CLUSTAL format seed alignment for MF_01966

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NNRE_ANAPD      ---------------------------------------------------MLVVDSKTM
NNRE_FINM2      ---------------------------------------------------MIYVTAEQM
NNR_THEMA       -----------------------------------------------------------M
NNRE_LACRD      -------------------------------------------------MTDKIVTAEEM
NNRE_LACRJ      -------------------------------------------------MTDKIVTAEEM
NNRE_LACRS      -------------------------------------------------MTDKIVTSEEM
NNRE_LACF3      -------------------------------------------------MTEQAITAAQM
NNRE_LACBA      --------------------------------------------------MSKAITIAEA
NNRE_OENOB      -------------------------------------------------MTTIYISSKQA
NNRE_LACBN      --------------------------------------------------MTQAITVEES
NNRE_LEUKI      ---------------------------------------------------MQLVTAAEM
NNRE_LEUS2      ---------------------------------------------------MQLVTAAEM
NNRE_LEUGG      ---------------------------------------------------MQLVTASEM
NNRE_LEUCK      ---------------------------------------------------MQLVTAAEM
NNRE_LEUMM      --------------------------------------------------MTRLVTATEM
NNRE_WEIKK      --------------------------------------------------MTDAVTAHEM
NNRE_RUBBR      ---------------------------------------------MSRVLSR-----DQS
NNRE_RHOBA      -------------------------MSPEVLSARPGFVRNLMDVMMKPVLQLPPMTCQRI
NNRE_PIRSD      -------------------------------------------MDLQRIYDR-----RKS
NNRE_ISOPI      -------------MIRGRKRDGTVHARPDVCLSSMDDFFLRKPPAMDESPRLRPLSRAEA
NNRE_PLAL2      ----------------------------------MEICPFVRLLDWRTLRAADCLTARQS
NNRE_RHOCB      --------------------------------------------------MTEILTSDDM
NNRE_ROSLO      --------------------------------------------------MPDILTASQM
NNRE_RHOSK      -----------------------------------------------------------M
NNRE_ACHXA      ------------------------------------------------------MPPSHS
NNRE_BORPD      ----------------------------------------------------MRAESGYS
NNRE_BORPE      -------------------------------------------------------MDIER
NNRE_BORPC      -------------------------------------------------------MDIER
NNRE_BORPA      -------------------------------------------------------MDIER
NNRE_BORBR      -------------------------------------------------------MDIER
NNRE_CLAM3      -----------------------------------MSDP-------------ALIADGYA
NNRE_CLAMS      -----------------------------------MSET-------------GSIADGYA
NNRE_MICTS      -----------------------------------MADPRRDPAAESKDRPSTERVAAYT
NNRE_DEHLB      ---------------------------------------MALKFTTAEGQAITPITVPVM
NNRE_TRURR      ------------------------------------------------------MSAAQA
