CLUSTAL format seed alignment for MF_01969

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KYNB_PSEF5        -------------MENTPRWWDISPPLSTATPTWPGDTPFQEERVWQFGPE-CPVNVGRV
C3K207_PSEFS      -------------MNPIKTWWDISPPLSTATPTWPGDTPFQEERVWQFGPE-CPVNVGRI
KYNB_PARXL        ----------------MRTLWDITPAVDTATPVWPGDTPVGIERVWRMEAG-SPVNVARL
D5WCD2_PARAM      ----------------MRALWDITPAVDPATPVWPGDTPVGIERVWRMEAG-SPVNVARL
E1T849_BURSG      ----------------MQTLWDITPAVDTTTPVWPGDTPVGIERVWRIEAG-SPVNVARL
KYNB_PARP8        ----------------MDTLWDITPAVDTATPVWPGDTPVGIERVWRMEAG-SPVNVARL
KYNB_BURPS        ----------------MDTIWDISPPIAPATPVWPGDTPVGIERVWRIEAG-SPVNVARV
C5ACA9_BURGB      ----------------MATLWDISPDIFADTPVWPGDTRVSVDRVWRIEAG-SPVNVARL
F2L8W0_BURGS      ----------------METLWDISPAISPATPVWPGDTEVAVERVWRMEAG-SPVNVARL
KYNB_BURVG        ----------------MDTLWDISPPLSPATPVWPGDTPLSVERVWRMEAG-SPVNVARL
KYNB_CUPPJ        ------MTNRPATPADSRKLWDISPPLSPATPVWPGDTPFQQETAWQMDEH-CPVNVGRI
KYNB_CUPTR        ---------MTAPNPDPRRLWDISPPLSPATPVWPGDTPFQQQPAWQIDAQ-CPVNVGRI
KYNB_CUPMC        -------MPQAPQLHDGRRIWDISPAVSPATPVWPGDTPFQHDPAWQLDEH-CPVNVGRI
KYNB_RALSO        ---------------MERTLWDISPALSTATPTWPGDTPFSQEIAWKLEGD-CPVNVGRI
KYNB_PSEAE        --------------MTSLRYWDISPALDPNTPTWPGDTPFQQEWAARLDEQ-CPVNVGRI
KYNB_PSEFL        --------------MPTRKLFDISPPITTAIATWPGDTDYQQEPVWVLDHQ-CPVNVGKI
G2IUB7_PSEUL      ------------------MLFDITPPLSAGTPVWPGDTPFSAHRTWQLGAD-CPVNVSRL
KYNB_BORPD        ----------------MKRLWDISPPVSAASPVFPGDTPYQQHWKWSLTPD-CPVNVSEI
E3HWS1_ACHXA      ----------------MKRLWDISPPVSTASPVFPGDTPYRQQWKWSLTPG-CPVNVSEI
KYNB_BORPE        ----------------MKRLWDISPPVSADSPVFPGDTPYRQQWKWSLTPD-CPVNVSEI
KYNB_BORA1        ----------------MKRLWDISPPISSQSPVFPGDTPYRQQWKWQLSPE-CPVNVSEI
D6CPM0_THIA3      -----------MNRPPRSRVWDISPTVSPSAPVFPGDEPFSLEWTARLGPG-CPVNLSAV
KYNB_POLNA        MTEPAAHFASHAAAARTLRIWDISPPLDERSEVFPGDTAYSQELHFSLSPG-CPVNVNRI
KYNB_POLSJ        ----MTARVLPSTTAKPLRLWDISPPVAPGSPVFPGDTPYQQQWAASIAPG-CPVNVSTL
E6V3N4_VARPE      ---------MRSLQPQP-RVWDISPPVHEGAPVFPGDTPYQQRWAATISPE-CPVNVSEI
KYNB_DELAS        ---------------MTRRLWDISPAVQAASPVFPGDTAYSQQWCATIGPG-CPVNVSAI
D0J4I3_COMT2      ---------------MTRQIWDISPAIHPAAPVFPGDTPYSQEWVASIGPG-CPVNVSAI
B9MCU2_ACIET      ------MRAMTATSTPSPALWDISAPVHAGSPVFPGDTPYQQQWSATLGPG-CPVNVSAL
F4GCE3_ALIDK      -----------MTRANPPRLWDISAPVHAASPVYPGDAPYRQQWSATIGPD-STVNVSCL
KYNB_ACIAC        -------------MTTPRMLWDISAPVHAGSPVFPGDTPYSQQWCATIGPQ-CPVNVSAL
