CLUSTAL format seed alignment for MF_01968

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NPD_LACPL       ------------MSDITAAQTTLQQAQHIVFMTGAGVSTPSGIPDYRSKN-GLYTE----
NPD_ENTFA       ----------MQDITQAEAIHWLATQQKITFLTGAGISTASGVPDYRSLK-GVYQG----
NPD_LISIN       ---------------MNNLKEAIKQAEHIVFLTGAGVSVPSGIPDYRSKN-GLYAG----
NPD_LISMO       ---------------MNKLNEALKKAERIVFLTGAGVSVPSGIPDYRSKN-GLYAG----
NPD_LISMF       ---------------MNKLNEALKKAEHIVFLTGAGVSVPSGIPDYRSKN-GLYAG----
NPD1_BRADU      ----MRLIASDLRSGVERLGDMIAEAKTIVPFTGAGISTECGIPDFRSPG-GIWTR----
NPD_RHOPA       ------MIAPSLSSGVEQLGDMIAHASSIVPFTGAGISTESGIPDFRSPG-GLWSR----
NPD_LARHH       -----------MSDVIDELAAQWRACRHLLVLTGAGLSTESGIPDVRSATTGQVRQ----
NPD_BACSU       ---------------METFKSILHEAQRIVVLTGAGMSTESGIPDFRSAG-GIWTE----
NPD_BACC1       ------------MQQFEEVHSILEKAKKITVLTGAGASTESGIPDFRSAN-GLYAD----
NPD_BACAN       ------------MQQFEEVRTILEKAKKITVLTGAGASTESGIPDFRSAN-GLYAD----
NPD_BACCR       ---------MIFVQQFEEVRSILEKAKKITVLTGAGASTESGIPDFRSAN-GLYAD----
NPD_BACHK       ---------MIFVQQFEEVRLILEKAKKITVLTGAGASTESGIPDFRSAN-GLYAD----
NPD_BACCZ       ---------MIFVQQFEEVRLILEKAKKITVLTGAGASTESGIPDFRSAN-GLYAD----
NPD_CHRVO       --------MSATERQLQYLRQLVDGARRIAVLTGAGMSTESGIPDFRSAD-GLWSR----
NPD2_GEOKA      ------------MDQIRQLAQWIKEANTIAVLTGAGMSTESGIPDFRSEN-GLYAQ----
NPD_STAES       ----------MKKPDIQQLKDIVNNSNQIVFFTGAGVSVASGIPDFRSMG-GLYDEISKD
NPD_STAEQ       ----------MKKPDIQQLKDIVNNSNQIVFFTGAGVSVASGIPDFRSMG-GLYDEISKD
NPD_STAAR       -----------MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_STAAC       -----------MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_STAA8       -----------MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_STAAS       -----------MRNDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_STAAW       -----------MRNDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_STAAM       -----------MRNDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_STAAN       -----------MRNDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMG-GLFDEISKD
NPD_FUSNN       -------MDSKRDEKILELVKILKNTKYLVFFGGAGTSTDSGVKDFRGKD-GLYKTLYKD
NPD_CUTAK       -------------MTGEQLAHWIEESTSTVFFGGAGMSTESGIPDFRSAG-GLYTTQHDL
NPD_CLOPE       -----------MDDKINKLKEIIKNSNNIVFFGGAGVSTESGIPDFRSAN-GLFNEKLNI
