       PAPNPNQDP---------------ATRDTSKDPDSDPEHISAQIIDLLPRLHVLVVGPGL
NNRD_NEUCR       PPALSSSDSG-------------SSPSRTKSAPDTDPSQIAAQIIPMLDRLHVLVIGPGL
NNRD_PHANO       ----------------------------KNVGQNENIESIKSEVVAMLSRLHVVVIGPGL
NNRD_SCHPO       DKAGPEDS----------------------------VDKCFELIKPMMGRLHAIVIGPGL
NNRD_CANAL       DNPHLNLNNSELEKLKNLPIDEIIKTNDNAVLNKLIDELILPKVTSLLNRIDIVVVGPGF
NNRD_CANAW       DNPHLNLNNSELEKLKNLPIDEIIKTNDNAVLNKLIDELILPKVTSLLNRIDIVVVGPGF
NNRD_YEAST       SNTKLDVDMDEQRK----------------------------KINSLLDRIHVVVIGPGL
NNRD_COPC7       SS----------------------------------VDKVKSELQSLLSRLHVLVVGPGL
NNRD_CRYNJ       KS----------------------------------REDIRSALKGVMSRLHVLIIGPGL
NNRD_USTMA       VE----------------------------------WSQVERSVDELFARFHAVVIGPGL
NNRD1_PUCGT      KEPEA-------------------------------YASHQNLFEQLLDRLHVLVVGPGL
NNRD2_PUCGT      KEPEA-------------------------------YASHQNQFEQLLDRLHVLVVGPGL
NNRD_PHATC       DFDPVR-----------------------------LVDDMVNEIGDMLPKLHCLVVGPGL
NNR_MYCTU        ----------------------------------------PEVIASPTPAAAGRVQAWVV
NNR_SYNY3        ------------------------------------LETPSGAIAGLGNLDLSRYSAVAL
NNRD_NEIG1       ------------------------------------MLDTADGLTKR-QGINAWTAGCGL
NNRD_NEIMB       ------------------------------------MLDTADSLAKR-QDINAWVVGCGL
NNRD_BORPE       ------------------------------------MLRDFRGLLEAGLGIDAWTAGCGC
NNR_ECOLI        ------------------------------------HELTMDSLTESLEWADVVVIGPGL
NNRD_ENTFA       ------------------------------------GFEETVLLTNVVEQADVILIGPGL
NNRD_LACPL       ------------------------------------DYHQTDTLLNLLAGMDVIVIGPGL
NNRD_STAA8       ------------------------------------DINDTKMLTKMIEMTDSILIGPGL
NNRD_LACLA       ------------------------------------DFDDLIKLREVAKAADVIVIGPGL
NNRD_STRR6       ------------------------------------ALQDKQLLKEQLEKAEVVLLGPGL
NNRD_LISMO       ------------------------------------DYENITSLSEQISQFDTILIGPGL
NNRD_CENSY       LT----------------------------------RGAARKLAGQIPTGLDSATIGMGL
NNRD_NITMS       LT----------------------------------RGAVNKLLGALPRKLDSATIGMGL
NNRD_HALTV       FE----------------------------------ESAVER-TREMSEWADALVIGPGL
NNRD_NATMM       FD----------------------------------QDAAAD-AVDICEWADALVIGPGL
NNRD_FLAPJ       HI----------------------------------------ALINFDLNLKSIGIGVGM
NNRD_RHOBA       EK---------------------------------FADPAWQSLKDRLSAQAAIGCGPGM
NNRD_BACSU       -----------------------------------------AADAQLEETYRAIAIGPGL
NNRD_XANCP       QGE---------------------------------IVRGHRALDAAMSACDAAVIGPGM
NNR_THEMA        GFFS---------------------------------LQNLQECLELSKDVDVVAIGPGL
NNR_HELPY        -------------------------------------------CENFPNLLSAFALGMGL
                                                                             

NNRD_DICDI       GRSSGAWSCASEVIKAARNI---NLPIVLDGDALRLICDNLD---II---KGY----DKA
NNRD_POLPP       GRSSIAWKSAKEVIKAARNI---NLPMVLDGDALRLICEDLE---LV---KGY----DKV
NNRD_ARATH       GRDPFLLECVSIIMLLAKKS---NVPFVIDGDGLFLVTNSID---LV---HSY----PLA
NNRD_VITVI       GRDPFLLGCVSEIMKHARQS---NVPIVIDGDGLFLVTNSLD---LV---SGY----PLA
NNRD_SORBI       GRDSFLLDCVSNIMRHARQA---NIPTVVDGDGLFLVTNNLS---LV---EGN----PLA
NNRD_PHYPA       GRDPILLDCVAAIIEEAKFK---NIPLVLDGDGLFLVTNQPE---LI---IGY----PLA
NNRD_ENTHI       GRDESVMEATLSILKQAITK---NIIIILDADGLFLINNHLD---LI---RGK----KNI
NNRD_BOVIN       GRDDALLENVKGILEASKAR---GIPVVIDADGLWLIAQQPA---LI---QGY----RKA
NNRD_CANLF       GRDNILLENVKGILEASKAR---DIPVIIDADGLWLIAQHPA---LI---QSY----QKA
NNRD_HUMAN       GRDDALLRNVQGILEVSKAR---DIPVVIDADGLWLVAQQPA---LI---HGY----RKA
NNRD_MACMU       GTQPGFL-FWQGILEASKAR---DIPVVIDADGLWLVAQQPA---LI---QGY----QKA
NNRD_MOUSE       GRDDLLLNNVRGILESTKAR---DIPVVIDADGLWLVAQQPA---LI---HSY----HKA
NNRD_RAT         GRDDLLLNNVRGILESTKAR---DIPVVIDADGLWLIAQRPA---LV---HGY----QKA
NNRD_DANRE       GREDMLLKNAKEIIERSKLR---GIPVIIDADGLWLVAKEPS---VI---QGY----QRG
NNRD_IXOSC       GRD-VEASWMPTLFNRIREQ---GLPVVVDADGLFYVTQNPD---LV---RGY----SRA