I0HNS7_RUBGI      --------------MAEARIWDISPPVHAGSPVFPGDAPYQAQWAARIAPG-CPVNLQTV
C0ZSI1_RHOE4      ----MVPRIGRHTGDSGARLIDISPPISESTPVWPGDTAFTRAVTSDLGDS-DAVTINRI
KYNB_ERYLH        ----------MSSWKSQRRIWDISQTLRPGLPIWPGDTEFGFERTWRMDEG-SPVNVGRM
KYNB_SPHAL        ----------------MSRIWDISQPLHAAVPVWPGEPAFSLHSHAVIGEG-CPVNVGGM
KYNB_MARMM        ----------------MAKMWDISQTLRPDLPVWPGDTAFACDEVWSIGPD-CPVQVSRL
B6IV25_RHOCS      --------------MGKRRIWDISQPVRTGIPVWPGDTAYAEERTWSIGPG-CPVTVSRL
F2J1U2_POLGS      ----------------MGRIIDITPAVRLGMAVFPGDAAYRVTQTFAIGPQ-CPVNVAEF
KYNB_SALRD        -----------------MALIDISRSVSPATAVWPGDQEVQWTWTARRNEDESSVNLGSL
KYNB_DEIGD        -------------------MIDISRQLTPSHPNWPGDAPFRVKPGARIAQG-DSVNTGEL
C1CWE9_DEIDV      -----------------MTLLDISRALTAAHPNWPGDAPLRVNPGARISAG-DSVNTSEL
E8U822_DEIML      --------------MNLSRVRDISRSLTPGHPNWPGDAPFSVEPAARIANG-DTVNTGVL
F0RPQ2_DEIPM      -----------------MQVLDISRALTPGHPNWPGDAPFTVTPGARISSG-DSVNTGVI
D7BCL0_MEISD      -------------------MWDITRRLYPGHPVWPGDTPFTYELTWKMAEG-ASVNVGKI
D3PQL7_MEIRD      -------------------MIDITRPIHPGVPVWPGDTPFSYELVARIAGG-DSVNVGKF
F2NPG7_MARHT      ---------------MPPRLIDITRALYPGHPVWPGDAPFALELTASMRDG-QPANVMRF
D7CT12_TRURR      -------------------MIDLTRALYRGHPNWPGDTPFTLEPTSKIAEG-AAVNVMAL
KYNB_BACAN        --------------MKTSKWIDISQPLNNDIATWPGDTPFSYEVLWSKEES-GSVNVGKL
KYNB_BACCR        --------------MKTSEWIDISQPLNNNIATWPGDTPFSYEVSWSKEES-GSVNVGKL
KYNB_BACCN        --------------MKASEWIDISQPLNNEIATWPGDTPFSYEVSCTKEQS-GSVNIGKV
C0ZG29_BREBN      -----------------MKIIDISRPFMAGMPTWPGDTPFHYVVNWPKAES-GSVNVGKV
KYNB_GEOTN        ---------------MMNPWIDISQRLDEHIPVWPGDTPFSYRTRWNKAES-GSVNVGQI
D5DK14_BACMD      ----------------MSKWIDISQPLDDKIARWPGDTPFSYELNWSKEET-GSVNVGKI
C4KZB8_EXISA      -----------------MTWIDVSQPLHADVATWPGDTKFSYDIAWPMAES-GSVNVGKM
B1YHD3_EXIS2      ----------------MNRWMDVSQPLTSSITTWPGDTKFDYTINWSKADT-GSVNVGQV
Q5WKB4_BACSK      ----------MNHTNNMNRWIDVSQPLNEKLAHWPGDLPYSYQLTFSKQQT-GSVNIGQM
D3FTN3_ALKPO      ----------MKD----NQWIDISQPLDEKLAHWPGDTPFHYVTEYTKEQT-GSVNIGKL
Q8ES87_OCEIH      ----------------MGVWIDISQPINNNLACWPGDQSFHFHTPVTKEMT-GSVNIGRI
I0JSI0_HALH3      -----------------MKLIDITMSLHNETPAWPGDEPFHYERTMTMEQT-GSVNIGQF
F2F7Z2_SOLSS      ------------------MWIDITQTMQNGMPNWPGDTPFSFEVGISKQQT-GSVNIGRM
C1A7G6_GEMAT      ------------------MWHDISVPLGAGTPEWPGDHPFTCGWTMRREDG-ESVNLAAI
                                       *::  .      :**:                ..    .