NPD_CLOAB       ---------MLLLDKINELKKIVAESSSIVFFGGAGVSTESNIPDFRSEN-GLYKTKNNF
NPD_CLOTE       ------------MDTRKNLKELIKSSSNIVFFGGAGVSTESNIPDFRSEE-GLYKTKSNF
NPD_HALMA       MADDRHGIDDIDGETLDAVAEALRTAETAVALTGAGVSTASGIPSFRGDD-GIWER----
NPD2_STRCO      ----------------------MTGKPLVAILSGAGVSTDSGIPDYRGPN-GLWRR----
NPD_TREDE       --------MDKEKNDYDKLFSEITKARHLVAFTGAGISTLAGIKDFRGKD-GLYKQ----
NPD_THEMA       -------------MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPN-GIYKK----
NPD_THEYD       -------MDISYHEKISKTYELIKKSTYSVAFTGAGISTESGIPDFRSPN-GLWQR----
NPD2_CALS4      ------MFFMDSKNLFKKAAELIKSSQKTMVLTGAGISTESGIPDFRSPGTGLWEN----
NPD_SYMTH       -----------MLEQIQDFARALQASRYAVALTGAGASTESGLPDFRSNT-GLWKD----
NPD_BACSK       -----------------MFTTSLRQAQRIVVFTGAGMSTESGVPDFRSSR-GLCKG----
NPD_ALKHC       -----------------MLTTWLTEAKKIVIFTGAGMSTESGVPDFRSSR-GLWQG----
NPD1_GEOKA      ----------------MTITSWLAASRHTVVLTGAGMSTESGLPDFRSPRTGLWAR----
NPD_OCEIH       -----------------MIKDWLQESNYTVIFTGAGMSTESGLPDFRSANTGLWKQ----
NPD1_PYRAE      ------MAVDFTTDELDEVASLIARSSCNVALTGAGVSTASGIPDFRGPQ-GVWRR----
NPD_CALMQ       ------MGNGECLEGGRKAAVILTSSRHAIAFTGAGISTESGIPDFRGPQ-GLWRR----
NPD_SULAC       ---------MYLVEEAKKVAEMILSSVNAIAFTGAGISTASGIPDFRGPQ-GLWKK----
NPD_SACS2       -------------MIYEKVAEELISSSYTIAFTGAGISTASGIPDFRGPQ-GLWKK----
NPD_SULTO       -------------MECDKVGDLLLTSTYAIAFTGAGISTASGIPDFRGPN-GLWKK----
                                               : *** *. ..: . *.   *        

NPD_LACPL       HHNAEYYLSHAFLAEHPLEFY--Q-YLQS--NLY-YPDAQPNVIHQKMAALTQQGR-ASV
NPD_ENTFA       IQQPEYLLSRTCLKTEPEKFY--Q-FV-K--TLY-HPDAQPNIIHQKMAQLEQM-KRGKI
NPD_LISIN       MSSPEYMLSHTCLVREPEKFY--Q-FVTE--NMY-YPDAVPNTIHRKMAEIEAD-KNVTV
NPD_LISMO       MSSPEYMLSHTCLVREPEKFY--Q-FVTE--NMY-YPNAVPNVIHKKMAEIETE-KDVTI
NPD_LISMF       MSSPEYMLSHTCLVREPEKFY--Q-FVTE--NMY-YPDAEPNAIHTKMAEIEAE-KDVTI
NPD1_BRADU      -NRPIPFDGFVASQEARDESWRRR-FAME----ETFAAARPGRGHRALASLYRAGKVPAV
NPD_RHOPA       -NQPIPFDEFVARQDARDEAWRRR-FAME----QTFAKARPARGHRALASLYKAGKVPAI
NPD_LARHH       -PGCADALSLRFFQQDPAAFW--S-AFRTLFPFGTTGSACPDIGHRLLAQLAATDKTVTV
NPD_BACSU       DASRMEAMSLDYFLSYPRLFW--P-KFKELFQMKMSGSFEPNEGHLLLAELEKQGKQVDI
NPD_BACC1       -ANVEMYLSRGYYNRSPKEFW--K-HYKEIFQINTFHQYKPNRGHRFLAELEEQGKDITI
