CLUSTAL format seed alignment for MF_01972

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

T23O2_RALSO       ------------------------------------------------------MKPMSY
T23O_SORC5        -----------MRPVPGPSVFWGAGSRLPAPLVARAHRLLRTRRANPARGASRITKDMNY
D0LHK4_HALO1      ----------------------------------------------------MTRDVTTY
T23O_ANADE        -----------------------------------------------MTDPSAHSAALTY
T23O_HERA2        -----------------------------------------------------MSQALTY
T23O_BRADU        -------------MTSSDYDPAS-----------------------EGAETDF-SRRMSY
Q9RYH4_DEIRA      -----MSGEPSCPFGGPAPEHSA-----------------------EQAHRDF-SRSLSY
T23O_BURPS        -------MQP--PGDDAAPRCPFAGAHAPDAPHVPEAAGDDAQAGWHRAQLDF-SQSMSY
T23O1_RALSO       ------MSEPIQPTRPAASGCPMHGAQA---------------ESWHDAQMDF-SKSMSY
T23O_BORPE        -------------MQPTPTQRPEAIVHD------------------EKAQLDF-ARDMSY
T23O_PSEAE        -------------MCPCPHSQAQGETDG--------------EAEWHNAALDF-THAMSY
T23O_PSEFL        -------------MCPCPYMHQAKPQ------------------QWHDAKLDF-AESMSY
T23O_BACAN        -------------MKENEKVIME-----------------------KGIHTDF-KENMTY
Q81CK2_BACCR      ----------MANMKENEKVIME-----------------------KGIHTDF-KENMTY
T23O_CAUVC        ----------------------------------------------------M-AQDMTY
T23O_XANCP        -------------MPVDKNLRDLE----------------------PGIHTDL-EGRLTY
D7AZD8_NOCDD      -------------MLTTTAQQCPYAGGPGGAE-------AARSAGDDSPTLSF-DRATPY
D7BWH7_STRBB      -------------MRPNTHQPAS-------------------------------DGETPY
Q9X8R3_STRCO      -------------------------------------------MSHDAPNLDF-EGSTPY
D2AYJ2_STRRD      ---------MEVNNLKESLMTSTRQLSERERE-------TRAAANEGLPTLGF-DAATPY
B0T9I9_CAUSK      MTRKRILPQIRSPELELSLVRDIDASTDATRR-------ANVVQTGGEPIVAFAETSNPY
G1MAF5_AILME      --------------MSGCPFLGNNFGCAF---KKLSIEGNEEDESQTGVNRASKG-GLIY
H0WPN4_OTOGA      --------------MSGCPFLGNNLRYAF---QKLPVEGSEEDISQGGVNRASKG-GLIY
T23O_HUMAN        --------------MSGCPFLGNNFGYTF---KKLPVEGSEEDKSQTGVNRASKG-GLIY
G1R355_NOMLE      --------------MSGCPFLGNNFGYTF---KKLPVEGSEEDKSQTGVNRASKG-GLIY
T23O_BOVIN        --------------MSGCPFLGKSFGYAF---KPLSAQGSEEDKSQAGVNRASKG-GLIY
T23O_MOUSE        --------------MSGCPFAGNSVGYTL---KNVSMEDNEEDRAQTGVNRASKG-GLIY
T23O_RAT          --------------MSGCPFSGNSVGYTL---KNLSMEDNEEDGAQTGVNRASKG-GLIY
G1PKL2_MYOLU      --------------MSGCPFLRNDFEYDL---RKLSLEGNEEDKSQTGVNKASKG-GLIY