NNRD_AEDAE       GRDRLILQTVSELIKICRQL---QKPLVIDADGLFLITHDIS---LV---KDY----YGV
NNRD_ANODA       GRDRLILQTVAELIRICRQL---QKPLIIDADGLFLITQDIG---LV---KDY----YGV
NNRD_DROME       GREPGILKTASNVLKLCMDT---KKPVVIDADGLFLLNDNLN---LI---CGQ----PNV
NNRD_DROPS       GREPLILQTVTNVLKLCTKL---QKPIVIDADGLFILNDNID---LV---SGQ----RNI
NNRD_CIOIN       GRVDATLNTVKEILIKLKKQ---EIPIVIDADGLFLITRDPS---II---HGY----TKA
NNRD_NEMVE       GRNPTNLENAKRTIEKARKN---KKHLVIDADGIAVVTTYPE---II---KNYDSKKSKV
NNRD_PEDHC       GTKPVNIIRLCN--ERSKLS---VLPLIIDADGLRIVNDNLD---LI---KKY---HGPV
NNRD_CAEBR       GRNPTLWPLLQEIFNFVKNE---KVPFVIDGDGLWFVSEHIE---HF---PRQ---MVTT
NNRD_CAEEL       GRNPNIWPLMQELFEFVRNR---DVPFVIDGDGLWFVSEHIE---KF---PRQ---MSAT
NNRD_BATDJ       SRDPVMLAMAKRIVEKVISL---GTPLVIDADGLCLV-EQTP---GL---VMG---YQNV
NNRD_EMENI       GRDGVTLKVV---TEVMKEARSRSIPFVLDADGLLLVTENP---DLV---KGYKD----C
NNRD_ASPFU       GRDGVTLKVV---TEVMKEARSRSIPFVLDADGLLLVTEDP---NLV---KGYKD----C
NNRD_AJECG       GRDPVTQEIV---TEIIKEARSREIPLVLDADALLLVQEHP---DLI---HGYTE----C
NNRD_FUSV7       GRDPLMHATV---ARVIRAARNRGTPVVLDADALILVQKDP---GLV---RGYDG----A
NNRD_NEUCR       GRDPLMQETC---AKVITAAREKGIPMVLDADALLLVTKDP---SLI---KGYDN----A
NNRD_PHANO       GRDKLMQDTC---AEVIQEARKQGIPFVLDADGLYLAQTRP---ELV---DGCTE----C
NNRD_SCHPO       GRDEWMQEIM---AKVIEYARKNDMPMVIDADGLWLIQQRP---ELV---SGYHN----V
NNRD_CANAL       GRDPLMLKSL---IRIIEEVKVLNLPIILDADSLYLVSLSP---KII---ANYPK----A
NNRD_CANAW       GRDPLMLKSL---IRIIEEVKVLNLPIILDADSLYLVSLSP---KII---ANYPK----A
NNRD_YEAST       GRDPLMLKSIKDIIRYILEKHEGKIPLVIDADGLFLVTQDSEVKEML---KSYPKGR--V
NNRD_COPC7       GREPYMQSYARLAISLVRE---RGMYLVLDADALFLVGHDLSIIK------GYRRA----
NNRD_CRYNJ       GRDDHMQSCAKIAFELAKDM--EQMGVVVDADGLWLVQNEPKVVMDW---PGVPRI----
NNRD_USTMA       GRDEFMQKCAKLCIGLARK---HDMYLVVDADGLWLLQNEPDLIK------GYKKA----
NNRD1_PUCGT      GRDTEMQDWAEWTLKTAIK---KKLHLVLDADALWLLVKKPDLLR------GYPNA----
NNRD2_PUCGT      GRDTEMQDWAEWTLKTAIQ---KKLHLVLDADALWLLVKKPDLLR------GYPNA----
NNRD_PHATC       GRCPLVMKAVARVLELARSQ---QLHLVLDADALYMMSLPVY--------RSSLKGYDRL
NNR_MYCTU        GPGLGTDEAGAAALWFAL-D----TDLPVLVDADGLTMLADHPDLVAGRN-------APT
NNR_SYNY3        GPGLGSDVGPLVEEVLSV-N----CPLILDADGLNQLAQQQLLPLLAVRT-------APT
NNRD_NEIG1       GTDAAAVETVAAVLARNR-D----EAVVLDADALNILSTDAETRNLARGC-------KNL
NNRD_NEIMB       GTGRAAVGTLAGILTEHT-D----KPVVLDADALNILSTDAETRNLARGC-------KNL
NNRD_BORPE       GMDALAANALSELFQLRG-D----AALVLDADGLNLLAAGAVQAR--WGD-------APV
NNR_ECOLI        GQQEWGKKALQKVENFR-------KPMLWDADALNLLAINPDKRH-------------NR
NNRD_ENTFA       GLDATAQQILKMVLAQHQKQ----QWLIIDGSAITLFSQGNFSLTY---P-------EKV
NNRD_LACPL       GTDTVADQLLTAVLAATHVP----QRLVIDGSALTLLAQQARPLPA---T-------DIV
NNRD_STAA8       GVDFKGNNAITFLLQNIQPH----QNLIVDGDAITIFSKLKPQLP----T-------CRV
NNRD_LACLA       GLERL--DLLTEVLNLLTEN----QKLVIDGSALTLFAREHLDLPF---P-------ENT
NNRD_STRR6       GDNAFGEDLVKQVFAGLKQN----QILIVDGGALTILARTSLSFP----S-------SQL
NNRD_LISMO       GLDAYAEEIFRLVLQKSTEH----QQVIIDGDGITIYAKGENPHP----A-------AKL
NNRD_CENSY       -AIAERSALKVLVVALVDMD----VRISLDAGALVREILGDISGK-------------NC
NNRD_NITMS       -AIQEKNALLHLVKSLLDRD----VRLSLDASALIPEVLPLLANK-------------NV
NNRD_HALTV       -VDADPQAVCEAIDTI---D----VPMVVDALALEPSLDADLS---------------NA
NNRD_NATMM       -VDAEADAIRDVLERT---D----IPVVVDALAIEPALESDLS---------------RA
NNRD_FLAPJ       GQHPDTQHAFFNFLKSNK------LPLVIDADALNILSQNIEWLSLL---------PKKA
NNRD_RHOBA       TTGSGGATIVEGLLAKKD------LPLVLDADALNIIAQNDWLSDGR---FERSKADAAC
NNRD_BACSU       PQTESVQQAVDHVLTAD-------CPVILDAGALAKRTYPKRE--------------GPV
NNRD_XANCP       ASTNTTAALVKRAIDQAVCT------LVLDAGALSPRLRAPLG--------------RPF
NNR_THEMA        GNNEHVREFVNEFLKTLEKP------AVIDADAINVLDTSVLKERKS-----------PA
NNR_HELPY        ENIPKDFNKWLELAPCVLDA-----GVFYHKEVLQALEKEV-------------------
                                                                             

NNRD_DICDI       ILTPNFVEFKSLSDSVK------------------KMIGDTSNNLLKPEHIASCLGNITI
NNRD_POLPP       ILTPNFVEYRALSDAAK------------------KLNNDNSNNILSPSDLAKALGNVVI
