CLUSTAL format seed alignment for MF_01971

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KMO_FLAPJ             --------------------------MQKSQKIAIVGSGLVGSLLAIYLKKEGHT-VHVY
KMO_GRAFK             --------------------------MQKEKDVAIVGSGLVGSLLAIFLRKQGHK-VTVF
KMO_XANAC             ------------------------MSPVSQRSLTLIGAGLAGCLLAILLSRRGWQ-VTVY
KMO_XANOM             ------------------------MSPVSPRSLTLIGAGLAGCLLAILLSRRGWQ-ITVY
KMO_XANCP             -----------------------MSAAASPRSLTLIGAGLAGCLLAILLSRRGWQ-ITLY
KMO_STRMK             ------------------------MIAHASRSLSIIGAGLAGSLLAILLSRQGWR-ITLY
KMO_PSEFL             -----------------------MTATDNARQVTIIGAGLAGTLVARLLARNGWQ-VNLF
KMO_SALAI             -------------------------MNRRRERVVVVGAGLAGSLAALYLARQGHE-VDIF
KMO_SALTO             -------------------------MNRRRERVVVVGAGLAGSLVALYLARQGHE-VDVF
KMO_LEGPC             -----------------------------MKHITIIGAGLAGTLCGLYLARRGYE-VELF
KMO_MYXXD             ------------------------MSEARKDTVTVVGAGLVGSLLSIYLARRGHT-VELL
Q1ITW4_KORVE          --------------------------MASKEKITIVGSGLAGPLLAISLKKRGLD-VELY
KMO_DICDI             ------------------------MDILLNKPITIVGGGLAGSALALLLGQKGFP-IQVI
D3B5G1_POLPP          ----------------------MISTVAMNESISIIGAGLAGSALSVLLSNHGFSNINVY
KMO_CYTH3             ----------------------------MKEQITICGAGLVGSLLAVYLIERGFS-VRVF
KMO_HUMAN             --------------MDSS--------VIQRKKVAVIGGGLVGSLQACFLAKRNFQ-IDVY
A0A2I3FZG4_NOMLE      --------------MDSS--------VIQRKKVAVIGGGLVGSLQACFLAKRNFQ-IDVY
G1M5X6_AILME          --------------MDVP--------DVQRKRIAVIGGGLVGSLNACFLAKRNFR-VDVY
G1NTW3_MYOLU          --------------MDSS--------DSQRKKVAVIGGGLVGSLNACFLAKRNFQ-VDVY
KMO_PIG               --------------MDSS--------DIQRTSIAVIGGGLVGSLNACFLAKRNFQ-VDVY
KMO_MOUSE             --------------MASS--------DTQGKRVAVIGGGLVGALNACFLAKRNFQ-VDVY
KMO_RAT               --------------MASS--------DTEGKRVVVIGGGLVGALNACFLAKRNFQ-VDVY
KMO_XENTR             --------------MEIQ--------GNRKKTVSVVGGGLVGSLNACFFAKKGFQ-VELY
F6UL58_XENTR          --------------MEIQ--------GNRKKTVSVVGGGLVGSLNACFFAKKGFQ-VELY
KMO_DANRE             --------------METAFSHPPQSSSSKRKVIAVVGGGLVGSLNACFLAKRGFD-VEVY
A9V478_MONBE          ------------------------------MKVIVVGGGLVGALEAVYMARRGHE-VHVY
KMO_CAEBR             -----------------------------MPSVAIAGAGLVGALNACFFAQKGWD-VSVY
KMO_CAEEL             -----------------------------MPSVAIAGAGLVGALNACFFAQKGWD-VSVY
KMO_ANOGA             MATASDSKYKRTNTNG---------MQHQPLDVAIVGGGLVGSLLALHLGKKGHE-VNLY
W5JA14_ANODA          MATDSGYKYKRTNTNG---------SAQRPLDVAIVGGGLVGSLLALHLGKKGHE-VNLY
KMO_AEDAE             ----MTAQYKQTNTNG---------LTARNLNVAVVGGGLVGSLFALHLGKKGHT-VDLY
KMO_DROME             --MSPGIVSQEVNGRQEPTEAARDERHGRRRRVAVIGAGLVGSLAALNFARMGNH-VDLY
E9H0N5_DAPPU          ---------------------MTSQDPQKKLKIAVVGGGLVGSLQACYMAKRGHQ-VELY
E0VU04_PEDHC          MNFENRNNNNNSRNDYDDDDDDDTTKSGKSLNIAVIGGGPVGSLCACYLANHGHK-VFLY
F4P9F4_BATDJ          ---------------------------MTEFSVAIIGGGLVGSLSAVYFAKRGYT-VTVY
KMO_CANAL             -----------------------MSEEESQKTIGIVGAGLVGCLAALAFAKKGYD-VTLF
KMO_YEAST             -----------------------MSE-----SVAIIGAGLVGCLAALAFSKEGYN-VTLY
KMO_YARLI             -----------------------MHE------VTVVGAGLVGCLAALAFADRGHK-VALY
E3KV40_PUCGT          -------------------------MSEKPK-VVVVGAGPVGCLAACMMENHGWS-VDLF
A8NFR7_COPC7          ------------MDSTHSSTSTLASLSHGPRRAVVVGAGPVGCLTALALAKRGWH-VDLL
KMO_CRYNJ             ------------------------MSQSRARKVLIVGAGPVGALTALSLHRRGWE-VEVW
KMO_ASPFU             ----------------------MADTVRKKQKLVVVGAGPVGSLAALYAAARGDE-VEIY
KMO3_ASPNC            ----------------------MAEPSAGRQKVVIVGAGPVGSLAALYAAARGDD-VEMY
KMO_EMENI             ----------------------MASPA--KQKVVIVGAGPVGCLAALYAAARGDD-VELY
C0NXN8_AJECG          -------------------------MAATKEKIVIVGAGPVGSLAALYAASRGDD-VEVY
KMO_NEUCR             -------------------------MEERKQKVVVVGAGPVGSLAALYAANRGHD-VEIY
A7F691_SCLS1          -----------------------MSRQSSRQKTVIIGAGPVGALAALYAAQRGDD-VEIY
C7YWN5_NECH7          --------------------------MGKPQKFVVVGAGPVGSLAALYAAQRGHE-VEVY
KMO2_ASPNC            --------------------------MTADGKIVIVGGGPVGSLAALYASHYHDN-VEVY
KMO1_ASPNC            ---------------------------MSSYKVVIVGGGPVGALAGLYAAQRGFQ-VEIY
KMO_PHANO             ----------------------------MPQKIVVVGAGPVGSLAALYAAVRGHD-VEIY
D5GNF0_TUBMM          -------------------------MDSLARKVIVVGAGPVGALAALYFSHAGWE-VEVY
KMO_USTMA             --------MSETRKDTDRASAQLPTKCQLPERVAVIGAGPVGCLAALAFAQRGCK-VDIF
                                                        : *.* .*   .          : : 

KMO_FLAPJ             DRSP-DIR----TIQFSGRSINLAMSNRGWNALD--GAGV-------------GDKVRHI
KMO_GRAFK             DRRP-DVR----NVQFSGRSINLAMSNRGWKALR--EAGI-------------EDEIREL
KMO_XANAC             ERRG-DPR---IKGYESGRSINLALAERGRHALR--QAGA-------------EDAVMAK
KMO_XANOM             ERRG-DPR---IKGYECGRSINLALAERGRHALR--QAGA-------------EELVMAK
KMO_XANCP             ERRG-DPR---IKGYESGRSINLALAERGRHALR--QAGA-------------EDAVMAK
KMO_STRMK             ERRG-DPR---VADYESGRSINLALAERGRNALR--QAGV-------------EDEVMAR
KMO_PSEFL             ERRP-DPR---IETGARGRSINLALAERGAHALR--LAGL-------------EREVLAE
KMO_SALAI             ERRP-DPRS--ALAGPEGRSINLGLSARGMRALD--GVGL-------------LADVLKH
KMO_SALTO             ERRP-DPRS--ALGRPEGRSINLGLSARGMRALD--GVGL-------------LADVLKH
KMO_LEGPC             ESRP-DIR---NSPTDYGRSINLALSCRGITALK--AMNL-------------LSEVNKI
KMO_MYXXD             ERRP-DMR---RETVDGGRSINLAISTRGLHALR--QVGL-------------ENEALKH
Q1ITW4_KORVE          ERRP-DMR---KVHISAGRSINLALSTRGIYALR--EIGV-------------WPQIEKI
KMO_DICDI             EKRPKQSEN------IRARSINLALSDRGVKTLT--KTGY-------------VDDILKI
D3B5G1_POLPP          EKRPRETDQ--TLPQNRARSINLALSDRGIKTLK--AAGV-------------IDEIEKI
KMO_CYTH3             EKRK-DPR---KNEADAGRSINLAISHRGIHALKDAQTGL-------------EKEALKL
KMO_HUMAN             EARE-DTR---VATFTRGRSINLALSHRGRQALKA-VGL--------------EDQIVSQ
A0A2I3FZG4_NOMLE      EARE-DTR---VANFTRGRSINLALSHRGRQALKA-VDL--------------EDQIVSQ
G1M5X6_AILME          EARE-DIR---AAQLSRGRSINLALSYRGRQALKA-IGL--------------EEQIVSQ
G1NTW3_MYOLU          EARE-DIR---VAQLARGRSINLALSHRGRQALKA-IGL--------------EDQIVSQ
KMO_PIG               ESRE-DIR---MAEFARGRSINLALSYRGRQALKA-IGL--------------EDQIVSQ
KMO_MOUSE             EARE-DIR---VAKSARGRSINLALSYRGRQALKA-IGL--------------EDQIVSK
KMO_RAT               EARE-DIR---VANFMRGRSINLALSYRGRQALKA-VGL--------------EDQIVSK
KMO_XENTR             EARE-DIR---YARMVSGRSINLALSHRGLQALKA-VGL--------------DEKIAAM
F6UL58_XENTR          EARE-DIR---YARMVSGRSINLALSHRGLQALKA-VGL--------------DEK-ATM
KMO_DANRE             ESRE-DIR---QAKVVKGRSINLALSHRGRQALKH-VGM--------------EDKIISK
A9V478_MONBE          EGRT-DIR---KEPRYSGLSINLALSVRGIAALRE-VGV--------------EAEIVNA