T23O_XENTR        --------------MSGCPFMGKKHHFNF---SELSLEDKNEDSSQEGLNKASKG-GLIY
T23OA_DANRE       --------------MSGCPYFQRKFLSTS---KQHLKE-EENDEAQTGINKASKG-GLIY
T23OB_DANRE       --------------MSGCPFLGGTLQLLS---SNPRQA-EEEDGSQGGVNKAAKG-GIIY
T23O_AEDAE        ---------------MSCPVGNH-----------------NGDP-QGGQRLGSEA-GMLY
T23O_ANOGA        ---------------MSCPMRSG-----------------FVDSVQGGHHLGSEA-GMLY
T23O_DROME        ---------------MSCPYAGN-----------------GNDHDDSAVPLTTEV-GKIY
T23O_DROPS        ---------------MSCPYAGN-----------------GNDHDDAAVPLSTEV-GKIY
E0VBN6_PEDHC      -----------MVYLFICIFKEK-----------------YIDSGQDGECLGEQS-GMLY
E9G9M1_DAPPU      -------------------------------------------------MAEHST-GMMY
T23O_CAEBR        ---------------MACPYMNGGDTLPH---RVTFME--GGEECQQGVNKVEMGFGQTY
T23O_CAEEL        ---------------MACPYLGSG-ELTH---RVTFME--GGEECQQGVNKVEMGFGQTY
T23O_DICDI        --------------MSGCQFNQPYCPRSE-EKKSIAESIEKATLMEPSIDAQSAQKGVYY
F0ZW87_DICPU      --------------MSGCQFHQPYVNNNENEKKTIAESIEKATLMDPALDAHKAQKGVYY
                                                                             *

T23O2_RALSO       WDYIKVEELLALQGGANGD-ETQVGNDEALFIVVHQVYELWFKLILRELTFARDLLRQDT
T23O_SORC5        WDYIHVEELLALQGGFDDD-EQKVGNDEALFIVVHQIYELWFKLILRELTSARELFRQNP
D0LHK4_HALO1      WDYIKVEELLGLQTGLGDD-EGTLSNDEVMFIVVHQIDELWFKLTLRELASVRALFAQEH
T23O_ANADE        GSYLALDELLAAQRPRSE------EHDELLFIVVHQVYELWFKQVVHELTWLQERLHRG-
T23O_HERA2        ASYLKIDELLNLQTPRSHG-P---EHDELLFIVIHQVYELWFKQILHELDYLCDLLRAN-
T23O_BRADU        GDYLALDAILGAQHPLSE------AHDEMLFIIQHQTTELWMRLAIHELSAARRAIARD-
Q9RYH4_DEIRA      GDYLHLDELRSAHQPITD------AHDEHLFIAIHHVSEVWLSLIVRELQAAMRLLDAG-
T23O_BURPS        GDYLSLDPILDAQHPRSP------DHNEMLFIIQHQTSELWMKLALYELRAALASIRDD-
T23O1_RALSO       GDYLALDQILNAQHPRSP------DHNEMLFIVQHQTTELWMKLMLHELRAARDCVRND-
T23O_BORPE        GDYLHLDELLGAQHPLSP------EHNEMLFIVQHQTSELWMKLMLHELRAAIAAIQQD-
T23O_PSEAE        GDYLKLDKVLDAQFPLSP------DHNEMLFIIQHQTSELWMKLMLHELRAAREHVKSG-
T23O_PSEFL        GDYLGLDKVLDAQVPRSQ------QHNEMLFIIQHQASELWMKLLLHELRHARQLIDQG-
T23O_BACAN        GEYLQLDSLLSSQKRLSD------HHDEMLFIVIHQASELWMKLILHELNAAIESIKQD-
Q81CK2_BACCR      GEYLQLDSLLSSQKRLSD------HHDEMLFIVIHQASELWMKLILHELNAAIEFIKQD-
T23O_CAUVC        ARYLALDELLSAQKPLSD------RHDELLFIVIHQTKELWLKEILHEVALALKLIAGG-
T23O_XANCP        GGYLRLDQLLSAQQPLSEP-A---HHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRD-
D7AZD8_NOCDD      VDYAGIDTLLSLQKPRTA------EPAEPSFIIATQVMELLFALVRERWEAARDALEAD-