NNRD_ARATH       VLTPNVNEYKRLVQKVL------------------NCEVDEQNAEDQLRSLAKQIGGVTI
NNRD_VITVI       VLTPNVNEYKRLVQKVL------------------NCEVGDQDAAEQLLSLAKGIGGVTI
NNRD_SORBI       ILTPNVYEYKRLVQKVL------------------NCDVDEETASEQLITLCQKIGDVTI
NNRD_PHYPA       ILTPNVMEHKRLVAKIVGERDQNVPQ---------NPEVSNEDLPGQLQDLAKRMEGVTI
NNRD_ENTHI       ILTPNVMEYRRL------------------------CDVLKVSHNTPCNKVALMLGGVTI
NNRD_BOVIN       VLTPNHVEFGRLSEAVLG------------------VPLDGGDRHGAVLRLSQALGNVTV
NNRD_CANLF       VLTPNHVEFNRLSEAVLS------------------HQVDGSDHHEAVRRLSQALGNVTV
NNRD_HUMAN       VLTPNHVEFSRLYDAVLR------------------GPMDSDDSHGSVLRLSQALGNVTV
NNRD_MACMU       VLTPNHMEFSRLYDAVLR------------------GPVDSDDRHGSVLRLSQALGNVTV
NNRD_MOUSE       ILTPNHVEFSRLWEAVLS------------------SPMDSNDLKGSTLKLSQALGNITV
NNRD_RAT         VLTPNHVEFSRLWDAVLS------------------SPMDTSNHSGSVLKLSQALGNITI
NNRD_DANRE       ILTPNFMEFTRLYEAMHH------------------EPLDSSDHKRSAQQLSIALGHLTL
NNRD_IXOSC       ILTPNAVELDRLYRAVLG------------------SPP----RENAVPELARALGHVTV
NNRD_AEDAE       ILTPNAIEFCRLFG---------------------------NDRDRIMQTLEKLGRGVTV
NNRD_ANODA       ILTPNAIEFCRLFG---------------------------KDRDQTMASLGRLGAGVTV
NNRD_DROME       ILTPNVMEFQRLFG---------------------------EDDQAARQKMSLLGAGVTV
NNRD_DROPS       ILTPNAMEFRRLFG---------------------------EDVNDVRQKMSCLGDGVVV
NNRD_CIOIN       ILTPNVVEFQRLSKSMNLN----------------WESKDLNGSIMETVALSKALGGVTI
NNRD_NEMVE       ILTPNVVEFDRLYTSV-MG----------------KAADPHGDSYEQARSLSQELGNVTI
NNRD_PEDHC       ILTPNEVEFKRLSSKFSN--------------------TEAINVASSLNSVLIQKGSTDV
NNRD_CAEBR       VLTPNIVEFSRLCKSALGEEDV-------------LNVKSSSQLQHLAAELSRKMDVTIY
NNRD_CAEEL       VLTPNIVEFSRLCKSALGEEDV-------------LNVRNNSQLQHLAAELSRKMNVTIY
NNRD_BATDJ       ILTPNTNEFKRLCHS--------------------VNIDASENCEVAAVQLSKALGSVTI
NNRD_EMENI       ILTPNVNEFSRLAKALNIEVPSLAQ-----ISSKES-GDKTSKEAEACEKLSQALGGVTI
NNRD_ASPFU       ILTPNVNEFSRLAKALGIEVPSQAQ-----IAAQTDESDKTSKESQACEQLSQALGGVTI
NNRD_AJECG       ILTPNVVEFARLAKALRADVSSMP--------------DSDAGKSEACKRLSNALGGVTI
NNRD_FUSV7       VLTPNVVEFAKLCEALKVD------------------VSEGASETARVEALAKTLEGVTV
NNRD_NEUCR       VLTPNVVEFGRLTKALGVDEEVEK-------------AEETAGETAKVEALAKALGGVMV
NNRD_PHANO       ILTPNVVEFGRLAKAKGVN-------------------VDEGDPSELCSKLAKAFGGVTI
NNRD_SCHPO       ILTPNVIEFKRLCDKLDIK----------------------SDGPDACNQLAGKLN-LLI
NNRD_CANAL       IITPNVVEFQRIAKALSIDADL--------------SESNKDKLIDQTIEVSRKLGDIIV
NNRD_CANAW       IITPNVVEFQRIAKALSIDVDL--------------SESNKDKLIDQTIEVSRKLGDIIV
NNRD_YEAST       ILTPNVVEFKRLCDAIGKKGD---------------SHSEMGSLIAQEL-------NCIV
NNRD_COPC7       VLTPNVVEFKRLSEQV------------------GVDPDAPPDE--RAGVVSRMLGGVTV
NNRD_CRYNJ       ILTPNVMEFKRLCDTMVGARTVLHLSPSTLINYQKINASGPHTS--LCPQLATALGNATI
NNRD_USTMA       ILTPNVAEFGRLCDTL------------------GIDCKQEPDS--AAKKLAQALEGPTV
NNRD1_PUCGT      ILTPNHVEFQRLLKAC------------------SIEPRENDDDGLLAMELSKALGGCSI
NNRD2_PUCGT      ILTPNHVEFQRLLKAC------------------SIEPREHDDDGLLAMELSKALGGCSI
NNRD_PHATC       VLTPNVVEYQRLFPKS-----------------------EDNNGESMEDASDEELAAATI
NNR_MYCTU        VLTPHAGEFARLAGAPP------------------------GDDRVGACRQLADALGATV
NNR_SYNY3        VLTPHGGEFKRLFPDID------------------------QGDRLTAVQTAAAMCQATV
NNRD_NEIG1       ILTPHPAEAARLLGTTVAQV---------------------QADRTAAVRKIGAILGATV
NNRD_NEIMB       ILTPHPAEAARLLGTTVAQV---------------------QADRTAAVRKIGAIFGATV
NNRD_BORPE       VLTPHPAEAGRLLGLSTEAV---------------------QADRPGAARALAARYGAWI
NNR_ECOLI        VITPHPGEAARLLGCSVAEI---------------------ESDRLHCAKRLVQRYGGVA
NNRD_ENTFA       VFTPHQMEWQRLSHLPIEQ----------------------QTLANNQRQQAKL--GSTI
NNRD_LACPL       V-TPHQMEWQRLSGIAIKD----------------------QTPTANHDAQQRL--GVMA
NNRD_STAA8       IFTPHLKEWERLSGIPIEE----------------------QTYERNREAVDRL--GATV
NNRD_LACLA       VFTPHEMELERLSGLKIGQ----------------------QTKEEVQDFVNQL--GAIV
NNRD_STRR6       ILTPHQKEWEKLSGITIEK----------------------QKEDTTASALTSFPKGTIL
NNRD_LISMO       TFTPHAGEWERLKVLAPDA----------------------VTPTDVALAIDAT-----I
NNRD_CENSY       LVTPHAGEFKRLFGESPPAD---------------------IEGRASMVERLAQEHGITI