KMO_CAEBR             EFRK-DIR---TMKHVQGRSINLALSQRGKSALEA-VGL--------------KEYIVNQ
KMO_CAEEL             EFRK-DIR---TMKHVQGRSINLALSQRGKSALEA-VGL--------------KEYIVNQ
KMO_ANOGA             EYRE-DIR---TAELVIGRSINLALSARGRRALAE-VGLE-------------DALL-NH
W5JA14_ANODA          EYRE-DIR---TAELVIGRSINLALSARGRRALAE-VGLE-------------EALL-GH
KMO_AEDAE             EYRE-DIR---TAELVIGRSINLALSARGRKALAE-VGLE-------------DALL-QH
KMO_DROME             EYRE-DIR---QALVVQGRSINLALSQRGRKALAA-VGLE-------------QEVL-AT
E9H0N5_DAPPU          ELRD-DIR---TMEHVPGKSINLAMSIRGRSALRE-VGLE-------------DEIIKNH
E0VU04_PEDHC          EGRE-DIR---TTELSKGRSVNLAISARGRAALKK-IGLE-------------REIIYEH
F4P9F4_BATDJ          EKQS-DIR---QSQKVSGRSINLALSARGIAALQS-AGV--------------YKSIAET
KMO_CANAL             EYRP-DPRTVDS-SKRNLRSINLAVSSRGIRALQYVDPAM-------------ADRILEH
KMO_YEAST             DFRQ-DPRLDTT-KNKNLKSINLAISARGIDALKSIDPDA-------------CEHILQD
KMO_YARLI             DARP-DLRSEAELKNASLRSINLAVSARGIEALRSVDTKM-------------AERVLAD
E3KV40_PUCGT          EARS-DFRKPQ-KTVNRPRSINLAFSKRGIEAIRAVDSEM-------------VERLLKQ
A8NFR7_COPC7          EGRP-DLRLPSSKAASQQRSINLAISHRGLAALEAIDPTA-------------ADKFLHT
KMO_CRYNJ             ETRD-DPRGQD-AAPSNLRSINLAISSRGLEALRSVDPSI-------------AENFLEE
KMO_ASPFU             ELRG-DLRDPSTVPLNFTKSINLALSERGITAMKHSNRED------------LVNNVLRD
KMO3_ASPNC            ELRG-DLRDPNTIPLNFTKSINLALSERGITAMRQANREE------------LIDRVLAD
KMO_EMENI             ELRG-DLRVPGTIPLNFTKSINLSLSHRGITALRHSGREH------------VINEILQE
C0NXN8_AJECG          ELRA-DLRNASTTPLNFTKSINLAISERGINSMKQTNRPG------------FISAVMDE
KMO_NEUCR             ELRG-DLRDPSTTPLNFTRSINLALSERGLNAMRHANQPR------------LIDYVKGV
A7F691_SCLS1          ELRS-DLRDPSTTPLNFTKSINLALSERGINAIRQSGRTE------------LLDSIMKE
C7YWN5_NECH7          ELRP-DLRDPGTIPLNFTRSINLAISERGINAMRHAGQPD------------LLDHVMAT
KMO2_ASPNC            ELRD-ERQNPAGASPLLQKSINFTLSERGIRALEKSGRTD------------LLRAIMRT
KMO1_ASPNC            EMRD-EYSQVQTATAFSAKSISLTLSERGIKALRHSQCRG------------LAERILST
KMO_PHANO             ELRS-DLRN-SEHSSNISQSINLALSERGINSLRKTGLPD------------LADAVLAE
D5GNF0_TUBMM          ELRG-DLRLPENLSLNFSKSINLALSERGINGLRNLGDGGK-----------LLDEVLSM
KMO_USTMA             ESRP-DPRTHEAITRASQRSINLALSTRGITGLRSVSLAGLGVGTNAPNGMDLADLVLQN
                      :    :             *:.: .: **   :                           

KMO_FLAPJ             AIAMEKRAIHI-GNQLNF----------QHYGL-QGECIYSISRGVLNRKMIDLAEE---
KMO_GRAFK             ALPLDKRAMHVEGQSVYF----------QKYGE-EGEAIYSISRGILNRKMIDLAES---
KMO_XANAC             AVMMRGRMVHPLVGQPQL----------QRYGRDDSEVIWSIHRAALNVALLDLAEQ---
KMO_XANOM             AVMMRGRMVHPLVGEPQL----------QRYGRDDSEVIWSIHRAALNVALLDLAEQ---
KMO_XANCP             AVMMRGRMIHPVSGEPQL----------QRYGRDDSEVIWSIHRAALNVTLLDLAEQ---
KMO_STRMK             AVMMRGRMVHPREGEPQL----------QRYGRDDSEVIWSIHRSDLNTTLLELAEQ---
KMO_PSEFL             AVMMRGRMVHVPGTPPNL----------QPYGRDDSEVIWSINRDRLNRILLDGAEA---
KMO_SALAI             SVPMRDRVVHSPDGGVRA----------QPYGVREHEILHSVLREELISLVVSAAEAE--
KMO_SALTO             SVPMRDRVVHSPDGGIRT----------QPYGVREHEILHSVLREELISLVVTAAEAE--
KMO_LEGPC             MVPMRARAIHEANGEVHY----------QPFGRHIDEYINAISRSDLNALLLNKAELC--
KMO_MYXXD             AIPMRGRMIHPPQGELVY----------QPYGKDDSQHINAMSRGWLNAFLMTAAEAT--
Q1ITW4_KORVE          IIPMRGRMMHALNGALTF----------QPYGKDETEVINSVSRADLNIALMDAAEAQ--
KMO_DICDI             AIPMKGRMIHSLDSVQTF----------QAYSSDSNKHLYSVSRQLLNDRLREHTEKL--
D3B5G1_POLPP          AIPMKGRMIHSIDSKTNF----------QPYSSNSDKHLLSVSRQLLNEKMRDYAERKSG
KMO_CYTH3             AVPMYGRAIHDLHGHVSF----------QAYGE-ASQHINSIGRGALNKLLITTAENL--
KMO_HUMAN             GIPMRARMIHSLSGKKSA----------IPYGTKS-QYILSVSRENLNKDLLTAAEKY--
A0A2I3FZG4_NOMLE      GIPMRARMIHSLSGKKSA----------IPYGTKS-QYILSVSRENLNKDLLTAAEKY--
G1M5X6_AILME          GIPMRARMIHSLSGKKSA----------IPYGTKS-QYILSISRENLNKDLLTAVEKY--
G1NTW3_MYOLU          GIPMRARMIHSFSGKKSA----------IPYGTKS-QYILSISRTNLNKDLLTAVEKY--
KMO_PIG               GIPMRARMIHSLSGKKSA----------IPYGTKS-QYILSISRENLNKDLLTAVEKY--
KMO_MOUSE             GVPMKARMIHSLSGKKSA----------IPYGNKS-QYILSISRENLNKDLLTAVESY--
KMO_RAT               GVPMKARMIHSLSGKKSA----------IPYGNKS-QYILSISREKLNKDLLTAVESY--
KMO_XENTR             GIPMRARMIHSVKGRKSS----------IPYGKQH-QYILSVDRANLNKELLSAAEKY--
F6UL58_XENTR          GIPMRARMIHSVKGRKSS----------IPYGKQH-QYILSVDRANLNKELLSAAEKY--
KMO_DANRE             GIPMHARMIHNVNGKRSP----------IPYGKKG-QYILSVDRANLNKELLTAAEAY--
A9V478_MONBE          GIPMHARMIHSHDGQQSS----------QPYGTQG-QAIRSIDRRNLNEHLLSAAEGL--
KMO_CAEBR             GVPLYARLVHNKDGKTYSR---------QPYGKPG-EHIVSINRRHLNEVMITQAEKS--
KMO_CAEEL             GVPLYARLIHNKDGKTYSR---------QPYGKPG-EHIVSINRRHLNEVMITQAEKS--
KMO_ANOGA             GIPMSGRMLHDVNGKCKI----------VPYDANTNQCIYSVGRKHLNEVLLNAAEKY--
W5JA14_ANODA          GIPMAGRMLHDLNGKRKV----------VPYDANTKQCIYSVGRKHLNEVLLNAAEKY--
KMO_AEDAE             GIPMKGRMLHDLKGNRKI----------VPYDANTNQCIYSVGRKHLNEVLLDAAEKY--
KMO_DROME             AIPMRGRMLHDVRGNSSV----------VLYDPINNQCLYSVGRRQLNEVLLNACDKL--
E9H0N5_DAPPU          GLPMEARMIHRLDGSTYQ----------IPYGKKG-QCIYSVGRRFVNEVLLNAAEKL--
E0VU04_PEDHC          GLPMIGRMIHDKNGTKNI----------IPYDEVGKQCIYSSSRKYVNELLLTAAERE--
F4P9F4_BATDJ          LIPMQGRMLHDSNGTLSS----------QQYGIHG-EFINSVDRRFVNEELLNAAEKY--
KMO_CANAL             VIPMKGRMIHDITGTK---------QESQVYGLNG-ESINSIDRSFLNNCLLDELD-K--
KMO_YEAST             MIPMKGRMIHDLKGR----------QESQLYGLHG-EAINSINRSVLNNSLLDELE-K--
KMO_YARLI             IIPMYGRMIHDLQGG----------QHAQAYGLWG-ECINSIDRAQLNRTMLDVIEDN--
E3KV40_PUCGT          VTPMKGRMIHNIDGG----------LNSQPYGLHE-ECINSIDRNLLNQSILSEAEQR--
A8NFR7_COPC7          AIPMRGRMIHTRTGE----------LDSQSYDRDG-QCIHSIDRALLNEGLLERAAAS--
KMO_CRYNJ             AIPMKGRMIHHTDGK----------QESQLYDPIGGQSINSISRPILNQRLVQSLP----
KMO_ASPFU             TIPMHGRMIHG------RDR-GKLWEAAQAYDVHG-RAINAVDRSTLNNALLDELECT--
KMO3_ASPNC            AIPMHGRMIHG------RSD-GKLWEAAQTYDVHG-RAINAVDRGTLNNALLDELSRT--
KMO_EMENI             VVPIYGRMIHG------RDD-GKLWEAPQAYDVHG-RNNYSADRGMLNNVFLNELERI--
C0NXN8_AJECG          TIPMRGRMVHR------KDKSGKLTEEPQPYDVHG-RHINSIDRGRLNELLLDELEKC--
KMO_NEUCR             TIPMRGRMIHG------KRPDGKLYEEAQDYDIHG-RSILAIDRGDLNKRLLDMLEEM--
A7F691_SCLS1          AIPMGGRMIHG------ETNDKELYEQSQDYDIHG-RSIYAVDRGDLNKRLLDELESL--
C7YWN5_NECH7          TIPMRGRMIHG------RGPTGALFEQSQDYDVKG-RAIHAIDRAGLNKRLLDILESM--
KMO2_ASPNC            AIPMHGRMVHGRMVHG-RSVSGKLQETFHQYDVHG-NSLYSLDRKALNIALRQELDAT--
KMO1_ASPNC            TVPVYGRMVHS-------RSKKRLTSRRIAYDVHG-QALYAISRSEINQSLLEELSAF--
KMO_PHANO             TFPMHGRMIHV-------RKHGQYVRQAQAYDAHG-RNLLAMDRTGLNKTLLDHLNSM--
D5GNF0_TUBMM          TIPMYGRMIHT-------GVPGEKGE-SQKYDVRG-RFIRSADRARLNVQLLDAL-VL--
KMO_USTMA             SVPMRARMIHVVTRQASATQAAEVKEISQLYSTKG-ESINSVDRGRLNNILLEHALMH--
                         :  * :*                    :.    .   :  *  :   .         