KYNB_PSEF5        TLSPHTGAHVDAPLHYRPDGLPIGEVSLDVYMGPCRVLHCLDSGALVQPEALLGRLEN--
C3K207_PSEFS      TLSPHTGAHVDAPLHYSADGAPIGEVSLDVYMGPCRVLHCLDSGALVQPHQLEGRVDN--
KYNB_PARXL        TLSPHTGAHTDAPLHYDAEGAAIGDVPLDAYLGRCRVIHCIGASPVVTPQHLTGSLDD--
D5WCD2_PARAM      TISPHTGAHTDAPLHYDADGAAIGEVPLDAYLGLCRVIDCIGASPVVRPQHLTGSLDD--
E1T849_BURSG      TLSPHTGAHTDAPLHYDAAGAAIGHVPLDTYLGPCRVIHCIGASPVVTPQHLHDSLGD--
KYNB_PARP8        TMSPHTGAHTDAPLHYDAGGVAIGAVPLDSYLGRCRVIHCIGVKPLVMPDDLAGSLDG--
KYNB_BURPS        TLSPHTGAHADAPLHYDADGAPIGAVPLDAYLGRCRVIHCIGARSAVTPEHVRAALAG--
C5ACA9_BURGB      TLSPHTGAHADAPLHYDAHGAPIGAVPLDTYLGACRVIHCLGAAPLVRPEQLAASLAG--
F2L8W0_BURGS      TLSPHTGAHADAPLHYDAEGAPIGAVPLDAYLGACRVIDCLGAAPAVAPARIAAALAG--
KYNB_BURVG        TLSPHTGAHCDAPLHYDADGAPIGAVPLDAYLGPCRVIHCVGAAPRVQPADVEAALDR--
KYNB_CUPPJ        TLSPHTGAHADAPLHYAADGAPIGEVGLEPYLGRCRVIHCVGATPVVAPHHVEHALND--
KYNB_CUPTR        TLSPHTGAHADAPLHYAADGAPIGAVPLAPYLGRCRVIHCIGAAPLVQPHHVEHALDA--
KYNB_CUPMC        TMSPHTGAHADAPLHYAADGAPIGAVPLDAYLGPCRVIHCIGAAPRVEPQHIAHALAG--
KYNB_RALSO        TLSPHTGAHADAPLHYHADGAPIGAVPLDAYLGPCRVIHCVGVA-RVEPEHVRDALDG--
KYNB_PSEAE        TLSPHTGAHVDGPLHYRADGLPIGQVPLDIYMGPCRVIHCIGANPLVTPEHLAGQLDD--
KYNB_PSEFL        TLSAHTGAHADAPLHYSNSGAAIGSVPLEPYLGTCRVIHCFDSDGLVRPAQLLPHLAQ--
G2IUB7_PSEUL      TLSTHCGAHADAPLHYSPHGLAIGAVELTPYLGPCRVVHCLDAGPLVTWPQLAARLQGVA
KYNB_BORPD        RLSPHIGAHADAPLHYSNGAPAIGAVPLEPFLGPCRVIHALDCGPLILPEHLRHAADG--
E3HWS1_ACHXA      TLSPHIGAHADAPLHYQNGAAAIGAVSLEPFLGPCRVIHAIDCGPLITVDHVAHAALN--
KYNB_BORPE        TLSPHIGAHADAPLHYENGAAAIGAVALEPFLGPCRVIHAIGCGPLILPEHLAHAQAG--
KYNB_BORA1        TMSPHIGAHADAPLHYANGATAAGCLPLEPFLGPCRVIHALDCGPLILPEHLAHAADD--
D6CPM0_THIA3      RFSPHVGAHADAPLHYANDGASIDAVGLAPYLGPCRVIHALDCGALIDIAHLQHAAAN--
KYNB_POLNA        TLSPHTGAHADAPLHYASGEAAIGAVDLQPYLGPCRVIHCLDCGPLVEPAHIAHALEN--
KYNB_POLSJ        TLSPHIGAHADAPLHYDPQGATIGAVDLTPYIGPCRVIHAIAKGPLIEWEHLAHAVH---
E6V3N4_VARPE      KLSPHIGAHADAPLHYDPEGQTIGHVDLAPFLGPCRVIHAIAKGPLIEWEHIAHAVTS--
KYNB_DELAS        TLSPHVGAHADAPLHYDADGASIGNVDLDAFLGPCRVIHAIGKGPLVEWEHIAHAVEH--
D0J4I3_COMT2      HLSPHVGAHADAPLHYDVQGAAIGAVDLDAFLGPCRVIHAMGCGPLIEWSHIAHAIDAG-
B9MCU2_ACIET      TLSPHVGTHADAPLHYAADGAAIGAVPLEAFIGPCRVVHALDCGPLIEWTHIAHAMTGT-
F4GCE3_ALIDK      MLSPHVGTHADAPLHYDNDGAAIGAVPLDAFIGPCRVVHAMGCGPLVQWRHIAHAMTAD-
KYNB_ACIAC        AMSPHVGTHADAPLHYDPQGATIGDVPLDAFIGPCRVIHAIGRGPLVAWEHIAHALGADR
I0HNS7_RUBGI      TLSPHVGAHADAPLHYDEAGTPVGLLDLAPYLGRCRVIHAIGAAPLVRWEHLTHALDG--
C0ZSI1_RHOE4      TTTPHIGAHADAPAHTRIGGAPIGSVPLEPYLGEALVVDMTGVDGAACIRPVEETVERLG
KYNB_ERYLH        TMSTHSGTHGDAPLHYAEDGLDAASMELDSYIGECLVVDARGVSGEIDVADL--PHIES-
KYNB_SPHAL        FTPLHAGTHGDAPLHYSNDGASSADCELAPYIGPCALIDVRHARGRVEIGDIDWSCVDG-