NNRD_NITMS       VVTPHAGEFKRLFGQVPSNS---------------------KNERIKLVEEKAKEFGITV
NNRD_HALTV       VLTPSGAEVGPIRDEYGS------------------------------LEAFSEETGAVI
NNRD_NATMM       VLTPSGSEDGPIYEAYGS------------------------------LRAFTEETGAVI
NNRD_FLAPJ       ILTPHQKELERLIGKWSS-----------------------EEEKLEKVKRLCLEYDLIF
NNRD_RHOBA       VLTPHPGELQRLTGASAKD----------------------VDAQVEAAAELACRLGLTI
NNRD_BACSU       ILTPHPGEFFRMTGVPVNELQ---------------------KKRAEYAKEWAAQLQTVI
NNRD_XANCP       VLTPHAGEMAALAGDDKAAV---------------------EAAPADYALAFAKKMRSVV
NNR_THEMA        VLTPHPGEMARLVKKTVGD----------------------VKYNYELAEEFAKENDCVL
NNR_HELPY        ILTPHPKEFLSLLKLVGINISM---------------LELLDNKLEIARDFSQKYPKVVL
                   **   *   :                                                

NNRD_DICDI       VQKGKE--------DII-----------------------TDGNQTVVCDDEGMPRRCGG
NNRD_POLPP       VQKGQE--------DII-----------------------TDGTISYSCDKAGMPRRCGG
NNRD_ARATH       LRKGKS--------DLI-----------------------SNGETVKSVSIYGSPRRCGG
NNRD_VITVI       LRKGKS--------DLI-----------------------SDGETVNSVGIYGSPRRCGG
NNRD_SORBI       MQKGKA--------DVI-----------------------SDGKTVTQVSTFGSPRRCGG
NNRD_PHYPA       LQKGKT--------DYI-----------------------SDGKTVLSSDYYGSPRRCGG
NNRD_ENTHI       LQKGQV--------DEV-----------------------SNGSYTVHVKHVGSPRRCGG
NNRD_BOVIN       VQKGEQ--------DVI-----------------------SDGEQVLECSQEGSGRRCGG
NNRD_CANLF       VQKGER--------DVI-----------------------SDGKQVLECTQEGSSRRCGG
NNRD_HUMAN       VQKGER--------DIL-----------------------SNGQQVLVCSQEGSSRRCGG
NNRD_MACMU       VQKGER--------DIL-----------------------SNGQQVLVCSQEGSSRRCGG
NNRD_MOUSE       VQKGEQ--------DLI-----------------------SNGQQVLVCNQEGSSRRCGG
NNRD_RAT         VQKGEQ--------DLI-----------------------SNGQQVLVCNQEGSSRRCGG
NNRD_DANRE       VLKGEE--------DII-----------------------TDGKNILTCSQEGSGRRCGG
NNRD_IXOSC       LAKGSE--------DII-----------------------SDGHRLLRCTEQGSPRRCGG
NNRD_AEDAE       IEKGLN--------DRIYD---------------------SLTLEKYECPQGGSGRRCGG
NNRD_ANODA       IEKGLN--------DRIYD---------------------SLTSEKYECPQGGSGRRCGG
NNRD_DROME       LEKGAN--------DKIYL---------------------PHCNEVHSMPSGGSGRRCGG
NNRD_DROPS       LEKGVN--------DKIHI---------------------PHTNEVYSMPTGGSGRRCGG
NNRD_CIOIN       VRKGEV--------DIV-----------------------AAGDEVVTMDEIGSPRRCGG
NNRD_NEMVE       CRKGQH--------DII-----------------------TDGQTVVECSITGSNRRCGG
NNRD_PEDHC       ITNGINF-------DEFDF---------------------TFDDVTITCETFGSNRRCGG
NNRD_CAEBR       MKGEVD----------LVV---------------------TPNGEVSKCSTDSSLRRCGG
NNRD_CAEEL       LKGEVD----------LVV---------------------TPNGEVSKCSTESSLRRCGG
NNRD_BATDJ       LCKGSK----------DLI---------------------ATGDDILFVSDPTSLRRCGG
NNRD_EMENI       IQKGPH--------DVISN-----------------------GVTSIVSDLPGGLKRSGG
NNRD_ASPFU       IQKGPH--------DVISN-----------------------GVTTLISDLKGGLKRSGG
NNRD_AJECG       IQKGPH--------DTISN-----------------------GMVNIVCDVRGGLKRSGG
NNRD_FUSV7       IQKGAK--------DYISN-----------------------GETTLTVDLQGGRKRSGG
NNRD_NEUCR       VQKGAK--------DYLSD-----------------------GKVTLTVDLKGGLKRSGG
NNRD_PHANO       IQKGAK--------DYISN-----------------------GSQTLISEGEGGLKRSGG
NNRD_SCHPO       IQKGQS--------DIISD-----------------------GATAYACSVPGGLKRCGG
NNRD_CANAL       FRKGEH--------DLIVK----------------------SSK-FLINEITGSNKRVGG
NNRD_CANAW       FRKGEH--------DLIVK----------------------SSK-FLINEITGSNKRVGG
NNRD_YEAST       VEKGQS--------DKIFSPD--------------------SEKDMLTNSEEGSNKRVGG
NNRD_COPC7       LQKGAK--------DIISVDTTGEEADLSASHIEGADAEKEKIKETIAVDVEGGLKRCGG
NNRD_CRYNJ       IQKGPS--------DIISNGLKIPSALLS-------DESEE--QNYLEVKVEGGLKRVGG
NNRD_USTMA       LEKGPV--------DRITNG-----------------------KEVLYVDLQGGLKRCGG
NNRD1_PUCGT      LQKGSI--------DLVAREG----------------------SEVAKVSCEGSPKRCGG
NNRD2_PUCGT      LQKGSI--------DLVAREG----------------------SEVAKVSCEGSPKRCGG
NNRD_PHATC       VRKGAED-------RIIVD-----------------------QRQVMSCGEEGGLKRSGG