KMO_FLAPJ             AGAEFFFEQKIWDVNLTDATLQMGETERG-------------------------------
KMO_GRAFK             AGATFRFEEKIWDVDMKEARLYTGESEKS-------------------------------
KMO_XANAC             AGARVHFYRRLHTVDFDAGYARFIDDRDD-------------------------------
KMO_XANOM             AGARVHFYRRLHTVDFDAGYARFIDDRDD-------------------------------
KMO_XANCP             AGARVHFYRRLHTVDFDAGYARFIDDRDD-------------------------------
KMO_STRMK             AGATVHFHRRLHTVDFDAGYARFIDDRDD-------------------------------
KMO_PSEFL             AGASIHFNLGLDSVDFARQRLTLSNVSGE-------------------------------
KMO_SALAI             PGVRFHFDSLLTSLDRETGTVRVAPTAGG-------------------------------
KMO_SALTO             PGVRFHFDSLLASLDRETGTVDVAPTAGG-------------------------------
KMO_LEGPC             PNIKLHFNMKLHSLDIHNKKIKFEN-KNG-------------------------------
KMO_MYXXD             GKVRIRFKQRVTDVDFGSGALTVHDDATG-------------------------------
Q1ITW4_KORVE          G-ITIHFNQRCTHFDLRERAVYFRDEETD-------------------------------
KMO_DICDI             ENVKFIFSDACKSIDLKQCTIQTQDSNQ--------------------------------
D3B5G1_POLPP          DRIKFHYDVSCRDVNFRDNSFTLVNNETK-------------------------------
KMO_CYTH3             -GVHFLFEHTCTDYHAAGEQWLFSDITGN-------------------------------
KMO_HUMAN             PNVKMHFNHRLLKCNPEEGMITVLGSD---------------------------------
A0A2I3FZG4_NOMLE      PNVKMHFNHRLLKCNPEEGMITVLGSD---------------------------------
G1M5X6_AILME          PNAKVHFGHRLLKCNPEEGVITVLGSD---------------------------------
G1NTW3_MYOLU          PNTKVYFGHRLLTCNLEEGTITVLGSD---------------------------------
KMO_PIG               PNAKVHFGHQLLKCRPETGVITLLGPD---------------------------------
KMO_MOUSE             ANAKVHFGHKLSKCIPEEGVLTVLGPD---------------------------------
KMO_RAT               PNAKVHFGHKLSKCCPEEGILTMLGPN---------------------------------
KMO_XENTR             SNVTMHFEHKLRDCNVDSGTMTFLNNM---------------------------------
F6UL58_XENTR          SNVTMHFEHKLRDCNVDSGTMTFLNNM---------------------------------
KMO_DANRE             PNTRLNFNHKLHDWSPKTGTMTFIGSD---------------------------------
A9V478_MONBE          PNVHLHFEHKLQRADTKSNTLVFKTP----------------------------------
KMO_CAEBR             PNVKFFFEHKVKSVDYDKKQLVVQCTSQPSRIPTFGTKSPPA------------------
KMO_CAEEL             PNVKFFFEHKVKNVDYDKKQLVVQCTSQPSKIPTFGNKSPPQ------------------
KMO_ANOGA             PNIHLHFNHKLVSANLDEGNLSMVDPV---------------------------------
W5JA14_ANODA          PNIHLHFNHKLVSANLDEGQFAMVDPV---------------------------------
KMO_AEDAE             PNIHLYFNKKLQSANLDEGEMSFIDPT---------------------------------
KMO_DROME             PNIRCHFEHKLTSANLREGSMEFRNPA---------------------------------
E9H0N5_DAPPU          PNVSFNFSHKLVNSDLDKGTMTFTNK----------------------------------
E0VU04_PEDHC          FNVMTSFKTKLISLDSKKGIMKFTRTD---------------------------------
F4P9F4_BATDJ          SNVKIYFEHSVVSCDFNNRTMIISDST---------------------------------
KMO_CANAL             SNVKILFKHKLVKLDTSNA------CRMTFIDG---------------------------
KMO_YEAST             STTELKFGHKLVKIEWTDDK---QICHFAIGED---------------------------
KMO_YARLI             ANITFFPEHKLTNISLSRKDKKYQRPTSTFETK---------------------------
E3KV40_PUCGT          PNVTVYFNKKLVKARFDDSTLVFQDTNTHETLE---------------------------
A8NFR7_COPC7          ENIRLFFNHKAVSADFDDRILTARDILSNKEVQ---------------------------
KMO_CRYNJ             EAVKLRFNTKLKHIDFKNRVAYASHKQETSLLPGEESEKDKKQN----------------
KMO_ASPFU             PNVKLFFNHKLTGADFNARKAWFERRVPGEAPLPNSAN----------------------
KMO3_ASPNC            PNVKMFFNHKLTGADFRTNRAWLERRTPGTASTPES------------------------
KMO_EMENI             PNIKLFFNHKLTGADFQANKAWFERRLPGEAPLPGSSG----------------------
C0NXN8_AJECG          PNVKLFFNHKLTGADFKNKKAWFELRKPENAAGPAATSTTQDGKPIAF------------
KMO_NEUCR             PNVTFFFNHKLTGADFKRNKAWFENKDES--TSNPRDR----------------------
A7F691_SCLS1          PNVKFKFNHKLTGADFKNKKAWFEVHGGKSLQWSVEIR----------------------
C7YWN5_NECH7          PNVKLFFNHKLTGADYRACKAWFEVQDGS---SAKDSR----------------------
KMO2_ASPNC            PNVKMFFHHKLIRADMNTRKVWFEQREDPSTSTSPSTS----------------------
KMO1_ASPNC            PNVHIFYKHRLNGLDMKQKCATFHNISRPQ------------------------------
KMO_PHANO             PNVTFFFHRKLVSVDFRKKLAWFENRTKTDPAK---------------------------
D5GNF0_TUBMM          KDVKLFFHHGLRGLNLDDRTAEFEMIGTG-------------------------------
KMO_USTMA             RNVEVHFEHKLQSVDFDHDIKSAAKRAGTPPPAIDASANKWLRGANVTGGDSCADEPSGC
                                                                                  

KMO_FLAPJ             ------------------------------------------EWTNVSYDMVFGADGAFS
KMO_GRAFK             ------------------------------------------VWKEYQFDLIFGADGAFS
KMO_XANAC             ------------------------------------------QPHEIHFQSLIGSDGAGS
KMO_XANOM             ------------------------------------------QPHEIHFQSLIGSDGAGS
KMO_XANCP             ------------------------------------------QPHEIHFQALVGSDGAGS
KMO_STRMK             ------------------------------------------SPHDIRFDTLIGADGAGS
KMO_PSEFL             ------------------------------------------R-LEKRFHLLIGADGCNS
KMO_SALAI             ------------------------------------------EASTVTADLVVGADGVFS
KMO_SALTO             ------------------------------------------ETRTVTADLIVGADGAFS
KMO_LEGPC             ------------------------------------------DFVEASYHRLIGADGAPS
KMO_MYXXD             ------------------------------------------EARQEPGRVVFGTDGSAS
Q1ITW4_KORVE          ------------------------------------------ERKTVNSELVIGADGAVS
KMO_DICDI             ---------------------------------------------TIEASTIIGCDGAFS
D3B5G1_POLPP          ------------------------------------------ESKRITTNTLVGSDGAFS
KMO_CYTH3             ------------------------------------------TVATQSKEIVIGADGAFS
KMO_HUMAN             -----------------------------------------KVPKDVTCDLIVGCDGAYS
A0A2I3FZG4_NOMLE      -----------------------------------------KVPKDVTCDLIVGCDGAYS
G1M5X6_AILME          -----------------------------------------KVPIDVTCDLIVGCDGAYS
G1NTW3_MYOLU          -----------------------------------------QVPKDVTYDLIVGCDGAYS
KMO_PIG               -----------------------------------------KVPKDIACDLILGCDGAYS
KMO_MOUSE             -----------------------------------------KVPRDVTCDLVVGCDGAYS
KMO_RAT               -----------------------------------------KVPRDITCDLIVGCDGAYS
KMO_XENTR             -----------------------------------------ENIIEKKADLIVGCDGAFS
F6UL58_XENTR          -----------------------------------------ENIIEKKADLIVGCDGAFS
KMO_DANRE             -----------------------------------------GQKTETQADLIVGCDGAFS
A9V478_MONBE          -----------------------------------------KGEVKATGDLIIGCDGAHS