NPD_BACAN       -ANVEMYLSRGYYNRSPKEFW--K-HYKEIFQINTFHQYKPNRGHRFLAELEEQGKDITI
NPD_BACCR       -ANVEMYLSRGYYNRSPKEFW--K-HYKEIFQINTFHQYKPNRGHRFLAELEEQGKDITI
NPD_BACHK       -ANVEMYLSRGYYNRSPKEFW--K-HYKEIFQINTFHQYKPNRGHRFLAELEEQGKDITI
NPD_BACCZ       -ANVEMYLSRGYYNRSPKEFW--K-HYKEIFQINTFHQYKPNRGHRFLAELEEQGKDITI
NPD_CHRVO       DMSLTDAVSVDYFRRDPAAFW--R-AFRDIFHIKLVGDYQPNDGHRFLAALEASGKEVTI
NPD2_GEOKA      EDNVEYYLSEYYYKKDPVDFW--R-RFKRMFSLKMMGGFAPNDGHRFLRWLEEMGKTVTI
NPD_STAES       GQSPEYLLSIDHLHDNKESFI--N-FYHE--RLL-IADKKPNIVHQWIAQLENQQKSLGV
NPD_STAEQ       GQSPEYLLSIDHLHDNKESFI--N-FYHE--RLL-IADKKPNIVHQWIAQLENQQKSLGV
NPD_STAAR       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTMPNIVHDWIAKLERNQQSLGV
NPD_STAAC       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTMPNIVHDWIAKLERNQQSLGI
NPD_STAA8       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTMPNIVHDWIAKLERNQQSLGV
NPD_STAAS       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTKPNIVHDWIAKLERNQQSLGV
NPD_STAAW       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTKPNIVHDWIAKLERNQQSLGV
NPD_STAAM       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTKPNIVHDWIAKLERNQQSLGV
NPD_STAAN       GLSPEYLLSRDYLEDDPEGFI--N-FCHK--RLL-FVDTKPNIVHDWIAKLERNQQSLGV
NPD_FUSNN       KYRPEEVLSSDFFYSHRDIFM--K-YVEK--ELN-IKGLKPNKGHMALVELEKIGILKAV
NPD_CUTAK       PFPAEYMLSHSCLVEHPAEFF--D-FYRT--YLV-HPQARPNAGHRALAALERAGQVSTI
NPD_CLOPE       TFTPEQLVSHSFFERYPEEFF--N-FYKA--KLI-YPNSKPNDAHIALAKLEEMGKLKAI
NPD_CLOAB       SYPPEVMLSHTFFKNHTEDFF--E-FYRE--KMI-FKDAKPNAAHYSLAKIEEQGKLKAI
NPD_CLOTE       SYSPEVMLSHSFFKEHTEDFF--D-FYKE--KMI-YKYAKPNLAHHALAKLEKVGKLKAI
NPD_HALMA       -HDPA-DFHRRRLDADPAGFWADRLSLRE--AIYGDIDPEPNAAHEALAALEADGHLDAV
NPD2_STRCO      DPEAEKLVTYEYYMGDPEIRR--RSWLMR--RDSAALHAEPNAAHRAVADLERRGVPVRV
NPD_TREDE       -PNTEKMFDIDVFYRDPSVYY--G-MAKE--FIYGLEEKQPAIVHTVLADLEKRGILKAV
NPD_THEMA       -YSQN-VFDIDFFYSHPEEFY--R-FAKE--GIFPMLQAKPNLAHVLLAKLEEKGLIEAV
NPD_THEYD       -FRIVTYQEFIIDRKARNEFW--K-MKRE--LIQEIINAKPNNAHNALAELEKRGLLKYV
NPD2_CALS4      -MDPTEVLSTKVLFNSPEEFY--R-VGFK--ILSSMRNAEPNEAHYILSEMEKEGIIAGV
NPD_SYMTH       -VDPVSLISMTALRRRPVDFY--R-FYRM--RFSHLWGAQPNPVHKVLAALQREGLLKRL
NPD_BACSK       -NNPEALASLQAMNDNREAFV--D-FYRR--RMEQLQHVQPHKGYDVLATWEQQLSVTAI
NPD_ALKHC       -KNPEALASVDAMDHNREAFI--D-FYRM--RIEGLQGVRPHKGYDVLAAWEKELPITSI