KYNB_MARMM        TLSTHSGAHADAPSHYDQAGDDIASTPLELYVGPCRLVTASGNGPHVQPADLDWAAIDG-
B6IV25_RHOCS      TLSSHTGTHADAPLHYAADGEPAGALDLTRYLGPALLLHVRPGLPRVEPAHLDGRVPPG-
F2J1U2_POLGS      AMSCHCGAHADAPLHYDPDGAPIDRLDLDDFIGPARLVDARGDGPLVRPQDIEPALDG--
KYNB_SALRD        RLSTHTGTHVDAPLHVKRQGQATDDLPLDSFVGPARVVDVNANAPSVRPEHIGQLDGA--
KYNB_DEIGD        CTSTHTGTHVDAPWHYSETGARLEEVELNRYVGRCRVVTVRAEGGLIPAAALAGLPKR--
C1CWE9_DEIDV      CTSTHTGTHVDAPWHYDDLGERLDAVPLEVYVGSCRVLSVHG-SGLIEPEELGDLPET--
E8U822_DEIML      STSTHTGTHVDAPWHYDDAGVRLHDVPLDVYLGRARVIHATG-HALVPASVLDGL-DD--
F0RPQ2_DEIPM      STSTHTGTHVDAPWHYDDAAPRLHEIPLDVYVGRALVVRVPP-GERIEASLLDTLPAQ--
D7BCL0_MEISD      EGTTHLGTHLDAPYHYDPAGERLEAISLSVLVGPCRVVDARGQAALDEPFL--RTLDD--
D3PQL7_MEIRD      TTTTHLGTHLDAPWHYVDDGGKLESVPLEVLIGPCRVVDARGQEALTADFL--KTIQ---
F2NPG7_MARHT      SSTTHLGTHLDAPFHYDPAGIRLGEVPLEVLMGPALVIHAPGRERLGPEVL--EGLEA--
D7CT12_TRURR      STSTHVGTHLDAPYHYDEDGVRLGEVALERLSGPAQVIYALAG--LEAGLL--EPFPR--
KYNB_BACAN        TMSIHTGTHIDAPFHFDNDGKKVLDLDIQVYVGPTRIIDVSNLESIGKKE-----LEKFH
KYNB_BACCR        TMSIHTGTHIDAPFHFDNDGKKVLDLDVQVYVGPARIIDVSNLESIGKKE-----LESFH
KYNB_BACCN        TMSIHTGTHIDAPFHFDNDGKKVIDLDIHVYVGPARIIDVSSMDSIGVKE-----LQQFN
C0ZG29_BREBN      TMSIHTGTHVDAPFHFDDDGRKIAELPLDLYIGEARVVELTGHSSIGPED-----FAQID
KYNB_GEOTN        TMSTHTGTHIDAPFHFDNEGKRVIDLDLNIYIGPARVIHLSNPKKIGIDE-----LQTID
D5DK14_BACMD      TMSIHTGTHIDAPFHFDSDGKKVIDLDLDLYIGRTKVVHIPANKSIGINE-----LSDVN
C4KZB8_EXISA      TLSLHLGTHIDAPFHFDDHGKRVIDLDPSVYIGPARVIHLPHKAKIEASD-----LDGHD
B1YHD3_EXIS2      TMSLHTGTHIDAPFHFDDVGQKVIDLDPDLYIGHVRVIYLPGRTELVASD-----LDAFD
Q5WKB4_BACSK      AMSVHSGTHVDAPFHFKNDGAKITDLDIHVFIGKARVVDLSKYEKIDKAA-----LRSLH
D3FTN3_ALKPO      TMSLHSGTHIDAPFHFDNDGARVLDLDINRYTGTARVINASAFEKLDEHA-----FSQFD
Q8ES87_OCEIH      TTSTHVGTHADAPYHFMEDGKRILDLEIDRYIGPCKVIDLSAFDEIDETA-----LKSKV
I0JSI0_HALH3      KASNHTGTHVDAPFHYDEDGLKIADLPPERFIGDALVVNMEGKTIIQADD-----LRAFE
F2F7Z2_SOLSS      TTSLHTGTHADAPFHFNSEAETIEQLDVNVYIGDCVIVDCIGQERVTAQS-----LEPFD
C1A7G6_GEMAT      TTSFHVGTHADAPVHVHSEWPASDGLELGAFVGEALVVALPASHGVAQDIDLPLLQRLIG
                    . * *:* *.* *                 *   ::                      

KYNB_PSEF5        --LPARVLLRTYPQAPLSA-WDPDFTAVAPATVELLASLGVRLIGIDTPSLDPQQSKTMD
C3K207_PSEFS      --VPERVLLRTYPQAPLTE-WDADFTAIAPQTIELLASLGVRLIGIDTPSLDPQQSKTMD
KYNB_PARXL        --LPPRVLLRTYRNAPTNV-WDSAFCAVAPDTIDLLASRGVKLIGIDTPSLDPQESKTMD
D5WCD2_PARAM      --LPPRVLLRTYRNAPTRE-WDSAFCAVAPETVDLLAARGVKLIGIDTPSLDPQESKTMD
E1T849_BURSG      --LPPRVLLRTYRNAPSTV-WDSGFCAVAAETIDLLAANGVKLVGIDTPSLDPQESKTMD
KYNB_PARP8        --VPPRVLLRTYREAPTTF-WDSGFCAVAPETIDLLAARGVKLIGIDTPSLDPQESKTMD