KMO_CAEBR             ----------------------------------------EHEEFHVEADLIIACDGAYS
KMO_CAEEL             ----------------------------------------EHAEFHVEADLILACDGAYS
KMO_ANOGA             ----------------------------------------TKDVKSARADLIVGCDGAYS
W5JA14_ANODA          ----------------------------------------TKETKSAQADLIVGCDGAYS
KMO_AEDAE             ----------------------------------------TKESTHTKADLIVGCDGAYS
KMO_DROME             ----------------------------------------KE-AVAAHADLIVGCDGAFS
E9H0N5_DAPPU          ----------------------------------------SGELVEAQADLILGTDGAYS
E0VU04_PEDHC          ----------------------------------------TNEFFETTADVIIGADGAYS
F4P9F4_BATDJ          -----------------------------------------GQNITVHANLIVGADGAYS
KMO_CANAL             ----------------------------------------HNDAKTSTFDFVVGCDGAHS
KMO_YEAST             ----------------------------------------LKTPHTEKYDFVIGCDGAYS
KMO_YARLI             ----------------------------------------EGEERVVESDYIIGADGAFS
E3KV40_PUCGT          ----------------------------------------------VKPDLTIGADGSYS
A8NFR7_COPC7          ----------------------------------------------FHFDFCVGTDGSYS
KMO_CRYNJ             ----------------------------------------TEDEDGTAFDLVIGCDGSWS
KMO_ASPFU             ----------------------------------------RVPEIEVDFDFMIGADGAHS
KMO3_ASPNC            -----------------------------------------VTEIEITFDYLIGADGAHS
KMO_EMENI             ----------------------------------------RVPEIEVDFDFLIGADGAHS
C0NXN8_AJECG          ---------------------------------------TRAPEIEITFDFLIGADGSHS
KMO_NEUCR             -----------------------------------------AREIEVDFDFMIGADGAHS
A7F691_SCLS1          -----------------------------------------DQEVEVDFDFLIGADGAHS
C7YWN5_NECH7          -----------------------------------------PKEIDISFDLMIGADGAHS
KMO2_ASPNC            -----------------------------------------STPKEVPFDFLIGADGAHS
KMO1_ASPNC            -----------------------------------------EPSHETKFDLLIGADGAHS
KMO_PHANO             -----------------------------------------SDDIEVSFDLMIGADGAHS
D5GNF0_TUBMM          ------------------------------------------ERVTVGADLIIGADGAHS
KMO_USTMA             GGRKQATTKSQGSEYVAPAGTSAVDRVRLDFDVHSTNQHIRKTSNTHYASFVVGCDGAHS
                                                                          .. **  *

KMO_FLAPJ             RIRHRMQRQ-----SMFNYSQDFLNTGYKELHIPANPDGSY-------------------
KMO_GRAFK             RVRHKMQRQ-----SRFNYSQHFIDVGYKELTILANEDGSH-------------------
KMO_XANAC             ALRAAMQRK-----SPLGERTEFLDHSYKELEIPPQPGGGF-------------------
KMO_XANOM             ALRAAMQRK-----SPLGERTEFLDHSYKELEIPPLPGGGF-------------------
KMO_XANCP             ALRAAMQRK-----APVGEHIAFLDHSYKELEIPPRADGGF-------------------
KMO_STRMK             ALRAAMNRR-----APLGEDIAFLDHSYKELEIPPADDGSF-------------------
KMO_PSEFL             AVRQAMASV-----VDLGEHLETQPHGYKELQITPEASAQF-------------------
KMO_SALAI             TVRQQMQHG-----LRANYAQDFLPWGYKELTIPVGTDGQP-------------------
KMO_SALTO             TIRQQMQHG-----LRANYAQEFLPWGYKELTIPVDADGQP-------------------
KMO_LEGPC             HVRDMLKNE-----GIVSASRDFLSHGYKELSISKKHTKG--------------------
KMO_MYXXD             AIRQALEKR-----PDFKGTQEQLGHGYKELTIPAGPGGAF-------------------
Q1ITW4_KORVE          AVRRDFLKL-----QRFNFSQQYLDYGYKELTIPPNSDGKH-------------------
KMO_DICDI             AVRGSMVKL-----DRQDYSQSYLKHGYKELCIPSGPNQTF-------------------
D3B5G1_POLPP          AVRQAMTRQ-----DRQEYSQSFLEHGYKELCIPAGPNGTF-------------------
KMO_CYTH3             IVRSFLSKQ-----QQPQPQIETLEYGYKELEI-ASAHTET-------------------
KMO_HUMAN             TVRSHLMKK-----PRFDYSQQYIPHGYMELTIPP-KNGDY-------------------
A0A2I3FZG4_NOMLE      TVRSHLMKK-----PRFDYSQQYIPHGYMELTIPP-KNGDY-------------------
G1M5X6_AILME          TVRSHLMKK-----PRFDYSQQYIPHGYMEFTIPP-KNGDY-------------------
G1NTW3_MYOLU          TVRGHLMKK-----PRFDYSQQYIPHGYMELTIPP-RNGDF-------------------
KMO_PIG               TVRTHLVKK-----PRFDYSQQYIPHGYMELTIPP-QNGDF-------------------
KMO_MOUSE             TVRAHLMKK-----PRFDYTQQYIPHGYMELTIPP-KNGEY-------------------
KMO_RAT               TVRAHLMKK-----PRFDYSQQYIPHGYMELTIPP-KNGEY-------------------
KMO_XENTR             VVRKQFMRK-----SRFNYSHVYIPHGYKELTIPP-RKGEF-------------------
F6UL58_XENTR          VVRKQFMRK-----SRFNYSHVYIPHGYKELTIPP-RKGEF-------------------
KMO_DANRE             AVRKQFLRQ-----SRFNYSQTYIPHGYMELTMPP-KDGDF-------------------
A9V478_MONBE          QVRRGLMRS-----DRVNYQQRYIPHGYKELTIPPGPDGDF-------------------
KMO_CAEBR             AVRRSLMTI-----PRFDFSQEYIEHGYVELNIMA-NNNEF-------------------
KMO_CAEEL             AVRRSLMTI-----PRFDFSQEYIEHGYVELNIMA-NNNEF-------------------
KMO_ANOGA             AVRKEIVKR-----PRYDFSQTYIEHGYLELCIPPTAGGEF-------------------
W5JA14_ANODA          AVRKEIVKR-----PRYDFSQTYIEHGYLELCIPPTATGEF-------------------
KMO_AEDAE             AVRKEIVKR-----PGYDYSQTYIEHGYLELCIPPTKDGDF-------------------
KMO_DROME             SVRQNNVRL-----PGFNYSQEYIETGYLELCIPSKS-GDF-------------------
E9H0N5_DAPPU          AVRKQFMKR-----PRFNYQQEYIPCYYLELCIPPTASGNF-------------------
E0VU04_PEDHC          TVRKEFLKH-----PMFNYSQEYIEHGYVELSIPPDIHGQF-------------------
F4P9F4_BATDJ          RVRTELLKK-----TIGFYSQEYIDHGYVELTMPATHSGNY-------------------
KMO_CANAL             QFRYHLQKT-----MRMDYSQKYIDMQYLELYIPPSED------------------ANNK
KMO_YEAST             ATRSQMQRK-----VEMDFSQEYMNLRYIELYIPPTEEFKPN--------------YGGN
KMO_YARLI             KTRDRLQRY-----VRMNYAQQYIDCVYLELKIPKADG-------------------PDP
E3KV40_PUCGT          QVRQQIMRC-----TRVDFSQEYIDDLYLELSIPPGVDK-ET--------------GKPC
A8NFR7_COPC7          VIRRQMMRVVRSTRSRMNYQQEYITSEYVELKMPAGRD--DH--------------GEPT
KMO_CRYNJ             KVRTAMMRA-----ERIDFSQSFIPHAYIELHMPSDPA------------------FPGG
KMO_ASPFU             AARYHMMKF-----ARVDYQQEYIDTLWCEFRIPPT-EDGD-------------------
KMO3_ASPNC            ASRYHMMKF-----ARVDYQQEYIDALWCEFRIPPSPETGD-------------------
KMO_EMENI             ATRYHMMKF-----ARVDYQQEYIDTLWCEFRIPPS-PTND-------------------
C0NXN8_AJECG          ATRYHLMKY-----ARVNYQQEYADVQWCEFQIKPTADTND-------------------
KMO_NEUCR             AVRYHLMKF-----SRMDYQQEYIDTLWCEFQIAPSSSS-----------------AKSK
A7F691_SCLS1          ATRYHLMKY-----LRMDYQQEYIDTLWCEFTIAAQEKTGD--------------DPVSR
C7YWN5_NECH7          AVRYHLMKF-----TRMNYQQEYIDTLWCEFQLKPVDTNDTA-------------DPMAK
KMO2_ASPNC            TTRQQIMRY-----TPLDYQQQYADTVWCELRIPPTEKTNS-------------------
KMO1_ASPNC            TTRFFLSRY-----AKININQKWEDIFWCELTIPAG------------------------
KMO_PHANO             AVRYHLMKF-----VPMSYQQEYIDKLWCQFHVPPSDKGD--------------------
D5GNF0_TUBMM          ATRRLLQKS-----VRMYFEQVYIETLWQEYEIPPDKETGD-------------------
KMO_USTMA             SIRSAMGSL-----IRMHYTHNYIDTGYIELSIPPRTSLGSGSRIRGSGGVDGKRGGHDA