NNRE_MOUSE      MSGLRTLLGLGLLVAGSRLPRVISQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQ
NNRE_YEAST      -----------------------------------------------MSTLKVVSSKLAA
NNRE_LEGPC      -----------------------------------MDYYFTKGKPQLVNMKTPIYLVTQF
NNRE_LEGP2      -----------------------------------MNYYFTKGKPQLVNMKTPIYLVTQF
NNRE_LEGPA      -----------------------------------MDYYFTKGKPQLVNMKTPIYLVTQF
NNRE_LEGPH      -----------------------------------MDYYFTKGKPQLVNMKTPVYLVTQF
NNRE_CENSY      -----------------------------------------------------MDISVKQ
NNRE_NITMS      -----------------------------------------------------MEITVDQ
NNR_MYCTU       ----------------------------------------------------MRHYYSVD
NNR_ECOLI       -------------------------------------MTDHTMKKNPVSIPHTVWYADDI
NNRE_ELUMP      ---------------------------------------------------MKTVTSQKM
NNR_SYNY3       --------------------------------------------MAVTSPWFRAVVSAAQ
NNR_METJA       --------------------------MRRDINNFLFGERMELFEILKQKIKEKEVITPKE
NNR_HELPY       ----------------------------------------------------MLSVYEKV
                                                                            

NNRE_ANAPD      KKIDQYAIDVLKVPSICLVERAALAVIKNINLE----------KRTSFAIVVGVGNNGAD
NNRE_FINM2      RQIDHYTIHEIGIPSIVLMENAKAQISKHILDK----------NFSKAYVFASVGNNGGD
NNR_THEMA       KEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNL------SDYRFLVLCGGGNNGGD
NNRE_LACRD      RHYDFYTINTIGIPSLVLMERAALAVRDEILHAF-PI------ALKDVVVVAGSGNNGGD
NNRE_LACRJ      RHYDFYTINTIGIPSLVLMERAALAVRDEILHAF-PI------ALKDVVVVAGSGNNGGD
NNRE_LACRS      RHYDSYTINTIGIPSLVLMERAALAVRDEILHAF-PI------ALKDVVVVAGSGNNGGD
NNRE_LACF3      RAKDQFTINQIGIPSLVLMERASLAVRDAILTHY-PA------ANK-IVVVAGQGNNGGD
NNRE_LACBA      QRYDAHATNVIGIPAMVLMERAALATFNNLLND--DF------DLDRVVVVAATGNNGGD
NNRE_OENOB      HNFDDYTINKIGVPSSVLMERAALAVCQRLLESR-NF------NLKKVLVVAGIGNNGGD
NNRE_LACBN      RELDDKTINKIGIPSLVLMERAGLKIYENMLDNK-DL------DLSNVLILAGTGNNGGD
NNRE_LEUKI      QTIDNYTVETIGMPQDVLIERAAMSVID-VIGAG-HF------NLDHILVLAGLGNNGAD
NNRE_LEUS2      QTIDNYTVETIGMPQDVLIERAAMSVID-VIGAG-HF------NLDHILVLAGLGNNGAD
NNRE_LEUGG      QKIDTYTVNTIGMPQDVLIERAALSVID-VIGAG-HF------NLEHILVLAGLGNNGAD
NNRE_LEUCK      QQIDSYTIETIGMPQNVLIERAAMSVID-VIGAG-HF------NLDHILVLAGLGNNGAD
NNRE_LEUMM      QQIDNYTIETIGMPQDVLIERAAMAVLD-VIGAG-RF------DLSHVLVLAGLGNNGAD
NNRE_WEIKK      QQYDQYTINEIGVPSLVLMERAALAGIE-VLGAG-QF------DLSQVLVIAGLGNNGGD
NNRE_RUBBR      REVDQIAIEQFHLPGVVLMENAGRNCAELIRQLSPAG---------QILILAGKGNNGGD
NNRE_RHOBA      REIDSLAMEQFQMPGIILMENAGRGAAELIEELAPEG---------NVLILCGKGNNGGD
NNRE_PIRSD      RLVDELAIAKYGMLGLMLMENAGRNVAYELLARTPCR---------RVVIVVGKGNNGGD
NNRE_ISOPI      RNLDLRAVRELGLPTLVLMENAGRSAARWFLEDWLSQGKG-NLTDHKVLILCGPGSNGGD