KYNB_BURPS        --APPRVLLRTYGQAPQHA-WDSAFCAVAPETIDLLAAHGVRLVGIDTPSLDPQESKTMD
C5ACA9_BURGB      --APPRVLLRTYARAPRET-WDSAFCAVAPETIDLLAAHGVRLVGIDTPSLDPQESKTMD
F2L8W0_BURGS      --CPPRVLLRTYANAPQQA-WDSAFCAVEAATIDLLAAHGVRLIGIDTPSLDPQESKTMD
KYNB_BURVG        --VPPRVLLRTCAHASVER-WDSDFCAVAPETIDLLAARGVKLIGIDTPSLDPQESKTMD
KYNB_CUPPJ        --LPTRVLLRTYKRAPLDQ-WDTGFCAVAPETIALLAAHGVQLIGIDTPSLDPQESKTMD
KYNB_CUPTR        --LPPRVLLRTYRQAPLAQ-WDPDFCAVSPDTIALLAAHGVQLVGIDTPSLDPQDSKTMD
KYNB_CUPMC        --TPPRVLLRTYAQAPQGK-WDSAFCAVAPETISLLARHGVRLIGIDTPSLDPETSKTMD
KYNB_RALSO        --APPRVLLRTYARMPQNA-WDDHFAAVAPETIGLLAAHGVRLIGTDTASLDPQTSKTMD
KYNB_PSEAE        --LPSRVLLRTFERVPAN--WPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLD
KYNB_PSEFL        --APERILLRTYRHSDPCI-WDQHSTAIAVAAIELLARHGVKLVGIDTPSVDPQHSKTLD
G2IUB7_PSEUL      GPLPPRVLIRSYRQFPRGQ-WDGHFAAIDPVAIDGLAEAGVCLIGVDTASLDPAHSKTLD
KYNB_BORPD        --LPPRVLVRTAEHAALDW-WTDDFSAYAPHTIEWLAERGVVLIGLDTPSIDPASSKTLD
E3HWS1_ACHXA      --LPPRVLVRTAKHAAQDW-WTDDFSAYAPQTIEWLAERGVMLIGLDTASIDPASSKTLD
KYNB_BORPE        --LPPRVLVRTARHAALQW-WVDDFSAYAPQTIEWLAGRGVTLIGIDTPSIDPASSKTLD
KYNB_BORA1        --MPERVLVRTAQHAAVHW-WTDDFSAYAPQTIEWLASLGVRLIGIDTPSIDPATSKTLD
D6CPM0_THIA3      --LPPRVLVRT-RHRALTV-WTEDFAAFAPTTVSWLAVQGVTLIGLDTPSIDPASSKTLD
KYNB_POLNA        --LPPRVLLRTSRTASQSW---ASFTAIAPATLALLATKNIVLIGIDTPSVDPAASQNLP
KYNB_POLSJ        -DLPPRVLVRTYARMPVER-WDPTLAAYAPETVERLAALGVKLIGIDTASIDPAGSKTLD
E6V3N4_VARPE      -DLPPRVLVRTYATMPVGH-WDPQLAAYAPATVERLAAMGVKLIGIDTASIDPADSKTLE
KYNB_DELAS        --LPARVLVRTYGRAPTT--WDQELAAYAPATVERLADLGVKLIGIDTASIDPASSKSLD
D0J4I3_COMT2      --LPARVLVRTYEKAPTG--WDADLAAYAPDTVRKLADLGVKLIGIDTASIDPASSKSLD
B9MCU2_ACIET      --LPPRVLVRTYARMPVDR-WDAGLTAYAPDTIERLADAGVVLVGIDTASIDPADSKPLP
F4GCE3_ALIDK      --LPPRVLLRTYARMPVDR-WDASLTACAPETLERLADAGVVLVGIDTASVDPADSRRLP
KYNB_ACIAC        PALPQRVLVRTYERMPLDR-WDAALAAYAPDTIERLADLGVVLVGIDTASIDPADSKSLD
I0HNS7_RUBGI      --LPPRVLLRTYARAPEA--WDPALAGIEPQALERLAELGVRLVGIDSASVDPADSKTLD
C0ZSI1_RHOE4      GHLPQRLILRTYPKYPRE--WDNDFAGVSPELTHWFADRGGVLIGIDGASFDPMDSKTMD
KYNB_ERYLH        ---ADRVLFRQWDSFPHDE-WRSDWLPIAAETVEWLALQGVKLIGTDAPSVDPQESKTMS
KYNB_SPHAL        ---AERVLLRTYEQFPHEK-WDSDFTAVAADVIERFGAMGVRLIGTDAASLDPEQSKTLD
KYNB_MARMM        ---ATRVLVRTYAKFPADD-WDPDFRALHADTIERLAATGCRLIGVDAASLDPQTSKTMD
B6IV25_RHOCS      ---TRRLLLRTMGSFPHAA-WDSRFTALAAETVDLLAGLGVRLIGVDSPSLDPEDSKTLD
F2J1U2_POLGS      --VPARVLLRLAERLDPLA-WPAGFRALAPETMDLLAARGVRLVGVDVPSVDPDTSKDLP
KYNB_SALRD        --SAERVLFKTSSGVSPDDEWPDAVVPIQPDTIHALADAGVSLVGTDAPSVDPLDSTDLP
KYNB_DEIGD        --LPPRLLLHTGQPAHWTE-FPEDFAALDPALIREAARRGVRLIGTDSPSVDPLTSKTLD
C1CWE9_DEIDV      --LPPRLLLNTGQPEHWAD-FPEDFRALSPAFIREAARRGVQLIGTDAPSVDPLTSKTLD