                        *                        : :  :                           

KMO_FLAPJ             -KLDKHSLHIWPRGKYMLIALPNLDGSFTCTLFMPFE------GENSFASLDNRQKVEAF
KMO_GRAFK             -KMDNSSFHIWPRGNFMLIAMPNLDGTFTCTLFMPFD------GETSFESIKTEDEADIF
KMO_XANAC             -RIEGNALHIWPRGRYMCIALPNDGGTFTVTLFLPNA------GEPSFATTRTGDEAFAL
KMO_XANOM             -RIEGNALHIWPRGRYMFIALPNDGGTFTVTLFLPNA------GEPSFATTRNGDEAFAL
KMO_XANCP             -RIERNALHIWPRGRYMCIALPNDGGTFTVTLFLPNE------GMPSFATTRSGDEALAL
KMO_STRMK             -RIERNALHIWPRGHYMCIALPNHEGTFTVTLFLPNQ------GDPSFATINTGAQAEAL
KMO_PSEFL             -NLEPNALHIWPHGDYMCIALPNLDRSFTVTLFLHHQSPAAQPASPCFAQLVDGHAARRF
KMO_SALAI             -RVRLEALHVWPGHEALMVAHPNRDGSLTCTLFMAHE------GPVSFAALDTPAAVRDF
KMO_SALTO             -RVRLEALHVWPGHEAMMIAHPNRDGSLTCTLFMAHE------GPVSFAALDTPTAVRDF
KMO_LEGPC             --MAREHLHLWPRDSFMLLGNPNPDDSITGSLFLANE------GKDSFAELNNEEKLHLF
KMO_MYXXD             -QMEKHALHIWPRGTFMLIALPDEEGSFTCTLFLPWQ------GPVSFASLDTPAKLEAF
Q1ITW4_KORVE          -AMETHALHIWPRGSFMLIALPNIDGTFGCILFLPFE------GKNSFQLLQNNSDIVKF
KMO_DICDI             -QIDKNSLHIWPRGSFMMIALPNIDGSFTCTLFFPFD-----GPL-SFSSLDTREKVDQF
D3B5G1_POLPP          -LLERECLHIWPRGAYMMIALPNIDGSFTCTLFFPFE-----GETNSFAALNSREKVDNF
KMO_CYTH3             -ITNNQALHIWPRERFMLIALPNEDGSYTATLFLPLK------GEISFEALQSDQDIQLF
KMO_HUMAN             -AMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFE--------EFEK-LLTSNDVVDF
A0A2I3FZG4_NOMLE      -AMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFE--------EFEK-LLTSNDVVDF
G1M5X6_AILME          -AMELNYLHIWPRNTFMMIALPNTNKSFTCTLFMPFE--------DFEN-LVTSSDVLTF
G1NTW3_MYOLU          -AMEPNYLHIWPRNTFMMIALPNKNKTFTCTLFMPFE--------EFEK-LPTSRDVLDF
KMO_PIG               -AMEPNYLHIWPRDTFMMIALPNMNKSFTCTLFMPFE--------EFEK-LLTSRDVLDF
KMO_MOUSE             -AMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFE--------EFER-LPTRSDVLDF
KMO_RAT               -AMEPNCLHIWPRNAFMMIALPNMDKSFTCTLFMSFE--------EFEK-LPTHSDVLDF
KMO_XENTR             -AMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFE--------DFEK-LTTGDQVLDF
F6UL58_XENTR          -AMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFE--------DFEK-LTTGDQVLDF
KMO_DANRE             -AMEPNYLHIWPRNTFMMIALPNLDRTFTCTLFMPFE--------DFEK-IRTGDELLRF
A9V478_MONBE          -QIKANFLHIWPRSTFMMIALPNQDKTFTATLFMPFD--------KFDS-IKTAEDVLEL
KMO_CAEBR             -AFEENVFHLWPRGHFTLIALANRDKTFTVTIFAPFT--------EFEKHMSTTEEVLSF
KMO_CAEEL             -AFEENVFHLWPRGHFTLIALANRDKTFTVTIFAPFS--------EFEKHMSTSEDVLSF
KMO_ANOGA             -AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFT--------QFHS-ITDQGLLLDF
W5JA14_ANODA          -AMPHNYLHIWPRGKFMMIALPNQDRTWTVTLFMPFT--------NFHS-ITDADALLDF
KMO_AEDAE             -AMPHNYLHIWPRGKFMMIALPNQDRTWTVTLFMPFT--------NFNS-IKCDGDLLKF
KMO_DROME             -QMPANYLHIWPRNTFMMIALPNQDKSFTVTLSMPFE--------IFAG-IQNQNDLLEF
E9H0N5_DAPPU          -AMNPKCLHIWPRGSFMMIALPNQDASWTVTLFMPHD--------KFEA-LTTPEELLAF
E0VU04_PEDHC          -LMEPNYLHIWPRDTFMMIALPNRDKSWTVTLFMPLK--------NFQE-LKKPETLLKF
F4P9F4_BATDJ          -AMDPGHLHIWPRQTFMMIALPNVDRSFTVTLFMPWF--------KFEE-IQTPTQLIEF
KMO_CANAL             FSIDANHLHIWPRHNFMLIALANKDGSFTSTFFSPWSVIEGIS--------SSQE-FVEF
KMO_YEAST             FAIAPDHLHIWPRHKFMLIALANSDGSFTSTFFGSKDQISDLI--------TSKSRVREF
KMO_YARLI             FSISPNHLHIWPRHKYMLIALANGDGSFTSTLFAPPALMEQVC--------ESQNTFISF
E3KV40_PUCGT          FLLDPNHLHIWPRQSFMLIALPNQDKSFTCTLFAPQHGVFDQLEVPKNE--EEERHIIDF
A8NFR7_COPC7          FLLDPNHLHIWPRHSFMLIALPN-------------------------------------
KMO_CRYNJ             YAMDKNHLHIWPRHAFMLIGLPNKDGSFTLTLFIPFSSL-------ELL--DTRESAAAF
KMO_ASPFU             FRISPNHLHIWPGREFMFIALPSADKSFTCTLFAPAAHYKHLG-SSPQ-------NLVES
KMO3_ASPNC            FQISPNHLHIWPGKEFMFIALPSADKSFTCTLFAPAWHYEKLEKSSPQ-------DLVTS
KMO_EMENI             FLISPSHLHIWPGKEFMFIALPSVDKSFTCTLFAPASHYAQLE-RSTE-------DLLQF
C0NXN8_AJECG          FAISPNHLHIWPGREFMFIALPSPDKTFTCTLFASEAHFTALE-NAPE-------TIVGF
KMO_NEUCR             FRISPNHLHIWPGKEFMFIAIPSNDGSFTCTLFAPAAIYEQLEEAGRTG--DTSSSIPEF
A7F691_SCLS1          FKISPNHLHIWPGQDFMFIAIPSTDGSFTCTLFMPSGPFNELELDPK--------NVPSF
C7YWN5_NECH7          FRISPNHLHIWPGKDFMFIAIPSDDGSFTCTLFMPSREFTELENNPS--------SLPSF
KMO2_ASPNC            FRLPPNYLHIWPGGEYMFCAFPCPDQSFNCILFAPASRLDALKSSPPA-------TLFDF
KMO1_ASPNC            HALPMDCLHMWPQRDFMLFACPDKEGTLTCNLFAPENVFLELKSSGR---------IVEF
KMO_PHANO             FRIPPNYLHIWPQDDAMFIALPNLDKSFTSTLFLTRSGFEELVASGK---------VVEY
D5GNF0_TUBMM          FKIDANHLHIWPKKDFMFIAIPSIDKTFTCTLFMEQWRFDAIGESREN--------LLAF
KMO_USTMA             FHLDANHLHIWPRHSFMLIALPNLDGSFTCTLFAPFKMFASELSTKEG--------IVAV
                             :*:**       . .                                      

KMO_FLAPJ             FAENLPDTV-DVIPD--LAEDFFKNPTSTLVTMKCFPWTYS-DKVALIGDAAHAIVPFYG
KMO_GRAFK             FEKYFPDIK-DEISN--LKKDFFKNPTSAMVTIKCFPWSYF-DKITLVGDSAHAIVPFYG
KMO_XANAC             FARDFPDAL-PLIPQ--LKEHWEEHPPGLLGTLTLDRWHLD-GRALLIGDAAHAMVPFHG
KMO_XANOM             FARDFPDAL-PLIPQ--LKQHWEEHPPGLLGTLTLDRWHLD-GRALLIGDAAHAMVPFHG
KMO_XANCP             FARDFPDAL-PLIPQ--LKEHWEEHPPGLLGTLTRERWHLD-GRAVLLGDAAHAMVPFHG
KMO_STRMK             FAREFADTL-PLIPN--LRADWEQHPPGLLGTLTLDRWHQQ-GRAVLIGDAAHAMVPFHG
KMO_PSEFL             FQRQFPDLS-PMLDS--LEQDFEHHPTGKLATLRLTTWHVG-GQAVLLGDAAHPMVPFHG
KMO_SALAI             FRRRFPDAE-ELMPD--LVREITEHPVGHLVTVRTAPWRYA-DRVVLIGDAAHAVYPFYG
KMO_SALTO             FRQRFPDAE-ELMPD--LVREVTEHPVGHLVTVRSDPWRYA-DRVVLIGDAAHAVYPFYG
KMO_LEGPC             FKTQFPDAY-AAMPN--LVQEFFGNPTGHLSTIQCSPWYYK-DECLLIGDAAHGIIPFFG
KMO_MYXXD             FGAQFPDAK-ALIPD--LVEAFFSRPTGSMVTVKGAPWHAG-GQTLLLGDAAHAIVPFFG
Q1ITW4_KORVE          FEENFPDAM-ALMPR--LAENFFANPVGAMVTVKCSPWSHG-SRALLLGDAAHAIVPFFG
KMO_DICDI             FKDYFPDAY-KLMPD--LLDDYFENPTSSLVTVKTEPYHYQ-GKVVLVGDAAHAIVPFYG
D3B5G1_POLPP          FKTIFPDAY-AVMPT--LLDDFDANPTSSLVTVKTYPWSVG-SKAVLIGDAAHAIVPFYG
KMO_CYTH3             FKKYFPDTE-NLFPD--LTEQFYRHPTSKLFTIHSSNWF-N-AHTLLIGDAAHALVPFYG
KMO_HUMAN             FQKYFPDAI-PLIGEKLLVQDFFLLPAQPMISVKCSSFHFK-SHCVLLGDAAHAIVPFFG
A0A2I3FZG4_NOMLE      FQKYFPDAI-PLIGEKRLVQDFFLLPAQPMISVKCSSFHFK-SHCVLLGDAAHAIVPFFG
G1M5X6_AILME          FQKYFPDSI-PLIGEQALVRDFFLLPAQPMISVKCSSFHLK-SHCVLMGDAAHAIVPFFG
G1NTW3_MYOLU          FHKYFPDAV-PLMGEQALTRDFFLLPAQPMISVKCSPFHFK-SRCVLMGDAAHAIVPFFG
KMO_PIG               FQKYFPDSL-HLIGKEALAQDFFRLPAQPMISVKCSSFHFN-SHCVLMGDAAHALVPFFG
KMO_MOUSE             FQKNFPDAI-PLMGEQALMRDFFLLPAQPMISVKCSPFHLK-SHCVLMGDAAHAIVPFFG
KMO_RAT               FQKNFPDAI-PLMGEQALMRDFFLLPAQPMISVKCSPFHLK-SRCVLMGDAAHAIVPFFG
KMO_XENTR             FKTYFPDSI-ELIGEKKLTEDFFLLPPQAMISVKCSSFCID-HKCVIMGDAAHAVVPFYG
F6UL58_XENTR          FKTYFPDSI-ELIGEKKLTEDFFLLPPQAMISVKCSSFCID-HKCVIMGDAAHAVVPFYG