NNR_MYCTU        LLKGNVTVIADPGG------------------------------PVYLNPAGQSWAATAG
NNR_SYNY3        LLKGAKTVIASPTG------------------------------PTWAIKDSTPALARGG
NNRD_NEIG1       VLKGHKTLVAASDT------------------------------EIYVNESGNAGLATAG
NNRD_NEIMB       VLKGHKTLVASPDT------------------------------EIYVNESGNAGLATAG
NNRD_BORPE       VLKGAGSIVCDPAG------------------------------ACRINRTGNPGLATAG
NNR_ECOLI        VLKGAGTVVAAHPD------------------------------ALGIIDAGNAGMASGG
NNRD_ENTFA       VLKSHRTTIFHAG-------------------------------EPFQNTGGNPGMATGG
NNRD_LACPL       VVKAHRTTVYTDE-------------------------------RVWFNPGGTPAMATGG
NNRD_STAA8       VLKKHGTEIFFKD-------------------------------EDFKLTIGSPAMATGG
NNRD_LACLA       VAKSSETRIFAPNR------------------------------ESFILKIGSPAQATGG
NNRD_STRR6       VEKGPATRVWQAGQS-----------------------------DYYQLQVGGPYQATGG
NNRD_LISMO       VLKGHRTKVYSGE-------------------------------SAWQNMYGTPAMATGG
NNRD_CENSY       LLKGPTDVISDGNR-------------------------------TLLNDRGAPAMTVGG
NNRD_NITMS       LLKGSTDIISNGST-------------------------------TYLYEKKIPAMTVGG
NNRD_HALTV       TLTGDVDEIVADGE-------------------------------RLENETGTSAMTVAG
NNRD_NATMM       TLTGGVDVIVTTGE-------------------------------RLENDTGTSALTVAG
NNRD_FLAPJ       VLKGAPTMIVN-------------------------------NKSTYENTTGNQALATAG
NNRD_RHOBA       VVKGGPSHVAYQN--------------------------GDGGKQVWQNTTGNPGMATAG
NNRD_BACSU       VLKGNQTVIAFP------------------------------DGDCWLNPTGNGALAKGG
NNRD_XANCP       IVKGADSFVAGP------------------------------DGALWVHRGGVPGLGTSG
NNR_THEMA        VLKSATTIVTD-------------------------------GEKTLFNITGNTGLSKGG
NNR_HELPY        LLKGANTLIAH-------------------------------QGQVFINILGSVALAKAG
                                                                           .*

NNRD_DICDI       QGDILAGTVGTMYAWSQLYYKYNSNTDDK-------------------------------
NNRD_POLPP       QGDVLAGVIGTFYAWTQNALKGKTSEELEHLKESIG------------------------
NNRD_ARATH       QGDILSGGVAVFLSWAQQLK-----------SDPES------------------------
NNRD_VITVI       QGDILSGSVAVFLSWARQRIIAE--------GDLNI------------------------
NNRD_SORBI       QGDILSGSVAVFASWARHFV---------------L------------------------
NNRD_PHYPA       QGDVLSGSTAVFVSWAKEYFSNENAAGKK--EVEER------------------------
NNRD_ENTHI       QGDVLSGSLATFVAWSKLNQ---------------D------------------------
NNRD_BOVIN       QGDLLSGSLGVLAHWALRAGPQKTGGPS--------------------------------
NNRD_CANLF       QGDLLSGTLGVLVHWALHAAPEKTNGSS--------------------------------
NNRD_HUMAN       QGDLLSGSLGVLVHWALLAGPQKTNGSS--------------------------------
NNRD_MACMU       QGDLLSGSLGVLVHWALLAGPEKTNGGM--------------------------------
NNRD_MOUSE       QGDLLSGSLGVMVHWALRAGPEKTNGSS--------------------------------
NNRD_RAT         QGDLLSGSLGVMAHWALRAGPEKTNGSS--------------------------------
NNRD_DANRE       QGDLLSGSLGAFAHWAFSSPSDATKGMN--------------------------------
NNRD_IXOSC       QGDLVSGSLALFAFWSHSAHDTPGEASKR-----QN------------------------
NNRD_AEDAE       QGDLLAGALATFYFWALECKQE--------------------------------------
NNRD_ANODA       QGDLLAGALATFYYWALESKQE--------------------------------------
NNRD_DROME       QGDLLSGSLATFFSWSLQSGE---------------------------------------
NNRD_DROPS       QGDLLSGSLATFFYWSLQSNQ---------------------------------------
NNRD_CIOIN       QGDLLSGVMALFSYWTHNSTCT--------------------------------------
NNRD_NEMVE       QGDLLSGSMAVFLHWANIEVT---------------------------------------
NNRD_PEDHC       QGDILSGCIATFVAWFELFKSNNTFIIP--------------------------------
NNRD_CAEBR       QGDVTAGSLGLFLYWAKKNLGDDWTSAHH-------------------------------
NNRD_CAEEL       QGDVTAGSLGLFLYWAKKNLGDDWTSAHH-------------------------------
NNRD_BATDJ       QGDVLAGILCAFLAWRNGYQSGRWTAQDQ-------------------------------
NNRD_EMENI       QGDTLTGSLGTLLAWRAA---YHDALWDSGEQEHSK-EAENKEEVQGELES---------
NNRD_ASPFU       QGDTLTGSLGTLLAWRAA---YHNKSWDSGEQENPK-EAQSKQDVLAELESE--------
NNRD_AJECG       QGDTLTGSLGTLLAWRKA---YHEGLWDTGESEASGGRELSRQDIEEDLSICGYESGDDG