NPD1_GEOKA      -FNPSELATIDALYHRRESFV--E-FYQY--RIRTLQQCQPHDGHRLLADWERRGIVQTI
NPD_OCEIH       -HDPSKIASIDTLNNNVETFI--D-FYRE--RVLKVKEYGPHQGHYILAEWEKQGLVHSI
NPD1_PYRAE      -VDPE-KFEISYFYNNPDEVW--D-LFVK--YLLPAFNVKPNPAHYALAEMERLGKLCAV
NPD_CALMQ       -FDPA-LASIDYLNTDPKGFW--E-FYIE--RFRVLNNARPNKAHLALAELEKLGIIKYV
NPD_SULAC       -YSPE-LASIEYFQKYPDAFW--Q-FYST--RMKSLFEAKPNRAHYALAQLEKMGLIKAV
NPD_SACS2       -YSPE-LASIEYFEKDPKNFW--G-FYSL--RMRGLFEAQPNKAHYSLAELEKMGIIKVI
NPD_SULTO       -YSPE-LATIEYFKKDPKGFW--E-FYRL--RMRGLFTALPNRAHYALAELEKMGLIRAI
                                                        *   :  :           :

NPD_LACPL       ITQNIDNLYGVAK--TAQLVEFHGNLYQVYCTKC-GQHVDWHEYLKS--------PYH--
NPD_ENTFA       VSQNIDGLHRKAG--SQEVVDFHGNLYECYCQTC-GATVPWQDYLLS-------DRHA--
NPD_LISIN       ITQNIDGLHEKAG--SKKVVNFHGSLYHCYCQKC-GRSVSASDYLQS-------DIHA--
NPD_LISMO       ITQNIDGLHEKAG--SKKVVNFHGSLYHCYCQNC-GMTVTAKDYLKS-------DIHT--
NPD_LISMF       ITQNIDGLHEKAG--SKKVVNFHGSLYHCYCQKC-GMSVTAEEYLKS-------DIHS--
NPD1_BRADU      ITQNIDNLHQASGFAHEHVIELHGNTTYARCVGC-GQTYQLDWVKRR--FDQDGAPNC--
NPD_RHOPA       ITQNIDNLHQVSGFAEHDVVELHGNTTYARCIGC-GKRHELDWVREW-FFRTGHAPHC--
NPD_LARHH       VTQNIDGLHQRAG--SPHVIEAHGSVERLVCPACLCRDHDATCQVQP-------VPHC--
NPD_BACSU       FTQNIDGLHKKAG--SRHVYELHGSIQTAACPAC-GARYDLPHLLER------EVPECTA
NPD_BACC1       LTQNIDGLHQLGG--SKHVIDLHGTLQTAHCPKC-KAGYDLQYMIDH------EVPRC--
NPD_BACAN       LTQNIDGLHQVGG--SKHVIDLHGTLQTAHCPKC-KMGYDLQYMIDH------EVPRC--
NPD_BACCR       LTQNIDGLHQLGG--SKHVIDLHGTLQTAHCPKC-KSGYDLQYMIDH------EVPRC--
NPD_BACHK       LTQNIDGLHQLGD--SKHVIDLHGTLQTAHCPKC-KTGYDLQYMIDH------EVPRC--
NPD_BACCZ       LTQNIDGLHQVGG--SKHVIDLHGTLQTAHCPKC-KTGYDLQYMIDH------EVPRC--
NPD_CHRVO       LTQNIDGLHGRAG--SRRVLELHGTLLTASCPDC-RSPHPLDYVQRH------ELPAC--
NPD2_GEOKA      LTQNIDGLHTKAG--STNVIELHGTLQTATCPSC-GNKYDLSFINRH------EVPRC--
NPD_STAES       ITQNIDGLHEDAG--SHNIDELHGTLNRFYCINC-YEEYSKSYVMTH------HLKYC--
NPD_STAEQ       ITQNIDGLHEDAG--SHNIDELHGTLNRFYCINC-YEEYSKSYFMTH------HLKYC--
NPD_STAAR       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNAC-HKSYMKSDVIDR------TLKHC--
NPD_STAAC       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNVC-HKSYTKSDVIDR------TLKHC--
NPD_STAA8       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNVC-HKSYTKSDVIDR------TLKHC--