E8U822_DEIML      --LPERLLVYTGQPAHWAD-FPQDFTALSPEFVRAAHARGVRLVGTDSPSVDPLDSKTLD
F0RPQ2_DEIPM      --LPPRLLLCTGQPAHWDE-FPRTFMFPAPEFVRAAGERGVRLLGLDVPSMDPLDSKTLD
D7BCL0_MEISD      --LPERVLFYTGQPGRWKT-FPETFTHVTPAAAAYLASRGVKLFGTDCPSVDPLDSKTLE
D3PQL7_MEIRD      --LAERTLFYTGQPSIWPS-FPHTFMHVLPEAAGYMAAQGVRLYGTDAPSVDPLTSKDLP
F2NPG7_MARHT      --LPERVLFFTGQPNRWMR-FPTAFTGLSPALVHALARRGVRLVGTDAPSVDRFEDAALP
D7CT12_TRURR      --LPERVLFFTGQPEVWEA-FPERFHTFSPEVIHLLADRGVRLIGTDAPSVDALNSKDLP
KYNB_BACAN        LEGVERLLLRTSSHGKANE-FPDIIPHLRADIAPFLSEKGIRLIGVDVPSVDPLDDKELA
KYNB_BACCR        LEGVERLLLRTSSHGKAEE-FPEVIPHLRADIASFLSEKGIRLIGVDVPSVDPLDDKELA
KYNB_BACCN        LEGVERLLLRTSSHGNAQK-FPDIIPFLCAEIAPFLSKKGVRLIGVDVPSVDPLDDKELA
C0ZG29_BREBN      LEGVERLLLKTLSWSDPNQ-FPSTICHLRADLPAFFAKKGIRLIGVDVPSVDPLDSKELA
KYNB_GEOTN        LHGVTRLLIYTGAWTNRTT-FPETIPYIDPPLAPYLKKYGVRLIGIDLPSVDPLTSKQLP
D5DK14_BACMD      LKGVTRLLIRTDAWQDRSV-FPETIPYIEPSLASYLAKLGIRLLGIDLPSVDPLDSKELA
C4KZB8_EXISA      LTGVERLILKTDGWPDKRV-FPETIPELKPSLADRLGELGIFLIGLDLPSVDAIDSKEMD
B1YHD3_EXIS2      LTDVRRLIIKTDGWVDKSV-FPETIPVLTPSLAERLGELGIELIGLDLPSVDAIDSKEMA
Q5WKB4_BACSK      LEGVKRLLIKTAVPNQATA-FPENIPYVTPDGAAYMKEKGIILIGVDVPSVDPLDSKELE
D3FTN3_ALKPO      LSGVTRVLVKTSVPNNPAH-FPEDFPYVTPCGADHLKQCGIQLIGVDVPSVDHPVSKELE
Q8ES87_OCEIH      KEDTERLLIRTSLPNNPEQ-FPTDVTPITSDGAAYMHFLGVKLVGVDTPSVDPLSSKELV
I0JSI0_HALH3      YTGVTKLLFRTTSWNDRNE-FPDHYTVISSDAAEFLHSQGIDLIGIDTPSVDPVESKDLA
F2F7Z2_SOLSS      FRSAKRVLLKTIE-QPSAA-FPQTIPVIHPNVAPFLKERGVILLGIDNPSVDPLDSKEVL
C1A7G6_GEMAT      EHAVSRVLLRTGHTSAAGI-FPDDWPALTAEAATWLVDRGVKLWGVDAPSVDRRQSKSLD
                       : :.                              .  * * * .*.*   .  : 

KYNB_PSEF5        AHNTVARHGMAILEGVVLDEVAEGDYELIALPLRFAHLDASPVRAILRPLADSFLQ----
C3K207_PSEFS      SHNAVARHGMAILEGIVLDDVPEGDYELIALPLRFAHLDASPVRAILRPLKEPTR-----
KYNB_PARXL        AHHRIRAHRMAILEGIVLDEVAAGDYELIALPLKLTTLDASPVRAILRALPESH------
D5WCD2_PARAM      AHHRIRAHGMAILEGIVLDAVEAGDYELIALPLKLTTLDASPVRAVLRALPGSRQATPAA
E1T849_BURSG      AHHRIRAHGMAILEGIVLDEVAPGDYELIALPLKLTTLDASPVRAVLRALPAAR------
KYNB_PARP8        AHHRIRAHRMAILEGIVLDAVAPGDYELIALPLKLSTLDASPVRAVLRSLT---------
KYNB_BURPS        AHRRIRAHRMAILEGLVLDEIAAGDYELIALPLKFTTLDASPVRAVLRALPAAPR-----
C5ACA9_BURGB      AHRRVGAHAMAILEGLVLDEVAAGDYELIALPLKFTTLDASPVRAVLRALPAPAAP----
F2L8W0_BURGS      AHRRVRAHGMAILEGLVLDAVPAGDYELIALPLKFATLDASPVRAVLRALPVDRAMP---
KYNB_BURVG        AHHRVRAHRMAILEGIVLDDVPAGDYELIALPLKFTTLDASPVRAVLRALPGHSS-----
KYNB_CUPPJ        AHKAVRRHGLAILEGLVLDAVAEGDYELIALPLRFTGLDASPVRAVLRSLD---------
KYNB_CUPTR        AHNAVRRHGLAILEGIVLDQVDAGDYELIALPLRFAALDASPVRAVLRSLD---------