NNRE_PLAL2      REVDRFAIEELGISSLVLMENAARSVCDWFSQHVQASSSE-E-TSFVVRVVCGRGNNGGD
NNRE_RHOCB      RSLERAAIASGRASGLELMERAGAAVVEAIAEAWPDIRPP-AVALRHAMILCGPGNNGGD
NNRE_ROSLO      RALETAAFNSGAVTGLELMERAGQSVIDALFSSKAEL----ATGEHRAVILCGPGNNGGD
NNRE_RHOSK      RAIENAAMAAGRATGLQLMERAGEAVAAAVPDW---------PAPRLAVVLCGPGNNGGD
NNRE_ACHXA      VAQIRDAERQTLATGRRLMPLAGAAAARHVAARIRPG--------AVVLALAGPGNNGGD
NNRE_BORPD      VLQIRQAEQRALAQGRALMPLAGAAAAGFIAARFPVG--------SVVLALAGPGNNGGD
NNRE_BORPE      VEQVRAVERLAHRRGLALMPRAGLAAADFVAARLPAG--------AQVLALAGPGNNGGD
NNRE_BORPC      VEQVRAVERLAHRRGLALMPRAGLAAADFVAARLPAG--------AQVLALAGPGNNGGD
NNRE_BORPA      VEQVRAVERLAHRRGLALMPRAGLAAADFVAARLPAG--------AQVLALAGPGNNGGD
NNRE_BORBR      VEQVRAVERLAHRRGLALMPRAGLAAADFVAARLPAG--------AQVLALAGPGNNGGD
NNRE_CLAM3      AADIRAAEAPLLAAGAQLMRVAAAGLARACRALAPD---------GPVLVLVGAGNNGGD
NNRE_CLAMS      AADIRAAEAPLLAAGAQLMRVAAAGLARVCRAEAPS---------GPVLVLVGAGNNGGD
NNRE_MICTS      ADAVRAAEAPLLAEGRPLMRTAARALADIAAAEVRTTP-------GAVLVLAGAGDNGGD
NNRE_DEHLB      REIDRLAVQETGPNLYQMMENAGRNLAELTLTLLGESRNG-----SRVLVLAGTGGNGGG
NNRE_TRURR      RHLTTLATGRYGFELQTLMERAGESLAGLAAHLAPD---------GPVLVVAGRGHNGGV
NNRE_MOUSE      AVDQELFN-EYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPP--TVLVICGPGNNGGD
NNRE_YEAST      EIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNGGD
NNRE_LEGPC      QQLMDLMQNQYEVSCLELMQRSGKAACDFLVYRWPKV--------KKISIFCGRGDNGGQ
NNRE_LEGP2      QQLMDLMQNQYEVSCLELMQRSGKAACDFLVYRWPKV--------KKISIFCGRGDNGGQ
NNRE_LEGPA      QQLMDLMQNQYEVSCLELMQRSGKAACDFLVYRWPKV--------KKISIFCGRGDNGGQ
NNRE_LEGPH      QQLMDLMQNQYQVSCLELMQRSGKAACDFLVYRWPKV--------KKISIFCGRGDNGGQ
NNRE_CENSY      MYNIEENGHAMGFLKKFMMENAGAAAARLLDERLEGA--------PRVLAFAGMGNNGGD
NNRE_NITMS      MYNIENKGHDMGFLKKFMMENAGAAAVKRLVEKLGNVD------SKNILIFVGMGNNGGD
NNR_MYCTU       TIRAAEAPLLASLPDGALMRRAAFGLATEIGRELTARTGG--VVGRRVCAVVGSGDNGGD
NNR_ECOLI       RRGEREAADVLGLTLYELMLRAGEAAFQVCRSAYPDA--------RHWLVLCGHGNNGGD
NNRE_ELUMP      RELETAAVKEFGIDEDVLMEHAGRSAAEEILNCFLSEN-----KEKKVIIVCGHGGNGGD
NNR_SYNY3       MQEIENWLFTQGMPVAALMEKAALQTAQRLLTLYPLS------TYPRIGVVVGPGHNGGD
NNR_METJA       MAIIDDNAEFLGIQKILLMENAGKAVYEEIKDIDAEE----------FIIFCGTGNNGGD
NNR_HELPY       NALDKRAIEELFLSEDILMENAAMALERAVLQNASLG--------AKVIILCGSGDNGGD
                                 ::  :                            . . * **. 

NNRE_ANAPD      GLAIARNLLAMGKYVEIYIVGDLTKQSQD---------FKLNLDSCKRLTD---------
NNRE_FINM2      GLAVARDIYNAKKYVKVYVIGKLEKASTD---------FKINYDILKKLDV---------
NNR_THEMA       GFVVARNLLGVVKDVLVVFLGK--KKTPD---------CEYNYGLYKKFGG---------
NNRE_LACRD      GIAIARLLHIAGVHVTILNIGNPQHASA-------------EHQTQEKIAQ---------
NNRE_LACRJ      GIAIARLLHIAGVHVTILNIGNPQHASA-------------EHQTQEKIAQ---------
NNRE_LACRS      GIAIARLLHLAGVHVTILNIGNPKHASA-------------EHQTQEKIAQ---------