NNRD_FUSV7       QGDTLTGSIATFLGWRKA---YLDRLWDVGQNA---------------------------
NNRD_NEUCR       QGDTLTGSIATFLGWRRA---YLEDLWDHGHK----------------------------
NNRD_PHANO       QGDTLTGSLATLLAYRKA---YHDKIWDHGTN----------------------------
NNRD_SCHPO       QGDILTGILATFLAWRHA---YLSKEWDTEGN----------------------------
NNRD_CANAL       QGDTLTGAIATLVNWSNN---YILRLWDNQVVVNWSNNYILRLWDNQV------------
NNRD_CANAW       QGDTLTGAIATLVNWSNN---YILRLWDNQVDLDQE------------------------
NNRD_YEAST       QGDTLTGAISCMLAFSRAM--YDFKICEQEEKGESSND----------------------
NNRD_COPC7       QGDVLSGCVGTFMAWGKCY--ESGVYGDGTVPTSR-------------------------
NNRD_CRYNJ       QGDILSGSTGVLLAWGSEW--VRGTYEHVGHPPPQD------------------------
NNRD_USTMA       QGDVLAGCLGTLAGWAKIYQDENPTLPARSTTTDGD------------------------
NNRD1_PUCGT      QGDILSGLVGTWCAWTKLY--FERQSQDEKPKSHEL------------------------
NNRD2_PUCGT      QGDILSGLVGTWCAWTKLY--FERQSQDEKPKSHEL------------------------
NNRD_PHATC       IGDVLAGTLGTFTSWHAILLDREAVSTE--------------------------------
NNR_MYCTU        SGDVLSGMIGALLASGL-------------------------------------------
NNR_SYNY3        SGDVLTGLMGGILAQPE-------------------------------------------
NNRD_NEIG1       SGDVLGGIIGSLLAQGV-------------------------------------------
NNRD_NEIMB       SGDVLGGIIGSLLAQGV-------------------------------------------
NNRD_BORPE       TGDVLAGILGSLLAQRI-------------------------------------------
NNR_ECOLI        MGDVLSGIIGALLGQKL-------------------------------------------
NNRD_ENTFA       TGDTLAGIIAGFLAQFK-------------------------------------------
NNRD_LACPL       MGDTLAGMIGGFVSQFH-------------------------------------------
NNRD_STAA8       MGDTLAGMITSFVGQFD-------------------------------------------
NNRD_LACLA       MGDTLAGMVGGFLAQFHG------------------------------------------
NNRD_STRR6       MGDTLAGMIAGFVGQFRQA-----------------------------------------
NNRD_LISMO       MGDTLAGTICGLMAQTE-------------------------------------------
NNRD_CENSY       TGDVLSGIAAGILARNR-------------------------------------------
NNRD_NITMS       TGDVLSGLVAGLLSKNR-------------------------------------------
NNRD_HALTV       TGDTMVGIVASLLGQGM-------------------------------------------
NNRD_NATMM       TGDTLAGITASLLGQEM-------------------------------------------
NNRD_FLAPJ       SGDVLAGIITSLLAQSY-------------------------------------------
NNRD_RHOBA       CGDVLTGIVTSLLGQGLS------------------------------------------
NNRD_BACSU       TGDTLTGMILGMLCCHE-------------------------------------------
NNRD_XANCP       SGDTLAGLIAGFAARGC-------------------------------------------
NNR_THEMA        SGDVLTGMIAGFIAQGL-------------------------------------------
NNR_HELPY        SGDVLAGLILSLLSQNY-------------------------------------------
                  **   *                                                     

NNRD_DICDI       -----------PEYPISIISAYAACSLLRHCSKKAYQISKR---STV-----------SM
NNRD_POLPP       -----------ENQSAAASAAYAGCVLVRYAAKLAFKNNRR---STI-----------TD
NNRD_ARATH       -----------PSENPAILGCIAASGLLRKAASLAFTKHKR---STL-----------TS
NNRD_VITVI       -----------SPKSPTVLGSIAGSALMRKAASLAFENKKR---STL-----------TG
NNRD_SORBI       -----------TNEQPTE---------KRKAASHAFEKNKR---STV-----------TS
NNRD_PHYPA       -----------VSNNPTMVGALAGSLLCRKSAANAFAQHKR---ATT-----------TT
NNRD_ENTHI       -----------FQDEDLICCSVAASALVKECSSFAFTEKHR---GVI-----------AS
NNRD_BOVIN       ---------------PLLVAAFGACALTRQCSQQAFQKYGR---ATT-----------TS
NNRD_CANLF       ---------------PLLLAALGACSLTRQCSLQAFQKHGR---STT-----------TT
NNRD_HUMAN       ---------------PLLVAAFGACSLTRQCNHQAFQKHGR---STT-----------TS
NNRD_MACMU       ---------------LDLKLTIWGPKIETGIKTRAQGGCGP---RTTAPTSPHLPLSPSP
NNRD_MOUSE       ---------------PLLVAAWGACTLTRECNRQAFQKYGR---STT-----------TT
NNRD_RAT         ---------------PLLVAAWGACTLTRECNHLAFQKYGR---STT-----------TT
NNRD_DANRE       ---------------PSLVAAFGATSLTRQCNRQAFHKHGR---STT-----------TS
NNRD_IXOSC       -----------SEYGPAMIAALGAAMLVRRCGRLAFQKMAR---STL-----------SS