KMO_DANRE             FHKYFPDSV-PLIGVEALKQDFFRLPAQAMVSVKCCPYHLF-EKCVLMGDAAHAVVPFYG
A9V478_MONBE          FEAEFPDSI-PLIGRERLVKDYFENPTGTLMTVKCDPVG-A-RRTILMGDAAHAVVPFYG
KMO_CAEBR             FEENFPDAY-LLLGKEHIADTFNRVKPQSLVSIKCSPHSFF-NNLVLMGDAAHAMVPFYG
KMO_CAEEL             FEENFPDAF-LLLGKEHIADTFNRVKPQPLVSIKCSPHSFF-DNLVLMGDAAHAMVPFYG
KMO_ANOGA             FRQHFPDAI-ELIGRERLVKDFFKTKAQPLVMIKCRPYHIG-AKALIIGDAAHAMVPFYG
W5JA14_ANODA          FRQYFPDAI-DLIGRERLIKDFFKIKPQPLVMIKCRPYHVG-TKALIVGDAAHAMVPFYG
KMO_AEDAE             FRTYFPDAI-DLIGRERLVKDFFKTRPQSLVMIKCKPYNVG-GKAVIIGDAAHAMVPFYG
KMO_DROME             FKLNFRDAL-PLIGEQQLIKDFFKTRPQFLVSIKCRPYHYA-DKALILGDAAHAMVPYYG
E9H0N5_DAPPU          FKTHYPDAI-PLIGKDRLVKDFFAIKPSGLISVKCYPHH-A-GKALLLGDAAHAMVPFYG
E0VU04_PEDHC          FQINFPDAL-NYMTEDGLIRDYFSTVPSHLVSIKCNPYHLK-NKLLLIGDAAHAMVPFFG
F4P9F4_BATDJ          FEDKFADAV-PLIGKGFLVQEYFKNTKGSLVSIKCKPYHYK-DRAVIIGDAAHAMVPFYG
KMO_CANAL             FRHNFPDAV-GLIGEDALSSAFKSNPRGSLMQVSCYPYSN--GKGIILGDAAHSMVPFYG
KMO_YEAST             LIENFPDII-NIMDLDDAVKRFITYPKESLVCVNCKPYDVPGGKAILLGDAAHAMVPFYG
KMO_YARLI             FKEQFPDAY-ELMGESQILESYENNPRSPLVSLKCSPYNHK-GECLLVGDAAHCMVPFYG
E3KV40_PUCGT          FNTHFPDAL-SLIGHKDLIRCFVENPRGSLLTIKCKPYHYK-DKAVIIGDAAHSMVPFYG
A8NFR7_COPC7          ---------------------------------KANPYHYL-DRAIILGDAAHSMVPFYG
KMO_CRYNJ             FREHFPSAV-DIVGEKVLLDDFEKNPRGNLVTINCTPSAWS-SHAILLGDASHSMVPFYG
KMO_ASPFU             FKDHFPGVCPELISPEDLQEQFTTNPHLPLISLKCKPHHYN-SSIVIVGDAAHAVLPFYG
KMO3_ASPNC            FDYNFPGVCPNLITPEALAEQFTENPHLPLISLKCKPHHFG-SSVVIVGDAAHAVLPFYG
KMO_EMENI             FDEHFPGVCPQLISPSDLTAQFRANPHLPLISIKCAPHHYS-SSVVIVGDAAHAVLPFYG
C0NXN8_AJECG          FNKHFPGVSPELIPPNSLQEQFNSNPHLPLISIKCSPHHFD-SSVVVIGDAAHAMLPFYG
KMO_NEUCR             FDMHFPGVT-SLIAPADLIAQFQTNPHLPLISIKCKPYHFS-SSVVIVGDAAHAMVPFYG
A7F691_SCLS1          FDEHFPGVT-KLIDHASLISSFTNNPHLPLISIKCKPYHFQ-DSVIILGDAAHAMVPFYG
C7YWN5_NECH7          FDKHFPGVT-DLIPGDELIESFKTNPHLPLISLKCKPYHHG-SSCVIVGDAAHAMVPFYG
KMO2_ASPNC            FDTHFPGVCPDLISQSSLSQQFYQSPHLPLIGIKCSPHHLG-SAAVIIGDAAHAMFPFYG
KMO1_ASPNC            FEKNFPGITPDLIPTDNLQKQFKSNLHHPMIDIRCSPYHYQ-DSCVLIGDAAHAMVPFYG
KMO_PHANO             FDEKFPGVVPELITEDELRKQFNEHDHFPLISIKCSPYHFG-STGVIVGDSAHAMVPFYG
D5GNF0_TUBMM          FRENFEEVI-DLVGEDSLVEQYLSHQRLPLISIKCRPYHYK-DRCVIIGDAAHAMVPFYG
KMO_USTMA             FQQHFPDAL-ALIDEEKLVKCLTTRRASALGSVQCDPYHYK-DRAVLIGDAAHAMLPFYG
                                                                    ::**::* : *:.*

KMO_FLAPJ             QGMNAGFEDITILYQMMQEY-------------------------------------GND
KMO_GRAFK             QGMNAGFEDISVLNEKMNLY-------------------------------------GDD
KMO_XANAC             QGMNCAFEDCVALADQLDAH-------------------------------------DDL
KMO_XANOM             QGMNCAFEDCVALADQLDAH-------------------------------------DDL
KMO_XANCP             QGMNCAFEDCVALAEQLDAH-------------------------------------SDL
KMO_STRMK             QGMNCAFEDCVALARHLMEA-------------------------------------DDL
KMO_PSEFL             QGMNCALEDAVALAEHLQSA-------------------------------------ADN
KMO_SALAI             QGMNSAFEDCVVLDECLTAH-------------------------------------PDR
KMO_SALTO             QGMNSAFEDCVVLDECLTAH-------------------------------------PDR
KMO_LEGPC             QGMNSAFEDCRILDELLDEY-------------------------------------QDD
KMO_MYXXD             QGMNCGFEDCVVLDQLLGQ--------------------------------------GAG
Q1ITW4_KORVE          QGLNCSFEDCTVLLGLLDRY-------------------------------------GPN
KMO_DICDI             QGMNAAFEDVLELFNCFEDKSLYPSSTDKPF-------------------------DNDH
D3B5G1_POLPP          QGMNAAFEDVLDLYQCIIEE----SKGSVEF-------------------------SNEA
KMO_CYTH3             QGMNAGFEDCRILAEIIDGK------------------------------------SKTN
KMO_HUMAN             QGMNAGFEDCLVFDELMDKFSNDLSL----------------------------------
A0A2I3FZG4_NOMLE      QGMNAGFEDCLVFDELMDKFNNDLSL----------------------------------
G1M5X6_AILME          QGMNAGFEDCLVFDELMDTFNNDLSM----------------------------------
G1NTW3_MYOLU          QGMNAGFEDCLVFDELMEKFNNDLSM----------------------------------
KMO_PIG               QGMNAGFEDCLVFDELMDKFNNDFSM----------------------------------
KMO_MOUSE             QGMNAGFEDCLVFDELMDKFNNNLSM----------------------------------
KMO_RAT               QGMNAGFEDCLVFDELMDKFNNDLSV----------------------------------
KMO_XENTR             QGMNAGFEDCLVFSELMEQYQNNLRI----------------------------------
F6UL58_XENTR          QGMNAGFEDCLVFSELMEQYQNNLRI----------------------------------
KMO_DANRE             QGMNAGFEDCLVFDEIMDQFNENLVA----------------------------------
A9V478_MONBE          QGMNAGFEDCLVFNNLLEKHANDIDA----------------------------------
KMO_CAEBR             QGMNCGFEDCLVFSETLEEQNNDIAS----------------------------------
KMO_CAEEL             QGMNCGFEDCLVFSETLEEYGNDIAK----------------------------------
KMO_ANOGA             QGMNAGFEDCSVLTELFNQYGTDLAR----------------------------------
W5JA14_ANODA          QGMNAGFEDCSVLTELFGKYGSDLER----------------------------------
KMO_AEDAE             QGMNAGFEDCTVLTELFNQHGSDVDR----------------------------------
KMO_DROME             QGMNAGMEDVTLLTDILAKQ-LPLDE----------------------------------
E9H0N5_DAPPU          QGMNCGFEDCLVLNEFLNQLGDHNLEK---------------------------------
E0VU04_PEDHC          QGMNAGFEDCVLLENLVTKY-KSDFNF---------------------------------
F4P9F4_BATDJ          QGMNCGFEDVLILDNLFSKHLDTLSISIDSHDDRKVPQLEMFTLSSISNMYVMSAPTPSQ
KMO_CANAL             QGMNCGFEDVRILMELIDTN-------------------------------------NGD
KMO_YEAST             QGMNCGFEDVRILMALLKKH-------------------------------------SGD
KMO_YARLI             QGMNAGFEDIRVLMEILDEK-------------------------------------KWN
E3KV40_PUCGT          QGMNCGLEDVRKLDQLFQK--------------------------YTDQIKPAN--QKEK
A8NFR7_COPC7          QGLNCGLEDVRILTTLMDQEGITA--------------------CAPESFDPSKDAVDRQ
KMO_CRYNJ             QGLNCGLEDVRVLSSILERH------------------------HISPTTTLALGETDPE
KMO_ASPFU             QGLNAGLEDIRVLF-ECLDKHGSYN------------------LDASPD------ARREA
KMO3_ASPNC            QGLNAGLEDIPVLF-SFMDQYGVYDD----------------SISPTPE------ARASA
KMO_EMENI             QGLNAGLEDIQVLF-DALDKHGVYN------------------ANSDQA------ARALA
C0NXN8_AJECG          QGLNAGFEDVRILF-DFLDEYGVYK-----------------ASTTPPQ------GQQER
KMO_NEUCR             QGMNAGLEDVRILF-DILDKHDRM-----------------TNDDSSLE------ASQ--
A7F691_SCLS1          QGMNAGLEDVRVLY-SILDNEKR-------------------NFPRLST------EAC--
C7YWN5_NECH7          QGMNAGMEDVRILF-SILDKHAQIEESNDP-----------SNQSTTST------AATFE
KMO2_ASPNC            QGLNAGMEDVRILF-DLLDEHRVFG-------------------HGKSL------DKDHA
KMO1_ASPNC            QGMNTGFEDVRILFEDFLDQRRSFPSWKDN-----------LSLSYAMQQKELPDTPQAI
KMO_PHANO             QGMNAGLEDVRVLF-EILDKYPGDQ-----------------------------------