NPD_STAAS       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNAC-HKSYTKSDVIDR------TLKHC--
NPD_STAAW       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNAC-HKSYTKSDVIDR------TLKHC--
NPD_STAAM       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNAC-HKSYTKSDVIDR------TLKHC--
NPD_STAAN       ITQNIDGLHSDAG--SQHVDELHGTLNRFYCNAC-HKSYTKSDVIDR------TLKHC--
NPD_FUSNN       ITQNIDDLHQVSG--NKNVLELHGSLKRWYCLSC-GKTADRNF-------------SC--
NPD_CUTAK       ITQNIDGLHQEAG--SRQVIELHGSVHRNRCLAC-GRAHPLSVIMDA-----PGVPRC--
NPD_CLOPE       VTQNIDGLHQMAG--SKNVFELHGSVLRNYCVDC-HTFYDEKFILES-----KGVPKC--
NPD_CLOAB       VTQNIDGLHQLAG--SKNVYELHGSIHRNYCMDC-GKSFDLEYVIKS----ETTIPKC--
NPD_CLOTE       ITQNIDGLHQLAG--SKNVIELHGGVGRNYCMDC-NKFFDLNYILNN----KEVVPKC--
NPD_HALMA       LTQNIDGLHDAAG--TDRVVELHGTHRRVVCDDC-GHRRDAEVVFEQAAESSDLPPRC--
NPD2_STRCO      LTQNVDGLHQLAGVSARKVLELHGTARDCVCTGC-GARGPMADVLAR-IEAGEDDPPC--
NPD_TREDE       ITQNIDLLHQKAG--SKNVIEVHGSPSVHYCINC-SYTETFEETAKT--AKTGEVPRC--
NPD_THEMA       ITQNIDRLHQRAG--SKKVIELHGNVEEYYCVRC-EKKYTVEDVIKK--LESSDVPLC--
NPD_THEYD       ITQNIDGLHQMAG--NKSVIELHGNQRGYICLDC-EKVYPLEEVLKM-LKEQELDLRC--
NPD2_CALS4      ITQNIDNLHQKAG--SKKVYEVHGNTREGSCLRC-GEKVSFELLEEK-VAKEEIPPRC--
NPD_SYMTH       ITQNVDGLHQAAG--SPDVIELHGSLRECQCLRC-GRRFPSRLIDVE-VETEADIPRC--
NPD_BACSK       ITQNTDGLHERAG--NQRVLPLHGSIQKLYCIQC-GQHYDVDRYMNN-------QPSC--
NPD_ALKHC       ITQNTDGLHEQAG--SEVVLPLHGSIQRLYCVAC-GQRYDVARYITN-------EPYC--
NPD1_GEOKA      VTQNVDGFHQEAG--SRRVIELHGSLRTVHCQRC-GESKPSFVYLHG-------VLTC--
NPD_OCEIH       VTQNVDGFHQASG--SKIVHELHGTLQKLHCQSC-GKEYSSKEYVEN-------EYHC--
NPD1_PYRAE      ITQNVDRLHQAAG--SKNVIELHGALEYAVCTNC-GSKYALAEALKW---RKSGAPRC--
NPD_CALMQ       ITQNIDNLHQSAG--SINVIELHGNYTTVYCMRC-KTQYPFTLALRK-YEEGENPPRC--
NPD_SULAC       ITQNVDGLHSVAG--SRNVIELHGNMRKSYCTSC-LRSYDSLEVLAR-VEKGEVIPRC--
NPD_SACS2       ITQNIDGLHQKAG--SKNVIELHGTMRRSYCVLC-LRTYDSLNVLSM-IEKGNLPPRC--
NPD_SULTO       ITQNIDGLHQLAG--SRNVIELHGNMRKCYCVNC-LKTYDSDTVLDK-IDKEGLPPKC--
                .:** * ::  .      :   **      *  *                          

NPD_LACPL       -----QTDHGYLRPNVVLYDEGIASANIERAVQYLQQADLVVICGTSFRVYPFAGL---I
NPD_ENTFA       ------DCHGQIRPAITLYEEGLSEEAIEKAIQAVASADLIVIVGTSFQVHPFCDL---I