KYNB_CUPMC        AHHAVRDHQLAILEGIVLDEVPAGDYELIALPLRLATLDASPVRAVLRELP---------
KYNB_RALSO        AHHAVGRHGLAILEGLVLDDVPAGDYELIALPLKFATLDASPVRAVLRRLP---------
KYNB_PSEAE        AHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALPTAE------
KYNB_PSEFL        AHHAIQRHGMAILEGLVLDEVPAGDYELIALPLKFMALDASPVRAVLRSLPTQVPRSG--
G2IUB7_PSEUL      AHHAVARHGMAILENLQLDDMPEGDYELIALPLKLVQLDASPVRAVLRTLA---------
KYNB_BORPD        SHHVILRRDMRVLENLLLDDVAEGDYELIALPLALAQADASPVRAILRELG---------
E3HWS1_ACHXA      SHHTILRHDMRVLENLVLDDVPEGDYELIALPLALVQADASPVRAVLREL----------
KYNB_BORPE        SHHAIRRHDMRVLENLRLDDVDEGDYELIALPLALVQADASPVRAVLRELA---------
KYNB_BORA1        SHHVILRRDIRVLENLVLDTVEPGDYELIALPLALVQADASPVRAVLRELG---------
D6CPM0_THIA3      SHAQLLQHELRVLENLVLDDVPEGDYELIALPLKLQGACASPVRAVLREL----------
KYNB_POLNA        SHQQLLRHGLRVLENLVLDDVPEGDYELIALPLKLMRADASPVRAILRELS---------
KYNB_POLSJ        SHQVIRQRGLRVLENLVLDEVPEGDYELIALPLKLMTADASPVRAVLRELP---------
E6V3N4_VARPE      SHQRIRRLDLRVLENLVLDAVPEGDYELIALPLKLVSADASPVRAVLRDLPR--------
KYNB_DELAS        SHQVIRRRGLRVLENLVLDEVAEGDYELIALPLKLVEADASPVRAVLRALA---------
D0J4I3_COMT2      SHMVIRQRGLRVLENLVLDAVSEGDYELIALPLKLTEADASPVRAVLRSLL---------
B9MCU2_ACIET      SHQVIRRRGLRVLENLVLDDVPEGDYELIALPLKLTTADASPVRAVLRALPPRA------
F4GCE3_ALIDK      SHQVLRRRGLRVLENLVLDAVPEGDYELIALPLRLVTADASPVRAVLRALA---------
KYNB_ACIAC        SHQVIRRRGLRVLENLVLDEVPEGDYELIALPLKLTTADASPVRAVLRTPA---------
I0HNS7_RUBGI      AHQVLRRRGLRVLENLVLDAVPEGDYELIALPLKWVAADASPVRAILRELP---------
C0ZSI1_RHOE4      GHHAASDRGVAILEGLCLDEVDEGYYELIALPLKFLDLDASPVRAVLRTLPSSLSTPTHA
KYNB_ERYLH        AHKAVLKHDMRILEGLVLDDVPEGRYELLALPLKIVDGDAGLCRAILRELPDAG------
KYNB_SPHAL        AHQAVKAADMRILEGLVLDDVPPGRYELIALPLRIVGADASPVRAILREIA---------
KYNB_MARMM        AHHAVQRHDMRILEGLVFDGVPDGHYELIALPLKIAGADAAPLRAVLRELP---------
B6IV25_RHOCS      AHHAVHRHGLSILEGLVLDGVPEGAYELIALPLKLATADAAPVRAILRDLPRQG------
F2J1U2_POLGS      AHGAARRHDLRILENLALQDVEFGDYELIALPIKLEGLDAAPVRAVLRPLRAD-------
KYNB_SALRD        AHHALLDTGIVNLEGLVLTNVPPGRYELIALPLKIVGGDAAPVRAVLRDAPDP-------
KYNB_DEIGD        AHHACLETDTLILEGLNLAEVPDGEYDLVCLPLPLAEVDGAPARAILLPAGTLPEGEG--
C1CWE9_DEIDV      AHHACQDTGIYILEGLNLSAVTDGEYELLCLPLPLVGVDGAPARAVLRLV----------
E8U822_DEIML      AHHTFAETGLFIVEGLNLAGVPEGEYDLVCLALPLHGVDGSPARAILLERDA--------
F0RPQ2_DEIPM      SHHAAYGAGIHILESLSLSHVAPGEYTLVCLPLPLHGADGAPARAVLLP-----------
D7BCL0_MEISD      AHHAFRRGQIYILEGLALEGVQPGTYELICLPLALEGADASPVRAILR------------
D3PQL7_MEIRD      AHKAFAQAGVYIVEGLALEGVAPGDYELVCLPLKLEGADAAPVRAILR------------
F2NPG7_MARHT      VHRACAEAGVFILEGLVLKGVPAGRYELVCLPLPLPTADAAPVRAILR------------
D7CT12_TRURR      AHRACAERDVLILEGLNLQGVNEGRYELLCLPLNLPEADASPVRAVLRKP----------