NNRD_AEDAE       -------------ISPAVVACFAASYLTKNCNTYAFKAKGR---SMT-----------CT
NNRD_ANODA       -------------ISPAMVACFAASTLTKTCNKYAFKAKGR---SMT-----------CS
NNRD_DROME       -------------PNPALVAACASSYFVKKLNAAAFQKFGR---SLL-----------AS
NNRD_DROPS       -------------PNPAYIAACASSYLVKRANSTAFKKFGR---SLL-----------AS
NNRD_CIOIN       -------------PPPTLLAGYAACFLTKRCANQAFQKHGR---STA-----------TT
NNRD_NEMVE       -------------QNPALVAAYAASGLTRWCNRLAYSRLKR---SMT-----------TS
NNRD_PEDHC       ---------------LSSVSCYGACAVTKTCSKLAFQKFGR---SMT-----------AS
NNRD_CAEBR       -----------EAGIS-------SSWLVRTAGRRAFEKHGR---SMN-----------TP
NNRD_CAEEL       -----------EAGIA-------SSWLVRTAGRRAFEKHGR---SMN-----------TP
NNRD_BATDJ       -----------STDISLMIVASNASSFARKCAALAFEKHKR---SIV-----------AS
NNRD_EMENI       -------NKRMSPSTTLLLAAWAGAAITRECSRRAFKAKGR---SMQ-----------AS
NNRD_ASPFU       -------NKRMSPATTLLLVAWAGSGITRECSRRAFNAKGR---SLQ-----------AS
NNRD_AJECG       ERDGDKPKKKLSRPATLLLVAWAGSAITRECSRRAFMAKGR---SMQ-----------AS
NNRD_FUSV7       ----------LGEHELVGLAAFGGAAITRECSRLAFAKKGR---SLQ-----------AS
NNRD_NEUCR       ----------LNKEELIGLAVFGGSAITRECSRLAFAKKGR---SLQ-----------AS
NNRD_PHANO       ----------MEPSETLALAAYGGSCITRECSKLAYKEKGR---SLQ-----------AA
NNRD_SCHPO       ----------MDAKECLFLAAFGASACTRWCSRLAFKECGR---ATQ-----------ST
NNRD_CANAL       ---------DLDQEDANLLACFAASSVVRNASSKAFNKYGR---SMQ-----------TS
NNRD_CANAW       --------------DANLLACFAASSVVRNASSKAFNKYGR---SMQ-----------TS
NNRD_YEAST       -------KPLKNWVDYAMLSCYAGCTITRECSRLGFKAKGR---AMQ-----------TT
NNRD_COPC7       ---------------VPLLAAVAGSMVTRTTSRRAYAKSGR---SLI-----------TQ
NNRD_CRYNJ       ---------KAIAENIPVLAAYGASTFNRTVSKRGFQKKGR---SMV-----------TG
NNRD_USTMA       ---------LIAEDRLLLLAGYAASVTARTCSRLAFAKSKR---AML-----------AD
NNRD1_PUCGT      ---------PISSEEAWIIAAVLGSEITRTCSRLAYHKLGR---SMQ-----------SS
NNRD2_PUCGT      ---------PISPEEAWIIAAVLGSEITRTCSRLAYHKFGR---SMQ-----------SS
NNRD_PHATC       ---------------DLPLSCWTACCAVKRATKRAFDDKRR---AMT-----------AP
NNR_MYCTU        ---------------PSGEAAAAAAFVHARASAAAAADPGP-GD--------------AP
NNR_SYNY3        ---------------KFDLAQRVATAAWWHAQAGILASQQR-TI--------------LG
NNRD_NEIG1       ---------------PVFEAACAGAWLH-GAAADVIKESAG-IA--------------AG
NNRD_NEIMB       ---------------PVFEAACAGAWLH-GAAADVIKESAG-IA--------------AG
NNRD_BORPE       ---------------APEQAVPGAVWLH-GAAADALVTHGV-GP--------------IG
NNR_ECOLI        ---------------SPYDAACAGCVAH-GAAADVLAARFG-TR--------------GM
NNRD_ENTFA       ---------------PTIETIAGAVYLHSLIGDDLAKTDYV-VL--------------PT
NNRD_LACPL       ---------------NFTDAVLSAVYLHSAIADDLAATRYV-VL--------------PH
NNRD_STAA8       ---------------NLKEAVMSATYTHSFIGENLAKDMYV-VP--------------PS
NNRD_LACLA       ---------------ETEEVVAAATYLHSLIASVLARKTYV-VL--------------PS
NNRD_STRR6       ---------------SLYERVAVATHLHSAIAQELSQENYV-VL--------------PT
NNRD_LISMO       ---------------KPITGTLAAVFLHSYIGEILAKKRYV-VL--------------PT
NNRD_CENSY       ---------------SPLESAAAAAYINGLAGEAAQEMHGLHIT--------------AM
NNRD_NITMS       ---------------KPLESAAAAAFINGLAGKVVQKKLGLHMT--------------SM
NNRD_HALTV       ---------------DRREAAELGAWILGKTGELATANHGPGVV--------------AT
NNRD_NATMM       ---------------DRQDAAELGAWILGKSGELATAEYGPGVV--------------AT
NNRD_FLAPJ       ---------------EPINAAIIGVYLHGLTADIAYPKVGY-------------QSFIAS
NNRD_RHOBA       ----------------GPDAAKLGVWIHGRCGDEAAARWSH-----------------AG
NNRD_BACSU       ---------------DPKHAVLNAVYLHGACAELWTDEHSA-----------------HT
NNRD_XANCP       ---------------DALTAALWGVFVHATAGKQLAKRIGT-----------------VG
NNR_THEMA        ---------------SPLEASTVSVYLHGFAAELFEQDERG---------------LTAS
NNR_HELPY        ---------------TPLDAAINASSAHALASLEFKNNYAL----------------TPL
                                                                             

NNRD_DICDI       DIINQISNGFEDLFPESSK-----------------------------
NNRD_POLPP       DIIKSVPNALVWGFLTDDRGRPTI------------------------
NNRD_ARATH       DIIECLGESLEDICPAS-------------------------------