NNRE_LACF3      GLAIARLLHVAGRGVAILTIGNSAHASS-------------EHQTQAHICD---------
NNRE_LACBA      GIAVARLLKIRGIDVTIYLLGDPENATP-------------QTSQQLKIAN---------
NNRE_OENOB      GIAVARMLYLKQVPVKIYLLGDREKISK-------------DSRIQLKIAE---------
NNRE_LACBN      GLVVARLLATHGYQVSILTVGNPDHASE-------------DHLAQARICN---------
NNRE_LEUKI      GVAISRLLYAQGFNVSLQFVGNVTRAKD-------------SVKRQLDIIE---------
NNRE_LEUS2      GVAISRLLYAQGFNVSLQFVGNVTRAKD-------------SVKHQLDIIE---------
NNRE_LEUGG      GVAITRLLYAQGFNVSLQFVGNVSRAKE-------------SVQRQLAIIE---------
NNRE_LEUCK      GIAIARLLYTQGFNVSLQFVGNVSRAKA-------------SVQQQLQIIE---------
NNRE_LEUMM      GVAIARLLYAQGVNVSLQFVGNVSRAKD-------------SVKRQLAIIE---------
NNRE_WEIKK      GVALARLLMQKGVHVDLLFVGDENRAAH-------------NNAIQLEIAK---------
NNRE_RUBBR      GFVIARHLHNAGLNVKLLVFANPED-------------YSGEAESNWRIIT--------A
NNRE_RHOBA      GFTIARHLQLAGREVMILAMAATNE-------------LQGDAAIQAKIAE--------A
NNRE_PIRSD      GWVIARHLDAAGVDVIVLLTTAPNE-------------FRGDAAVNYAIAN--------L
NNRE_ISOPI      GGVMARWLDLAGVLVRVAWVSGPVPRL-----------PAGDAAIQRDALA--------K
NNRE_PLAL2      GFAIARLLWTMGYAVEIFATHPEAE-------------LAPDARVNAALAR--------K
NNRE_RHOCB      GFVVARLLRRRGWKVTLYLYGEADRLP-------------PDARANHDRW--------RR
NNRE_ROSLO      GFVIARLLFVLGWQVRVYLYADPEKMP-------------RDAHANHDSWVDLVPECTQR
NNRE_RHOSK      GFVVARLLAGRDWQVHVFASGWEAVFPELGPPGPVRAREGTDAVTNARRWR-------DE
NNRE_ACHXA      ALEAATGLRAMGHDVRVLLPSGAQ----------------GLPADAARAYA---------
NNRE_BORPD      ALVAAARLLAAGYTVRVTMPRGPQ----------------ALPPDAARAYA---------
NNRE_BORPE      ALVAATLLQARGYRVAVVMPAGPA----------------RLPDDARRAWQ---------
NNRE_BORPC      ALVAATLLQARGYRVAVVMPAGPA----------------RLPDDARRAWQ---------
NNRE_BORPA      VLVAATLLQARGYRVAVVMPAGPA----------------RLPDDARRAWQ---------
NNRE_BORBR      ALVAATLLQARGYRVAVVMPAGPA----------------RLPDDARRAWQ---------
NNRE_CLAM3      ALLAAAELAREGREVGVIRTAGRI----------------HEAGAAQAVAA---------
NNRE_CLAMS      ALLAAADLARDGRDVRVIRTASRI----------------HGA-AARAAEA---------
NNRE_MICTS      ALFAAADLASSAERVDVVLVRDRV----------------HREALDAAVAA---------
NNRE_DEHLB      GLCAGRHLANHGLAVDYTLGDRDG----------------LSEVTGRQLSL---------
NNRE_TRURR      GLAAAHCLARARRAVWVVPTHEAE----------------NYSGVPKELLE---------
NNRE_MOUSE      GLVCARHLKLFGYQPTIYYPKRPN-KP-------------LFTGLVTQCQK---------
NNRE_YEAST      GLVCARHLKLFGYNPVVFYPKRSERTE-------------FYKQLVHQLNF---------
NNRE_LEGPC      GYVLAQQAKKMGMVPTVWQVGHQMSMSK-------------PPQMHKEVWY---------
NNRE_LEGP2      GYVLAQQAKKMGMVPTVWQVGHQMSMSK-------------PPQMHKEVWY---------
NNRE_LEGPA      GYVLAQQAKKMGMIPTVWQVGHQMSMSK-------------PPQMHKEVWY---------
NNRE_LEGPH      GYVLAQQAKKMGMIPTVWQVGHQMSMSK-------------PPQMHEEVWY---------
NNRE_CENSY      ALVAARHLAGRGADVTVVLLGNPDGIRTE------------EARWNWSILE---------