NPD_LISIN       ------DCGGVVRPDVVLYEEAISESAIDQSLAAIREADLIVIVGTSFRVSPFCNL---T
NPD_LISMO       ------DCGGVIRPDVVLYEEAISESAIDQSLTAIRKADLIVIVGTSFRVSPFCNL---T
NPD_LISMF       ------GCGGVIRPDVVLYEEAIPESAIDQSLAAIRQADLIVIVGTSFRVSPFCNL---T
NPD1_BRADU      -----TVCDEPVKTATISFGQMMPEEEMQRATALSRACDLFIAIGSSLVVWPAAGFP--M
NPD_RHOPA       -----TACDEPVKTATVSFGQSMPSDAMRRATELAQHCDLFIAIGSSLVVWPAAGFP--M
NPD_LARHH       -----HCCGEVLKPDVVLHGEPVE--AMDAALAALAEADCLWVMGSSLEAGPVNQLP--A
NPD_BACSU       AGNNGDICGTVLKTDVVLFGDAVM--HFDTLYEKLDQADLLLVIGTSLEVAPARFVP-ED
NPD_BACC1       -----EKCNFILNPDVVLYGDTLP--QYQNAVKRLYETDVLIVMGTSLKVQPVASFP-QI
NPD_BACAN       -----EKCNFILNPDVVLYGDTLP--QYQNAIKRLYETDVLIVMGTSLKVQPVASFP-QI
NPD_BACCR       -----EKCNFILNPDVVLYGDTLP--QYQNAIKRLYETDVLIVMGTSLKVQPVASFP-QI
NPD_BACHK       -----QKCNFILNPDVVLYGDTLP--QYQNAIKRLYETDVLIVMGTSLKVQPVASFP-QI
NPD_BACCZ       -----QKCNFILNPDVVLYGDTLP--QYQNAVKRLYETDVLIVMGTSLKVQPVASFP-EI
NPD_CHRVO       -----RRCGAALKPDVVLYGEAVP--LIDVAFQAALNAELLLVMGSSLEVSPVNLIP--V
NPD2_GEOKA      -----EKCQTIVKPDVVLFGGLVP--RMEEAFAAAAASDLLLAMGTSLEVAPVNQIPFYV
NPD_STAES       -----EKCGNVIRPDIVLYGEMLNQKTVFKALDKIQHADTLIVLGSSLVVQPAAG----F
NPD_STAEQ       -----EKCGNVIRPDIVLYGEMLNQKTVFKALDKIQHADTLIVLGSSLVVQPAAG----F
NPD_STAAR       -----DNCGGAIRPDIVLYGEMLDQPTIIRALNKIEDADTLVVLGSSLVVQPAAG----L
NPD_STAAC       -----DNCGGAIRPDIVLYGEMLDQPTIIRALNKIEHADTLVVLGSSLVVQPAAG----L
NPD_STAA8       -----DNCGGAIRPDIVLYGEMLDQPTIIRALNKIEHADTLVVLGSSLVVQPAAG----L
NPD_STAAS       -----DNCGGAIRPDIVLYGEMLDQPTIIRSLNKIEHADTLVVLGSSLVVQPAAG----L
NPD_STAAW       -----DNCGGAIRPDIVLYGEMLDQPTIIRSLNKIEHADTLVVLGSSLVVQPAAG----L
NPD_STAAM       -----DNCGGAIRPDIVLYGEMLDQPTIIRALNKIEHADTLVVLGSSLVVQPAAG----L
NPD_STAAN       -----DNCGGAIRPDIVLYGEMLDQPTIIRALNKIEHADTLVVLGSSLVVQPAAG----L
NPD_FUSNN       ------ECGGVVRPDVTLYGENLNQSVVNEAIYQLEQADTLIVAGTSLTVYPAAY----Y
NPD_CUTAK       ------SCGGMVRPEVVLYEESLRSQDLDNATTAISTADLLIVGGTSLNVYPAAA----L
NPD_CLOPE       -----TKCGGIVKPDVVLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGL---I
NPD_CLOAB       -----DKCGGIVKPDVVLYEEGLDDSIIQNSVKAISEADTLIVGGTSLVVYPAAG----L
NPD_CLOTE       -----DVCGGIVKPDVVLYEEPLNMDNINNAVRYVENSDVLIVGGTSLVVYPAAN----L
NPD_HALMA       ------DCGGVYRPDVVLFGEPMPDVAMNEAQRLARDSDVFLAVGSSLSVQPASLLP--K