NNRD_VITVI       DIIECLGRSLEDICPAK-------------------------------
NNRD_SORBI       DIIEFLGKSLEDICPAEH------------------------------
NNRD_PHYPA       NIIEYLGHRLFTFMLRFY------------------------------
NNRD_ENTHI       DIIESIPSVFDQVFGQNKIQLIYE------------------------
NNRD_BOVIN       DMVAEVGPAFRRLFEA--------------------------------
NNRD_CANLF       DMIAEIGPAFSKLFET--------------------------------
NNRD_HUMAN       DMIAEVGAAFSKLFET--------------------------------
NNRD_MACMU       QVQPSPGGCIRRLLSHQAVQPPSLPEARSLHHHLRHDRRGGGRLPQAL
NNRD_MOUSE       DMITEVGTAFSRLFTT--------------------------------
NNRD_RAT         DMIAEVGAAFSKLFTT--------------------------------
NNRD_DANRE       DMIQEINSAFKKLFES--------------------------------
NNRD_IXOSC       DMLAEVRTAFSMLFPVD-------------------------------
NNRD_AEDAE       DMIEQIHNVFDDIFEHKKE-----------------------------
NNRD_ANODA       DMIDQIHQVFDDLFEHKKD-----------------------------
NNRD_DROME       DMVNQIPSVFQTEFENSDPQ----------------------------
NNRD_DROPS       DMINEISAVFRSDFEDAETG----------------------------
NNRD_CIOIN       DLISEINSVFVNNFENPTDPKS--------------------------
NNRD_NEMVE       DMIQQIHQAFEELFGKE-------------------------------
NNRD_PEDHC       DMIGCIHQSFTSLFGS--------------------------------
NNRD_CAEBR       LLLDEIPKLVRDVETREMKDTVHSDSSKH-------------------
NNRD_CAEEL       LLLDEIPKLVRDVETREMKDTVHTDSSKH-------------------
NNRD_BATDJ       SILKEIGPAFDSLYDDEL------------------------------
NNRD_EMENI       DLTDEVHESFLTLIGEPEGSKVPERL----------------------
NNRD_ASPFU       DLTDEVHESFLELIGEPEASRTHL------------------------
NNRD_AJECG       DLTDEVHGSFLDLIGEPEGTKL--------------------------
NNRD_FUSV7       DLTEEVHVAFLNIFGEEDEETDSSRL----------------------
NNRD_NEUCR       DLTDEVHTAFLNLFGEVDAKL---------------------------
NNRD_PHANO       DLTEHVHTAFLNVIGEKEETPKL-------------------------
NNRD_SCHPO       DLVRHVGKAYNALMEDEIPSVEEKIKD---------------------
NNRD_CANAL       NVHEYLHESFTELFGDSIFRTSNI------------------------
NNRD_CANAW       NVHEYLHESFTELFGDSIFRTSNI------------------------
NNRD_YEAST       DLNDRVGEVFAKLFG---------------------------------
NNRD_COPC7       DLLSEAGPAFEECFG-----GDKGRL----------------------
NNRD_CRYNJ       DLVDMVGEVYEEVFGKPGEMEGRGKL----------------------
NNRD_USTMA       DLLPEVGRAYEELWG-----DVQALL----------------------
NNRD1_PUCGT      DMLGYIGEAFELVMH------GHTKD----------------------
NNRD2_PUCGT      DMLGYIGEAFEQVMH------GHTKD----------------------
NNRD_PHATC       DVLHHLGQALDEMTRED-------------------------------
NNR_MYCTU        TSASRISGHIRAALAAL-------------------------------
NNR_SYNY3        VDAQHLAEYLIPACRQWLGPNVANWPANLSHSS---------------
NNRD_NEIG1       LSAGEIAPAARWLRNWITESM---------------------------
NNRD_NEIMB       LLAGEIAPAARWLRNRITKSM---------------------------
NNRD_BORPE       LTAGELADSARRLRNSRA------------------------------
NNR_ECOLI        LATDLFSTLQRIVNPEVTDKNHDESSNSAP------------------
NNRD_ENTFA       KISQALPTYMKKYAQPHTAPDSELLEQKRSR-----------------
NNRD_LACPL       QISTRIPTYMHRFSQIERP-----------------------------
NNRD_STAA8       RLINEIPYAMKQLES---------------------------------
NNRD_LACLA       RLIEEIPLFMKKYEC---------------------------------
NNRD_STRR6       EISRYLPKIMKIICQQERVSKDKLV-----------------------
NNRD_LISMO       EIAEELPTYLKIFSETDEHA----------------------------
NNRD_CENSY       DLCELLPSVMKPFDRLE-------------------------------
NNRD_NITMS       DLLPEISTVMKPFDKIM-------------------------------
NNRD_HALTV       DVIERIPDTIR-------------------------------------
NNRD_NATMM       DVIECIPKTIR-------------------------------------
NNRD_FLAPJ       DIIETLGEAYLHIIK---------------------------------
NNRD_RHOBA       MTSLHALDALALVADEMTQPAD--------------------------
NNRD_BACSU       LLAHELSDILPRVWKRFE------------------------------
NNRD_XANCP       FLAREIPPEVPGILDRLPRG----------------------------
NNR_THEMA        ELLRLIPEAIRRLKE---------------------------------
NNR_HELPY        DLIEKIKQL---------------------------------------