NNRE_NITMS      GLVMARHLAGYNAKVTVMLLGNPENIKTE------------ESNWNWSILE---------
NNR_MYCTU       ALWAATFLRRRGAAADAVLLNPDR----------------THRKALAAFTK---------
NNR_ECOLI       GYVVARLAKAVGIEVTLLAQESDK-----------------PLPEEAALAR---------
NNRE_ELUMP      GLVCGRYLMERGVDVYCYIIPPFQGSYKG----------LVLKNLKRAFFS---------
NNR_SYNY3       GLVVARELKLQGYQVQVLQPLDKL-----------------KPLTQNHVDY---------
NNR_METJA       GFVVARHLGKGDVILIGKESEIKTYEARE------------NFKILKNLAE-------FG
NNR_HELPY       GYALARRLVGRFKTLVFEMKLAKSP----------------MCQLQQERAK---------
                                                                            

NNRE_ANAPD      ---KIFEPKSIEDLAIMERNLEEVSTIIDAIFGTGL--NRTVGGMQSYMISLINRTMKY-
NNRE_FINM2      ---EIEFVDENTKFDITENDL-----IVDSIFGTGL--KRDIEGIYKGVIDMINDSQAF-
NNR_THEMA       ---KVV--EQFEPSILNEFDV-----VVDAIFGTGL--RGEITGEYAEIINLVNKSGKV-
NNRE_LACRD      ---YYQIPETSDLAVLNKATL-----IVDAMFGIGI--DRAVKGAYADAINAINNTDAV-
NNRE_LACRJ      ---YYQIPETSDLAVLNKATL-----IVDAMFGIGI--DRAVKGAYADAINAINNTDAV-
NNRE_LACRS      ---YYQIPETSDLAVLNKATL-----IVDAMFGIGI--DRAVKGAYADAINAINNTDVV-
NNRE_LACF3      ---YYQIPVASDPALLKDADL-----IIDAIFGIGI--DRPVEGAYATVIKQVNAAHAP-
NNRE_LACBA      ---YYNIPVTADLNQIVNATL-----IVDAIFGVGL--TRDVTGKFADAINAINAADAK-
NNRE_OENOB      ---NYGVPFVSNIDDLSSYTT-----IVDAVFGVGL--SRDVTGEIAGIVDFINNSPAS-
NNRE_LACBN      ---YYQIPKVFMNADFNKFTT-----LVDALFGSGL--SRNVGGDFATIIDKANASTAK-
NNRE_LEUKI      ---KYGLVRAEK-SDFNEATL-----IIDAIFGTGL--NNLLPEGLQKMIKAANHIEKT-
NNRE_LEUS2      ---KYGLVHAEK-SDFNEATL-----IIDAIFGTGL--NNLLPEGLQKMIKAANHIEKT-
NNRE_LEUGG      ---KYGLVRSEK-SDFNEATL-----IIDAIFGTGL--NNLLPEGLQKMIKAANHIEKT-
NNRE_LEUCK      ---NYGLIRAEK-SDFNEATL-----IVDAIFGVGL--NNTLPEGLQKMIKAANHIEKT-
NNRE_LEUMM      ---KHGLVRSEK-SDFNEATL-----IIDAIFGVGL--NNVLPEGLQKMIKAANHIDKP-
NNRE_WEIKK      ---KYGLTPVNKVKDFRQYTV-----IVDALFGIGL--SKPVPIKLGEMIKRVNAANVP-
NNRE_RUBBR      MQLPAVSNATAADLSQALAELPESSLIVDALLGTGI--RGQVRAPFDEIITAVNAYRDDH
NNRE_RHOBA      AGIKIQVVGEAVEAGR----LPATDIVVDGLLGTGA--KPPLRGRYAEVVEAANA-----
NNRE_PIRSD      AKIKIIDLSRTPTAEAIATHFAEADWLVDAMLGTGA--TGEPRGAMRLAIEAINQ-----
NNRE_ISOPI      AGFDQQDWVLPEDNAKLAKSLSWCTWVVDALLGTGL--TRPIDGAFRTAVEMIND-----
NNRE_PLAL2      LGIP---WREMREFGEAAASARAEDWIVDAILGTGQ--SRPLSGVLAELVQGMNA-----
NNRE_RHOCB      IGTIAPLPAAPD--------FSSADLVVDALFGLGL--TRP----LTGFGPIFAALASAG
NNRE_ROSLO      ISFPSVLPAEAERFGDEAFGNGEVDVIVDALFGIGL--NRP----LSGLHPILATCHANR
NNRE_RHOSK      GGSCRPLTALAEV-------EAGRILVVDALLGIGQ--TRPCDDLLEPYWRARDGWDRAG
NNRE_ACHXA      --GWQAAGGET---WSTLEPGFVPGLVIDGLFGIGL--NRPLGADWQALVDTVNAWNVP-
NNRE_BORPD      --GWRAQGGAE---QSNLPSD-PPDVVIDGLFGIGL--NRPLDATWQTLVDAVNAWNRP-
NNRE_BORPE      --DWCAAGGQA---SADLPAH-APALVIDGLFGIGL--ARPLDGAWQGLIDQVNAWRVP-
NNRE_BORPC      --DWCAAGGQA---SADLPAH-APALVIDGLFGIGL--ARPLDGAWQGLIDQVNAWRVP-