NPD2_STRCO      -----LDCGGVLKTATVMFGERLDPVVLGEAAAISKACQVFVAVGTSLQVEPAAGLA--R
NPD_TREDE       -----PKCGSPIKPAITFFGEALPQKALMKAETEASKSDFMLVLGTSLLVYPAAALP--A
NPD_THEMA       -----DDCNSLIRPNIVFFGENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELP--L
NPD_THEYD       -----EVCGGIIKPTIVFFGEPMPEKELLMAQQIANKCDIMFVIGTSLQVEPAASIP--R
NPD2_CALS4      -----DRCGGMLRPDVVLFGDPMPH-AFDLALKEVQESDLLIVIGSSLVVAPVNFLP--G
NPD_SYMTH       -----PECGGVLKPGVVLFEEALPADAIEAAIEAAMKADLFLVVGSSLEVGPANQLP--V
NPD_BACSK       ------SCGGFIRPSVVLFGEPLDSNILALAEQHSIEADVFIVLGSSLVVSPANLFP--R
NPD_ALKHC       ------SCGGFIRPAVVLFGEMLNTDTLALAERHTKEADLFLVLGSSLVVSPANLFP--K
NPD1_GEOKA      ------ECGGVLRPSVVLFGEPLPEKAITEAWEAAQQADLFLVLGSSLQVSPANQLP--L
NPD_OCEIH       ------DCGGVLRPSIILFGEMLPQEAFQTAFNDAEKADLFVVLGSSLTVSPANQIP--L
NPD1_PYRAE      -----PKCGGVIKPDVVFFGEPLPQDALREAFMLAEMAEVFMAIGTSLAVYPANQLP--L
NPD_CALMQ       -----PKCGGILRPNVVLFGEPVN--EINRALEIAALSDVALVVGSSLTVYPAAYVP--L
NPD_SULAC       ------ECGGILKPDVVLFGEPVH--GIYEAMRIANESDLVLAIGSSLTVYPANQIP--L
NPD_SACS2       ------DCGGIIRPDVVLFGEPVK--NIYEALSIAYESDLVISIGSSLTVYPANLIP--Q
NPD_SULTO       ------ECGGVIRPDVVLFGEPVY--NISSALEIAREADLVLAIGSSLTVYPANMIP--L
                            ..    .   :               .     *:*: . *        

NPD_LACPL       DYRNPKAQVLAINAEPLQLPFAFTMVQQD-AVDFFEGVQV---------------
NPD_ENTFA       HYKQPTATILAINQTPLFLQQPYYFLEAK-AETIFAELTIKE-------------
NPD_LISIN       DYRNKKARIFAVNKERISLPYPFEMIEND-AVKVFAEI-----------------
NPD_LISMO       DYRNKKARIFAVNKERISLPYPFEMMESD-AVKVFEEI-----------------
NPD_LISMF       DYRNKKARIFAVNKEQISLPYPFEMMESD-AVKVFAEI-----------------
NPD1_BRADU      MAKRAGARLVIINREPTEQDDIADLVIRH-DIGETLGPFVGN-------------
NPD_RHOPA       LAKECGAKLVIINREPTEQDEIADLVIRH-DIGETLGPFVGN-------------
NPD_LARHH       LARHWRMPSALVNLQPTALDSRFDLCLHW-PIGEVCAKFRQILGFDSD-------
NPD_BACSU       ASLIPGMKKVIINLEPTYCDSLFDMVIHQ-KIGEFARSLGMKK------------
NPD_BACC1       AKREVGATTILVNEELTGQEYNFDYVFQN-KIGEFVEGLSSRK------------
NPD_BACAN       AKREVGATTILVNEELTGQEYNFDYVFQN-KIGEFVEGLSSIK------------
NPD_BACCR       AKREVGATTILVNEELTGQEYNFDFVFQN-KIGEFVEGLSSMK------------
NPD_BACHK       AKREVGATTILVNEELTGQEYNFDYVFQN-KIGEFVEGLSSIK------------
NPD_BACCZ       AKREVGATTVLVNEELTGQEYNFDYVFQN-KIGEFVEGLSSRK------------
NPD_CHRVO       EAARAGIPCALINYTPTRFDALFDLCIQA-GIGDTCRQLRA--------------