D5GNF0_TUBMM          QGMNAGFEDVSVLFEHIRRHPDSM------------------------------------
KMO_USTMA             QGLNCGFEDVRVMF-DIIDQHESLQ-----------------------------------
                      **:* .:**   :                                               

KMO_FLAPJ             WKTIFSEYEKSRKPDADAIAELSYRNFMEMSTKTANEKFLLQKKIERWFASKYPEK----
KMO_GRAFK             WEKVFEDYQTERKPNADAIAELSYRNFVEMSKKTADPKFLLRKKIEQKFAENHPDL----
KMO_XANAC             ASAFAAFEAA-RRDDAAAIQQMALENYLEMRDRVDDPDFLLQRELEQQLQARWPTR----
KMO_XANOM             ASAFAAFEAA-RRDDAGAIQQMALENYLEMRDRVDDPEFLLQRQLEQQLQARWPTR----
KMO_XANCP             SEAFAAFEAA-RRDDAAAIQQMALENYLEMRDRVGDAQFLLQRALEQQLQARWPTR----
KMO_STRMK             EGAFAAFEAE-RKPNARAIQQMALENYLEMRDRVADPAFLLQRELEQELQRRWPTR----
KMO_PSEFL             ASALAAFTAQ-RQPDALAIQAMALENYVEMSSKVASPTYLLERELGQIMAQRQPTR----
KMO_SALAI             AAALAAYEAA-RKPHTDVLADLSTANFEDLRDRVHRLGYSASAAADRLLARLLPQR----
KMO_SALTO             ATALAAYEAA-RKPHTDVLADLSTANFEDLRDRVHRLGYSASAAADRLLARLLPQH----
KMO_LEGPC             WSRVTPVFYEQRKVNTDAIAKMSMDNYHEIHSDIRNPKFILQKQIERELMLRYPEH----
KMO_MYXXD             WEQVFTDFERLRKTNADAIADMAVENFVEMRDSTGDPRFLFRKAVEKVLLNAFPGE----
Q1ITW4_KORVE          WPVVFREFGAARKVNTDAIADMAIENFVEMRDKVGDSRFLFKKKVELALEAKFPGL----
KMO_DICDI             FNNIYKKYQENRKANSDAIAEMAVENFFEMRDHVGDALFLFKKKVEHLLEVKFPSR----
D3B5G1_POLPP          FTAAYRRYQINRKKNSDAIAEMAVENFIEMRDKVADEMFVFKKKVEHLLEEKFQLR----
KMO_CYTH3             WSEIFAEFYNQRKENADAISDLALQNFIEMRDHVADASFLLRKKIEKHLHQELEDA----
KMO_HUMAN             ---CLPVFSRLRIPDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPST----
A0A2I3FZG4_NOMLE      ---CLPAFSRLRVPDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPST----
G1M5X6_AILME          ---CLPEYSRLRIPDDHAISDLSMYNYIEMRAHVNSRWFIFQKNVERFLHTVMPST----
G1NTW3_MYOLU          ---CLPEFSRFRIPDDHAVSDLSMYNYVEMRAHVNSRWFIFHKNVERFLHAIMPST----
KMO_PIG               ---CLPEFSKFRIPDDHAISDLSMYNYIEMRSHVNSRWFIFQKNIERCLHTLMPST----
KMO_MOUSE             ---CLPEFSRFRIPDDHAISDLSMYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPST----
KMO_RAT               ---CLPEFSRFRIPDDHAISDLSMYNYIEMRAHVNSRWFLFQRLLDKFLHALMPST----
KMO_XENTR             ---CLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTT----
F6UL58_XENTR          ---CLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTT----
KMO_DANRE             ---VLQEYTRVRVPDDHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPKT----
A9V478_MONBE          ---AVADYSRSRVADVHAIADLALYNYVEMRDLVNSRWFLFRKKVDNFLHALMPNT----
KMO_CAEBR             ---AVQVYSERRVNDAHTINDLAMYNYEELKDLVNKNSYKLRKKFDGFMNAIFPKS----
KMO_CAEEL             ---AVKVYSDGRVNDAHSINDLAMYNYEELKDLVNKSSYKLRKKFDTIMNSIFPKS----
KMO_ANOGA             ---ILPEFSEKRWEDAHAICDLAMYNYIEMRDLVTKRSYLLRKKLDELLFWMMPNT----
W5JA14_ANODA          ---ILPEFSERRWEDAHAICDLAMYNYIEMRDLVTKRSYLLRKKLDELLFWMMPNT----
KMO_AEDAE             ---ILAEFSDTRWEDAHSICDLAMYNYVEMRDLVTKRSYLFRKKLDELLYWMLPNT----
KMO_DROME             ---TLALFTESRWQDAFAICDLAMYNYVEMRDLTKRWTFRLRKWLDTLLFRLFPG-----
E9H0N5_DAPPU          ---VLPAYTEHRHVDAHAICDLALYNFIEMRDLVNRFSFLARKRFDNTMHWLFPNW----
E0VU04_PEDHC          ---IMPEFSKTRCRDAEAICDLAMYNYIEMRFLVNKKTFRLRKKLDNVLYKIFQNK----
F4P9F4_BATDJ          LASILKEYSTIRNPDAEAICDLALNNYIEMRSSVTTWSYLLRKKFESAMYALFPNL----
KMO_CANAL             IEEAFKQYSAARKNDLDAICKLALDNYYEMSSKVVDIGYLIKKKLDYTLGKIFKNK----
KMO_YEAST             RSRAFTEYTQTRHKDLVSITELAKRNYKEMSHDVTSKRFLLRKKLDALFSIIMKDK----
KMO_YARLI             VEEAFNTYTERRHKDLVAIVDLAMRNYVEMSHSVVSLPYLIRKKVDGVLGRVFSSA----
E3KV40_PUCGT          LGVILESYTQTRHQDLLAICDLALQNYREMSDKVTRFDYLMRKKVDSVLARLLRGN----
A8NFR7_COPC7          LARVLEKYTLGRHQDCLAIIDLAMDNYIEMRHSVTTWSYLVKKAVDNILYTLTSRKMVSL
KMO_CRYNJ             LELALKAYSDERQGDLKAICELALQNYTEMRSHVLSPLHHLRRQVDKVFTTLFRSAPQAT
KMO_ASPFU             RAKAFQAYTDQRCADTHAINDLSKQNYLEMRWGVKTPLYKLRKSVEEALDRYVPSL----
KMO3_ASPNC            RAAALQAYTNQRTADTWAINDLSKQNYLEMRWGVKSPVYKLRKMVEETLDHYVPSL----
KMO_EMENI             RQSAFAAYTASRTADAHAINDLSRQNYVEMRWGVKQPLYRLRKYIEEALYHYLPSL----
C0NXN8_AJECG          RAAALAAYTKHRTPDAHAINNLSLHNYIEMRWGVTSPLYLMRKSVEEMLDRHLPFL----
KMO_NEUCR             RELALAEYSAVRVADAHAINDLALQNYIEMRSSVLSPVYRWRKALEEWLSVYVPSL----
A7F691_SCLS1          RSVALNLYSEIRKADAHAINDLALHNYIEMRASVISPVYKFRKWLEETLSVHVPRL----
C7YWN5_NECH7          RSLALAEYSAVRPFDAHAINDLALQNYVEMRSSVLSRRYRLRKFLEEFMSVHFPRM----
KMO2_ASPNC            RAAALTEYSNQRVRDAHAIHDLSRRNYLELRGGVNSPVYKARKFVEEALQRYVPLL----
KMO1_ASPNC            VEDYLEQYTKYRQPDVHIINELALQNYRELRQGVFKMSYHIRKHIEEFLSLHAPQL----
KMO_PHANO             -AKALSEYSEQRTPDAQTINDLALGNYREMASDVKKPLYLLRKWIEEKLYIYVPSA----
D5GNF0_TUBMM          -ADALASYSAYRMPDGHMINELAMQNHIEMRAAVTSKGYLFRKAIEEALYAYVPWL----
KMO_USTMA             --VALDLYTKERHPDLVAILQLAEQNYREMAHSVVSWPYLLRKKLDGLLMSILPSS----
                                 *  .   :  ::  *. ::        .         :           

KMO_FLAPJ             -------------------WIPLYDRVTFS-TRPYSEALAIGDFQETIMQEILK------
KMO_GRAFK             -------------------WTPLYSRVTFS-DKAYSDALKIGDYQREIMDEVMK------
KMO_XANAC             -------------------FVPHYTMVTFL-RTRYSIALARSEIQREILVQATR--GHSD
KMO_XANOM             -------------------FVPHYTMVTFL-RTRYSIALARSEIQREILVEATR--GHSD
KMO_XANCP             -------------------FVPHYTMVTFL-RTRYAIALARSEIQREILLEATH--GHTD
KMO_STRMK             -------------------FVPHYTMVTFL-HTPYAEALRRTELQRDMLVAATT--GHDS
KMO_PSEFL             -------------------FIPRYSMVTFS-RLPYAQAMARGQIQEQLLKFAVA--NHSD
KMO_SALAI             -------------------WVPLYAMVAHT-TIPYADALARANRQDRILRRAGA--GLTL
KMO_SALTO             -------------------WVPLYGMVAHT-TIPYADALARAKRQDRILRQAGA--GLAL
KMO_LEGPC             -------------------YVSMHVLVMFT-NTPYAKAMAIGELQSGLLEQICF--PITD
KMO_MYXXD             -------------------FVSRYSLVSFS-HVPYRLAYQMGALTDGIVSELSE--GLPR
Q1ITW4_KORVE          -------------------FVPKYAMVTFH-RVPYSVAESRGRIQDRILSELCD--PIAK
KMO_DICDI             -------------------YISRYELISFS-TQPYAYAQKIGLANQQILNELVKGNDDYN
D3B5G1_POLPP          -------------------YISRYELISFS-TTPYSEAQRIGLINQQILSELVK-EANFD
KMO_CYTH3             -------------------FIPQYTMVSFT-DISYKEAMETGLLHQKILDEIMA------
KMO_HUMAN             -------------------FIPLYTMVTFS-RIRYHEAVQRWHWQKKVINKGLFFLGSLI
A0A2I3FZG4_NOMLE      -------------------FIPLYTMVTFS-RIRYHEAVQRWHWQKKVINKGLFFLGSLI
G1M5X6_AILME          -------------------FIPLYTMVTFS-RIRYHEAVLRWHWQKKVIKKGLFFFGTLI
G1NTW3_MYOLU          -------------------FIPLYTMVTFS-RIRYHEAMLRWRWQKKVINKGFFLFGTLI
KMO_PIG               -------------------FIPLYTMVTFS-RIRYHEAMLRWQWQKKVINTALFFFGTLV
KMO_MOUSE             -------------------FIPLYTMVAFT-RIRYHEAVLRWHWQKKVINRGLFVLGSLI
KMO_RAT               -------------------FIPLYTMVAFT-RIRYHEAVLRWHWQKKVINRGLFVLGSLV