NNRE_BORPA      --DWCAAGGQA---SADLPAH-APALVIDGLFGIGL--ARPLGGAWQGLIDQVNAWRVP-
NNRE_BORBR      --DWCAAGGQA---SADLPAH-APALVIDGLFGIGL--ARPLGGAWQGLIDQVNAWRVP-
NNRE_CLAM3      --GVPITSADELDDATLADIARSSALVVDGILGIGTTDSPALRGEGRRVVAALLPVVTAE
NNRE_CLAMS      --GVPITPAEELDDAEVAALARASALVVDGILGIGTTASPALRGEARRVVAALLPVILGA
NNRE_MICTS      --GARVVSV-----SDASAGVADYALVLDGILGIGRLADRRLRGSARALVERLLALAHR-
NNRE_DEHLB      --LELAGGREV---DPVSPETGEADIVLDALIGYSLL--GAPSGRSAELIRWLNAGNSR-
NNRE_TRURR      --RLAELPNVR---LRSSLPKMKFSCALDAAVGMRLE--GPPRGRTLDVITVLNNLGCK-
NNRE_MOUSE      --MDIPFLGEMPP--EPMMVDELYELVVDAIFGFSFK--GDVREPFHSILSVLSGLT---
NNRE_YEAST      --FKVPVLSQDEGNWLEYLKPEKTLCIVDAIFGFSFK--PPMREPFKGIVEELCKVQNI-
NNRE_LEGPC      EMNSCHQQGIVLHTYSPDIDLGDPELIVDALFGVGL--YGHVRPEIALLLQRLQQFTVP-
NNRE_LEGP2      EMNSCHQQGIVLHTYSPDIDLGDPELIVDALFGVGL--YGHVRPEIALLLQRLQQFTVP-
NNRE_LEGPA      EMNSCHQQGIVLHTYSPDIDLGDPELIVDALFGVGL--YGHVRPEIALLLQRLQQFTVP-
NNRE_LEGPH      EMNSCHQQGILLHTYSPDIDLGDPELIVDALFGVGL--YGHVRPEIASLLQRLQQFTVP-
NNRE_CENSY      -----KMPSIKLVSGGSFDASVSPDAIIDGILGTGI--TGEIREPYLSAIKFINGIQCT-
NNRE_NITMS      -----KMPSVKLMTGGTTNFDFKPDVIVDGILGTGI--SGEIREPYASAINYINQTDCY-
NNR_MYCTU       -----------SGGRLVESVSAATDLVIDGVVGISG--SGPLRPAAAQVFAAVQAAAIP-
NNR_ECOLI       ---EAWLNAGGEIHASNIVWPESVDLIVDALLGTGL--RQAPRESISQLIDHANSHPAP-
NNRE_ELUMP      ---HLSVKEIYQNLSDLKNSVADAYIVIDALLGIGF--KGEVKKNYKETIEVLNSSPSI-
NNR_SYNY3       ------GKSLGIPWVDGVQALAHCDLIIDALFGVGL--TRLITGAIADLITTINNLPIP-
NNR_METJA       NIRIREIKWAEEVNDIFERLKNKKAVIIDAMIGTGV--KGELREPFKTIVDKINELKQIN
NNR_HELPY       ----KAGVVIKAYEENALNQNLECDVLIDCVIGSHF------KGKLEPFLNFESLSQKA-
                                           :*  .*                           

NNRE_ANAPD      ----TISVDIPSGLDGDSGR------------NWGEVVDSDLIISMQIMKRGV--YEKSH
NNRE_FINM2      ----VVSVDMPSGLDSDENK------------IHNVAVKADLLVTLQLPKKS-----LQD
NNR_THEMA       ----VVSVDVPSGIDSNTGK------------VLRTAVKADLTVTFGVPKIGHILFPGRD
NNRE_LACRD      ----VVAVDMPSGVNTDTGE------------VMGTAVRATTTVTFAYNKVGLTKNDGKD
NNRE_LACRJ      ----VVAVDMPSGVNTDTGE------------VMGTAVRATTTVTFAYNKVGLTKNDGKD
NNRE_LACRS      ----VVAVDMPSGINTDTGE------------VMGTAVRATTTVTFAYNKVGLTKNAGKD
NNRE_LACF3      ----VVAVDVPSGINTDTGA------------VMGVAVKADLTVTFSYNKTGLVTDQGQA
NNRE_LACBA      ----TVAIDVPSGINADTGA------------VMGVAVVADSTTTMAYNKIGLLTTVGKQ
NNRE_OENOB      ----VMAVDMPTGLNADNGN------------IMGTAVKAAETVTMSYNKLGLISETGRK
NNRE_LACBN      ----IHAIDIPSGLNGDTGD------------VMGTAIKAISTSTVAYPKVGMLKDQAKP
NNRE_LEUKI      ----VIAVDTPTGIDATTGE------------VRGAALKAHTTVTFGYNKIGLTQRVGGY
NNRE_LEUS2      ----VIAVDTPTGIDATTGE------------VRGAALKAHTTVTFGYNKIGLTQRVGGY
NNRE_LEUGG      ----VIAIDTPTGIDATTGE------------VRGAALKAHTTVTFGYNKIGLTRRVGGY
NNRE_LEUCK      ----VIAVDIPTGIDATTGE------------VRGAALKAHTTVTFGYNKVGLTQNVGGY