KYNB_BACAN        AHHQLFKHSIHILENVVLDHVADGDYELIALPLALSDADGSPVRAVIRPI----------
KYNB_BACCR        AHHQLFKHGIHILENVVLDHVADGDYELIALPLALTDADGSPVRAVIRPI----------
KYNB_BACCN        AHHQLFQHGIHILENVVLDHVQDGDYELIALPLALTEADGSPVRAIIRPL----------
C0ZG29_BREBN      AHHGLHQHDIHILEGLLLDHVEPGDYELIALPLPLVEADGSPVRAILRRS----------
KYNB_GEOTN        AHHELHRCGIHILEGLVLDHVSPGDYELAALPLPLVNADGSPVRAALRKMG---------
D5DK14_BACMD      AHHGLAYHKIHILEGVLLDKIPPGDYELIAAPLPLVEADGSPVRALLKKSDY--------
C4KZB8_EXISA      AHHALARNGVHILEGLVLDNILPGDYDLNAVPLPIVEGDGSPVRALLRPIL---------
B1YHD3_EXIS2      AHHALAAHGVHILEGLVLDTITPGDYHLNAVPLPLVDGDGSPVRALMRPY----------
Q5WKB4_BACSK      GHHALADNGISILENLMLDKVKEGDYELIALPLPMEEADGSPVRAVIRAI----------
D3FTN3_ALKPO      GHHALLKNDIAILENIMLDHVEDGDYELIALPLPIREGDGSPVRAVIRKQS---------
Q8ES87_OCEIH      GHHALFKHDINILENVMLDQVVEGDYEMIALPLPLQDADGSLVRAVIKPINGGNHDAK--
I0JSI0_HALH3      AHHSLYKHDILILEGLELDHAAPGVYELMAFPLKMEVADGSPVRAILRQK----------
F2F7Z2_SOLSS      AHHKLYEHGIHILEGLDLGHVQQGLYELIALPLKIAGADGAPVRAVVRKKLIE-------
C1A7G6_GEMAT      VHHALLGRGTFVLENLDLRHIETGVYELIAPPLAVIGADAAPVRALLRRRVG--------
                   *          :*.: :     * * : . .:      ..  ** :             

KYNB_PSEF5        -----
C3K207_PSEFS      -----
KYNB_PARXL        -----
D5WCD2_PARAM      SY---
E1T849_BURSG      -----
KYNB_PARP8        -----
KYNB_BURPS        -----
C5ACA9_BURGB      -----
F2L8W0_BURGS      -----
KYNB_BURVG        -----
KYNB_CUPPJ        -----
KYNB_CUPTR        -----
KYNB_CUPMC        -----
KYNB_RALSO        -----
KYNB_PSEAE        -----
KYNB_PSEFL        -----
G2IUB7_PSEUL      -----
KYNB_BORPD        -----
E3HWS1_ACHXA      -----
KYNB_BORPE        -----
KYNB_BORA1        -----
D6CPM0_THIA3      -----
KYNB_POLNA        -----
KYNB_POLSJ        -----
E6V3N4_VARPE      -----
KYNB_DELAS        -----
D0J4I3_COMT2      -----
B9MCU2_ACIET      -----
F4GCE3_ALIDK      -----
KYNB_ACIAC        -----
I0HNS7_RUBGI      -----
C0ZSI1_RHOE4      GEESS
KYNB_ERYLH        -----
KYNB_SPHAL        -----
KYNB_MARMM        -----
B6IV25_RHOCS      -----
F2J1U2_POLGS      -----
KYNB_SALRD        -----
KYNB_DEIGD        -----
C1CWE9_DEIDV      -----
E8U822_DEIML      -----
F0RPQ2_DEIPM      -----
D7BCL0_MEISD      -----
D3PQL7_MEIRD      -----
F2NPG7_MARHT      -----
D7CT12_TRURR      -----
KYNB_BACAN        -----
KYNB_BACCR        -----
KYNB_BACCN        -----
C0ZG29_BREBN      -----
KYNB_GEOTN        -----
D5DK14_BACMD      -----
C4KZB8_EXISA      -----
B1YHD3_EXIS2      -----
Q5WKB4_BACSK      -----
D3FTN3_ALKPO      -----
Q8ES87_OCEIH      -----
I0JSI0_HALH3      -----
F2F7Z2_SOLSS      -----
C1A7G6_GEMAT      -----