KMO_XENTR             -------------------FIPLYTMVTFS-RIRYHEVILRWKWQKKIINVGLFTVGTTG
F6UL58_XENTR          -------------------FIPLYTMVTFS-RIRYHEVILRWKWQKKIINVGLFTVGTTG
KMO_DANRE             -------------------IVPLYTMVTFT-RTRYNDAVNRWHWQNKVITRGLWLCGFVS
A9V478_MONBE          -------------------FIPLYTMVTFS-QIPYATVVARSKQQAHTIDTALTALAATA
KMO_CAEBR             -------------------WIPLYSMVTFT-RIPYSEVVDRRRKQDRILSNLWKTTSTLA
KMO_CAEEL             -------------------WIPLYSMVTFS-RIPYSEVIERRKRQDKILSRIMTTTSTLA
KMO_ANOGA             -------------------WVPLYNSVSFS-HMRYSKCIANRAWQDKILTRVLYGASIAS
W5JA14_ANODA          -------------------WVPLYNSVSFS-HMRYSKCIANRAWQDQILTRVLYGASFAA
KMO_AEDAE             -------------------WVPLYNSVSFS-HMRYSKCIANRKWQDKILTRVLYCCSITA
KMO_DROME             -------------------WIPLYNSVSFS-SMPYRQCIANRKWQDQLLKRIFGATFLAA
E9H0N5_DAPPU          -------------------WVPLYTSVTFS-RMRYHLCIENKKWQDRVRQN---------
E0VU04_PEDHC          -------------------WLPLYNSVTFT-DMNYSKCIENRKFQDKNSKDFS-------
F4P9F4_BATDJ          -------------------ITPLYTMVSFS-RIPYSEAMRKWKAQTWWYRTVGRASIWCG
KMO_CANAL             -------------------WLPLYTMISFRDDIPYAKAIEIEKRQNRIMNNVG-----LG
KMO_YEAST             -------------------WIPLYTMISFRSDISYSRALERAGKQTRILKFLE-----SL
KMO_YARLI             -------------------WVPLYSMVSFRADIPYSKALSRSARQDRIIGNIVNWTSFAG
E3KV40_PUCGT          -------------------WLPLYTMVTFRDDIDYSQVIKREAKQSQLIDWSLRFF--VG
A8NFR7_COPC7          PSLVPTLSRMAYPPEAPRGWLPLYTMVTFRPDISYATAKAKAERQARILDGLIWTG--TA
KMO_CRYNJ             LSLME-----PFPTKKVRGWTSLYEMVTFRPDVGYSEALRKERWQKDVVGYAGWIGG-VV
KMO_ASPFU             ------------------GWQTQYSRVSFS-NQRYSDVIRSARWQGRILALGLATTLIST
KMO3_ASPNC            ------------------GWQTQYSRVSFS-NQRYSEVIASVKRQGKLLGVAGLSSVLVS
KMO_EMENI             ------------------GWQTQYTRVSFS-NQRYSEIIAINRRQGRILGAVFGSTLISV
C0NXN8_AJECG          ------------------GWSTQYSCVSFS-NQPYSKIVQKARRQGLVLTSILAVMLSSA
KMO_NEUCR             ------------------GWQTKYSRVSFG-NERYSEVVKKSERQGQVLLRSLVGGVGLP
A7F691_SCLS1          ------------------GWQTKYARVSFS-NERYSEIVRQSEKQGKLILA---------
C7YWN5_NECH7          ------------------GWQTKYSRVSFS-NEGYLDVIKKSDSQGKVLVRSFFTLIASP
KMO2_ASPNC            ------------------GWRTLYSRVSFS-DQRYSEVVVKNELQGWVLLLMSGLGVLLH
KMO1_ASPNC            ------------------GWATQYRLVAFE-TMRYTDVLRQVRKQGLILSAVAWSCLLLF
KMO_PHANO             ------------------GWATQYSRVTFS-NMRYSEVQAAAQRQAKILNGIVGVTTLSL
D5GNF0_TUBMM          ------------------GVRTMYSMISFS-NIRYTEVVNRTRRQ-RVWLNAVATALLVG
KMO_USTMA             ------------------MWSSLYAMTTFS-NLPYSRVVKTEKRQQAIIGHALVATAVAF
                                           . :    .     *                         

KMO_FLAPJ             IENIETNWETEEIEHKIIQLLNSK-----------------------------
KMO_GRAFK             IPGIEEKWESSEVEEKIISLIKK------------------------------
KMO_XANAC             LSRIDWSALEAVVHARLEPLDGAH-----------------------------
KMO_XANOM             LSRLDWAALETIVHARLEPLDGAH-----------------------------
KMO_XANCP             LSRIDWVALETVVHARLEPLEGAH-----------------------------
KMO_STRMK             LDNIDWAALEAQIHAQLPVLEGAH-----------------------------
KMO_PSEFL             LTSINLDAVEHEVTRCLPPLSHLC-----------------------------
KMO_SALAI             AVGLAATAAALRVGRRRRAARR-------------------------------
KMO_SALTO             VTVLAATAA-LRAGRRRRANRR-------------------------------
KMO_LEGPC             IKELNWQEVEKLLSIYDKKLAKII-----------------------------
KMO_MYXXD             AEDVDLKRAAELIRSRLTPFMKEHADGFRTEG---------------------
Q1ITW4_KORVE          IEDLDWQRADELVHRNLTPLEDA------------------------------
KMO_DICDI             IEKIDLVLADQLIKKYLNK----------------------------------
D3B5G1_POLPP          INKIDLTKADNLIKQLLGK----------------------------------
KMO_CYTH3             IPDIEAAWPTEELKNKVITVTKKYI----------------------------
KMO_HUMAN             AISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR
A0A2I3FZG4_NOMLE      AISSTYLLMHYMSPRPFLCLRRPWNWIAHFRNTTCFPAKAMDSLEQISSLISR
G1M5X6_AILME          AIGSTYPCMCSMSLRPLHYFRRPWDWLTCFHKTTCFPANSMGSL---------
G1NTW3_MYOLU          AIGSTYFLIRSMAPRPLDYLRRPWDWVTNLQNTGHVSLKTPWSY---------
KMO_PIG               ALSTTYLLTGPTFRSSLGCLRRSWNSVTYFQNIGRISL---------------
KMO_MOUSE             AIGGTYLLVHHLSLRPLEFLRRPAWMGTTGYWTRSTDISLQVPWSY-------
KMO_RAT               AIGSAYILVHHLSPRPLELLR-SAWTGTSGHWNRSADISPRVPWSH-------
KMO_XENTR             SVGAAYLVIKYLPFNKYIEHVGNCLTHLKGNAYLSRLWAK-------------
F6UL58_XENTR          SVGAAYLVIKYLPFNKYIEHVGNCLTHLKGNAYLSRLWAK-------------
KMO_DANRE             AAGGTYVLVKNSHKLPSISAEQLWTRILALKLF--------------------
A9V478_MONBE          VGGAALAAWRYWRL---------------------------------------
KMO_CAEBR             LIGAAIGIYSNRGRLGL------------------------------------
KMO_CAEEL             LIGAAAGIYVNRGKLGL------------------------------------
KMO_ANOGA             VAAIGGLCYRHVTMGHLERLSTRILSTFQLLKPKASV----------------
W5JA14_ANODA          VATIATLGYRHVTVSALERLSTSVLSTLKLLKPSY------------------
KMO_AEDAE             VAAAGYFGYKYGNMDLVQHYSSSVLQLLKLK----------------------
KMO_DROME             IVTGGAIYAQRFL----------------------------------------
E9H0N5_DAPPU          -----------------------------------------------------
E0VU04_PEDHC          -----------------------------------------------------
F4P9F4_BATDJ          VLGVGVYALLRTPHVRKAIVSVLDY----------------------------
KMO_CANAL             VLGTAAVYGLVKLGQYWNRRQ--------------------------------
KMO_YEAST             TLGMLSIGGYKLFKFLTRERS--------------------------------
KMO_YARLI             LVGMGALFYYKGRHLFGRLFE--------------------------------
E3KV40_PUCGT          CSSVGLIATVLKFGRQLKYALQFD-----------------------------
A8NFR7_COPC7          LVGAGGVWAAWMLQRTLARR---------------------------------
KMO_CRYNJ             GVGAAGVFAATMAKKWLERR---------------------------------
KMO_ASPFU             VGVIAYVFWKKPRQYSPLSLLRYSWRRLSSIWVTMFRTIAYA-----------
KMO3_ASPNC            VMIGAGVLMRWPERLS-----------LGAVWRTVFGRN--------------
KMO_EMENI             LAVTGIYLWRQPTTRL-LSLASFRGALQGALQGALTGTA--------------
C0NXN8_AJECG          VGLGGFFCWKGMWLTR-----------LERLMKAFGKRAS-------------
KMO_NEUCR             MLAGGLFLWFRYKGALGRAAYGVFYNCMGMVCRTIHGRRR-------------
A7F691_SCLS1          -----------------------------------------------------
C7YWN5_NECH7          FFVTAAVFGYKYRRSLAHIIHGLRHLGDHA-----------------------
KMO2_ASPNC            VLVFGALGGAFLGLKR-------------------------------------
KMO1_ASPNC            FLLCLLSLRL-------------------------------------------
KMO_PHANO             IGSAALWLGRTGGLQQAKQNILRSICLLAQQAQKVTKG---------------
D5GNF0_TUBMM          GVMSGLWGANRLGLRKVG-----------------------------------
KMO_USTMA             VSAAAVGVYSTRALWQPVTVRCIARLHNS------------------------