NNRE_LEUMM      ----VIAVDVPTGIDATTGE------------VRGAALKAHTTVTFGFTKVGLTQQNGCY
NNRE_WEIKK      ----VVAIDVPSGINATTGD------------IMGSSIRATATVTFAYPKTGLLQGEGVK
NNRE_RUBBR      PHAIVFAVDVPSGLDCDTG------------LPCGVAIKADQTATFVMLKQGFVTGDGP-
NNRE_RHOBA      SSAIRIALDIPTGMNGDTG------------ETGETTFRADHTLTFAAPKVGFEKLGAA-
NNRE_PIRSD      SSVRTLAVDLPTGIDCDSG------------GAATVAVRADVTCTFVTLKPCCQVAACR-
NNRE_ISOPI      SGKPVYALDLPSGLDADTG------------EPLGVALRATATATFVAPKLACQYKEAE-
NNRE_PLAL2      SLSRRLAVDLPTGFSADAGPGLGNPLTEQPHELVELCVRADVTVTFVTPKMGMLHPGAR-
NNRE_RHOCB      RPV--LAIDLPSGRDADAR----------ADAAGWPSAPCSLAVTFHREKP--AHAQLR-
NNRE_ROSLO      HEAYFVAVDVPSGLGENGP----------LEAADWSVFPADLTVTFHRPKQ--AHQNGL-
NNRE_RHOSK      AEVRTLSVDVPTGFDCDNG----------VALARRP-FEADLVVSFHAEKP--VHARLR-
NNRE_ACHXA      ----VLALDVPSGIDADSGE--------ALG----RPIQARWTLSFIGRARGLERPGPGR
NNRE_BORPD      ----VLALDVPSGVDADSGR--------VLG----RALRARWTLSFIGAARGLCAPGPGR
NNRE_BORPE      ----VLALDVPSGLSAASGQ--------PLGDPPGRPVRATWTLSFIGVPAALRAPGAA-
NNRE_BORPC      ----VLALDVPSGLSAASGQ--------PLGDPPGRPVRATWTLSFIGVPAALRAPGAA-
NNRE_BORPA      ----VLALDVPSGLSAASGQ--------PLGDPPGRPVRATWTLSFIGVPAALRAPGAA-
NNRE_BORBR      ----VLALDVPSGLSAASGQ--------PLGDPPGRPVRATWTLSFIGVPAALRAPGAA-
NNRE_CLAM3      GGPAVIACDIPSGVGCDDGA--------VPDPA---VLPADVTVTFGAGKAGLMQ-GPGR
NNRE_CLAMS      GGPVVVACDIPSGVGCDDGQ--------VPDPT---VLSADVTVTFGAGKPGLMR-GPGR
NNRE_MICTS      --PRVLAVDVPSGLDPDDG---------TADAV---ILPADVTVTFGALKAGLVR-GRGP
NNRE_DEHLB      ----IISLDVPSGVDADSGL--------TPGEY----VRPQTTLTLAWPKTGLLPR----
NNRE_TRURR      ----VLSLDVPTGLAADSGE--------VPGDV----VRASATLALALPKPGTPPGG---
NNRE_MOUSE      --VPIASIDIPSGWDVEKG----------NPSG----IQPDLLISLTAPKKSATHF----
NNRE_YEAST      --IPIVSVDVPTGWDVDKGP--------ISQPS----INPAVLVSLTVPKPCSSHIR---
NNRE_LEGPC      ----ILAIEVPTGINASTGE------------IAGNALAATATITFLCMKLGLLINDGK-
NNRE_LEGP2      ----ILAIEVPTGINASTGE------------IAGNALAATATITFLCMKLGLLINDGK-
NNRE_LEGPA      ----ILAIEVPTGINASTGE------------IAGNALAATATITFLCMKLGLLINDGK-
NNRE_LEGPH      ----ILAIEVPTGINASTGE------------IAGNALAATATITFLCMKLGLLINDGK-
NNRE_CENSY      ----KMAIDAPSGLDPQTGE------------AADPCVKVDFTVTFHRMKEGIPKRK---
NNRE_NITMS      ----KFAVDVPSGLDPQTGE------------TANIFTKCDMTVTFHKMKQGIPKRK---
NNR_MYCTU       ----VVAVDIPSGIDVATGA------------ITGPAVHAALTVTFGGLKPVHALAD---
NNR_ECOLI       ----IVAVDIPSGLLAETGA------------TPGAVINADHTITFIALKPGLLTGKAR-
NNRE_ELUMP      ----KIAFDIPSGLNADSGQ------------NEGAVFKADYTYAMGFAKQGCLKAK---
NNR_SYNY3       ----VVSIDLPSGIETDTGE------------ILGVAVEADRSFCLGLWKRAYFQDRAL-
NNR_METJA       KNIFVISVDVETGH-----------------------LESDLTITFHKRKTIN-------
NNR_HELPY       --RFKIACDIPSGIDSKGR-------------VDKGAFKADLTISMGAIKSCLLSDRAK-
                      : :  :*                                .              