NPD2_GEOKA      AAESPATRKVLINKTATRMDGMFDLVIYG-GIGKTVASVRKQIQAE---------
NPD_STAES       VSEFKGDNLVIINRDATPYDHTASLVIHD-DMTSVIEEIVNSNS-----------
NPD_STAEQ       VSEFKGDNLVIINRDATPYDHTASLVIHD-DMTSVIEEIVNSNS-----------
NPD_STAAR       ISNFKGDNLIIINKDRTPYDNDATLVIHD-DMVSVVKSLMTE-------------
NPD_STAAC       ISHFKGDNLIIINKDRTPYDSDATLVIHD-DMVSVVKSLMTE-------------
NPD_STAA8       ISHFKGDNLIIINKDRTPYDSDATLVIHD-DMVSVVKSLMTE-------------
NPD_STAAS       ISNFKGDNLIIINKDRTPYDRDATLVIHD-DMVSVVKSLMTE-------------
NPD_STAAW       ISNFKGDNLIIINKDRTPYDRDATLVIHD-DMVSVVKSLMTE-------------
NPD_STAAM       ISHFKGDNLIIINKDRTPYDSDATLVIHD-DMVSVVKSLMTE-------------
NPD_STAAN       ISHFKGDNLIIINKDRTPYDSDATLVIHD-DMVSVVKSLMTE-------------
NPD_FUSNN       LRYFRGKNLIIINDMDTQYDGEASLVIKD-NFSYVMDRVVKELKKIQFGKTLKNI
NPD_CUTAK       LRFFRGRHLVFINREATGYDRAADLVIHD-GLGKTLSAVQRAVMP----------
NPD_CLOPE       NYYFRGKNLVLINKSSTQADSKADLVIND-SIGKVLGKVID--------------
NPD_CLOAB       IRYFKGNKLILINKSATAYDNEADLVISD-SIGKVLETVI---------------
NPD_CLOTE       IHYYKGNKLVLINKSSTPYDRKAQIVIND-SIGSILGGIVEELGY----------
NPD_HALMA       IAAEGDSTLVVVNYEETPRDASAAHVLRA-DVTQVLPAIVERL------------
NPD2_STRCO      VAVEHGARLVVVNAEPTPYDELADEVIRE-PIGSALPALLRGLG-----------
NPD_TREDE       YTLRNGGKIAIVNNQPTQFDSYTDLLFED--LEETFEEIDKRLKKV---------
NPD_THEMA       ITVRSGGKLVIVNLGETPFDDIATLKYNM-DVVEFARRVMEEGGIS---------
NPD_THEYD       IAYQNGAKLIFINKVQTEWDWIAEIIFYD-SAGKVLKDILDVIKSEKF-------
NPD2_CALS4      MVD----GLIIINATETPYDYKADVVIRE-KASYALRNIWNLIKS----------
NPD_SYMTH       LAVQHGGRLAIFNLTPTFLDPRATWIFRE-KAGQALGALAAELGISL--------
NPD_BACSK       IAKEHGAKLIIVNHDSTPLDTIADYVVNDKPIGSFLVETNRALQK----------
NPD_ALKHC       IAKECGAKLVIVNHDETPLDPLADLVIQDQSIGTFLEETNRALQA----------
NPD1_GEOKA      VAKRNGAKLVIINWEPTELDDLADAVIHQRKIGEVLNELNEQLAEVDP-------
NPD_OCEIH       IAKENGAKLVIVNQDPTPYDQYADMTISDQKIGEFLRSISNEG------------
NPD1_PYRAE      VAKKRGAKLVIINADETYYDFFADYIIRG-RAEEVLPKLLDRLRGMLF-------
NPD_CALMQ       VVKEHGGRLIIINLEPTDYDDYADVVLHC-SASEALDLVLNEVKGIMAAGN----
NPD_SULAC       IVKRNGGGLIILNGEETPYDEYADLVIRE-RIEIFLPEVISHIQSLHRSS-----
NPD_SACS2       TVKERGGKLIILNMEETPLDSIADYVVRE-PVEISLPKILENVRQKILS------
NPD_SULTO       TVKEMGGKLIILNAEETPLDNIADIVVRE-RVEEFLPCVVDYIKSQTLHRSS---
                           .*