NNRE_ANAPD      FKDKCIVE-DIGIPQKAIRAIL---------------------------------
NNRE_FINM2      YEGEYVVE-PIGIPEKSIKHVLNNAS-----------------------------
NNR_THEMA       LTGKLKVA-NIGHPVHLIN>-----------------------------------
NNRE_LACRD      YAGNVVVANDMGTYAVD--------------------------------------
NNRE_LACRJ      YAGNVVVANDMGTYAVD--------------------------------------
NNRE_LACRS      YAGNIVVANDMGTYAVD--------------------------------------
NNRE_LACF3      YAGRVIVADDMGTY-----------------------------------------
NNRE_LACBA      HAGTIHVA-DIGIYAQDRVEHAR--------------------------------
NNRE_OENOB      FAGVVTVA-DIGIYEP---------------------------------------
NNRE_LACBN      YTGKIYVD-DIGIYRGNAFENE---------------------------------
NNRE_LEUKI      LSGNVIVK-DIGLLTPQDFNFSLPDKENSPSVATS--------------------
NNRE_LEUS2      LSGNVIVK-DIGLLTPQDFNFSLPDKENSPSVATS--------------------
NNRE_LEUGG      LSGNVIVK-DIGLLTPPDFSFSDTEENHSTKDV----------------------
NNRE_LEUCK      LSGNVIVK-DIGLRLPEDFTFTTVTPDNIATT-----------------------
NNRE_LEUMM      LSGNVILK-DVGMLIPDDFEFSLQETLPVA-------------------------
NNRE_WEIKK      RSGSIFVK-DIGIYSPAELHQFNPEIKEN--------------------------
NNRE_RUBBR      EYTGTTHVIDIGIPPALLDRLTAE-------------------------------
NNRE_RHOBA      RFTGEVHVISIGVPLELLRQFSV--------------------------------
NNRE_PIRSD      SYLGEVRVIDIGVPRALLEEIDAMP------------------------------
NNRE_ISOPI      EYLGEVAVLPIGLPYALLEDYIEED------------------------------
NNRE_PLAL2      EYLGETFVASIGLPEKLLREAVSLQ------------------------------
NNRE_RHOCB      AEGIGVIVKPIGL------------------------------------------
NNRE_ROSLO      SFCGKIMVQYIGL------------------------------------------
NNRE_RHOSK      AAGVTVAVADIGLSS----------------------------------------
NNRE_ACHXA      DACGISEVDTLGVIMTPAN------------------------------------
NNRE_BORPD      EAAGELHLDTLGVALA---------------------------------------
NNRE_BORPE      AWCGEQYLSLLGLTPAFLAEAVGPCGQATATAARRSGP-----------------
NNRE_BORPC      AWCGEQYLSLLGLTPAFLAEAVGPCGQATATAARRSGP-----------------
NNRE_BORPA      AWCGEQYLSLLGLTPAFLAEAVGPCGQATATAARRSGP-----------------
NNRE_BORBR      AWCGQQHLSLLGLTPAFLAEAVGPCGQATATAARRSGP-----------------
NNRE_CLAM3      ALAGRVELVDVGLD--LSGATPLVRAAR---------------------------
NNRE_CLAMS      ALAGRVELVDVGLD--LSGATPVARAAR---------------------------
NNRE_MICTS      ELSGRVHLVDLGLEPYLRRAHPAVTAAIDVVRETPRAAETDRAQRA---------
NNRE_DEHLB      -LTGELWLGDLGIPPAVYTRAGLKNFRSPFIAGYLVRLTASEQ------------
NNRE_TRURR      -VVGDLYLASFDLPEALFHDVGLEPFVAPSPWARIV-------------------
NNRE_MOUSE      -TGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ-----------------
NNRE_YEAST      ENQTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL------------------
NNRE_LEGPC      IYSGEIAFDDLLAPEAIYQQVKGIEESSLLDSSTIFSKKIWYRNKTQKGWQLSIN
NNRE_LEGP2      IYSGEIAFDDLLAPEAIYQQVKGIEESSLLDSSTFFSKKIWYRNKTQKGWQLSIN
NNRE_LEGPA      IYSGEIAFDDLLAPEEIYQQVKGIEESSLLDSSTCFSKKIWYRNKTQKGWQLSIN
NNRE_LEGPH      IYSGEIAFDDLLAPEAIYQQVKGIEKSSLLDSSTCFSKKIWYRNKTQKGWQLSIN
NNRE_CENSY      DLTGDVTVQKIGIPPEAEKGVL---------------------------------
NNRE_NITMS      DLTGELFAEKIGIPPEAEEGIL---------------------------------
NNR_MYCTU       --CGRVVLVDIGLDLAHTD>-----------------------------------
NNR_ECOLI       DVTGQLHFDSLGLDSWLAG>-----------------------------------
NNRE_ELUMP      DICGEIKVLNIGLPKELLSKV----------------------------------
NNR_SYNY3       AHLGQTELLGIGLPPQAIA>-----------------------------------
NNR_METJA       --KDNAIVKKIGIPKEAEY>-----------------------------------
NNR_HELPY       DYVGELKVGHLGVFNQIYE>-----------------------------------