D7BWH7_STRBB      AAYARMDTLLSLQHPRTG------AETEPGFIILSQVKELLFKLCHTEFSTARDHLAAD-
Q9X8R3_STRCO      EDYVKADVLTHLQHTLSD------DPGEMVFLVTTQVMELWFTVIVHEWETAARALRED-
D2AYJ2_STRRD      DDYVGTATLHRLQRTVTD------APEELAFLVTTQVMELYFGLLRSEWQLAQRQLDDD-
B0T9I9_CAUSK      IDFHRNDVLHSLQHMRTE------AYDEFPFIVMTQVKELIFRSIHYELANIQQRIRDD-
G1MAF5_AILME      GNYLHLEKVLNAQELQSEI-KGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQSGH
H0WPN4_OTOGA      GNYLHLEKILHAQELQSEI-KGNKIHDEHLFIVTHQAYELWFKQILWELDSVREIFQSGH
T23O_HUMAN        GNYLHLEKVLNAQELQSET-KGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGH
G1R355_NOMLE      GNYLHLEKVLNAQELQSET-KGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGH
T23O_BOVIN        GNYLQLEKVLNAQELQSEM-KGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGH
T23O_MOUSE        GNYLQLEKILNAQELQSEV-KGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGH
T23O_RAT          GDYLQLEKILNAQELQSEI-KGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGH
G1PKL2_MYOLU      GNYLHLEKILNAQELQSEL-KGNKIHDEHLFIITHQAYELWFKQILWELDSVCEIFQNGH
T23O_XENTR        GDYLQLDKVLNAQELQSEK-KGNKIHDEHLFIVTHQAYELWFKQILWELDSVREIFQNGH
T23OA_DANRE       GDYLQLDKIVTSQVLQSEL-KGNKIHDEHLFIVTHQAYELWFKQVLWELDSVREIFISGH
T23OB_DANRE       GDYLQLDKVLNAQVLQSEQ-KGNKIHDEHLFIVTHQAYELWFKQILWELDSVRDLFIKKH
T23O_AEDAE        GEYLMLDKVLSAQRMLSVE-SNKPVHDEHLFIVTHQAYELWFKQIIFELDSIRSLFS-TE
T23O_ANOGA        GEYLMLDKVLSAQRMLSVE-GKKPVHDEHLFIVTHQAYELWFKQIIFELDSIRDLFS-TE
T23O_DROME        GEYLMLDKLLDAQCMLSEE-DKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLD-AE
T23O_DROPS        GEYLMLDKLLDAQCMLSTE-DKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLD-AE
E0VBN6_PEDHC      GEYLQLEKILNAQTLLSEQ-HNRTVHDEHLFIITHQAYELWFKQIIWEVDSVRNLFGFSE
E9G9M1_DAPPU      GEYLQLDKILDGQRLMSEQLGSETVHDEHLFIVTHQAYELWFKQILYELDSVREMFS-NE
T23O_CAEBR        PEYLQLDKILTAQKLKSEA-DGQRVDDEHLFIVIHQAHELWFKQIIFDLDIVRKLLN-NT
T23O_CAEEL        SEYLQLDKILTAQRLKSEA-DGQRVDDEHLFIVIHQAHELWFKQIIFDLDNVRKLLN-NT
T23O_DICDI        GSYLKLDELLNIQECESVK-VGAPAHEEMLFIIIHQTYELWFKQMIHEIDSIRSIMS-TP
F0ZW87_DICPU      GSYLKLNELLGIQNLESVK-AGQPAHEEMLFIIIHQTYELWFKQIIHEIDSIRNIMS-TP
                    :     :   :              *  *:   :  *: :             .    

T23O2_RALSO       VPGH-QIALGVRSLRRAIAVFEQANQHFRVMETMTARDFLDFRERLMPASGFQSAQLREI
T23O_SORC5        VPDQ-KLASAARSFRRVVTIFEQAIEHFRVMETLTTRDYLDFRDRLIPASGFQSAQLREI
D0LHK4_HALO1      VREQ-SLSSAVRGIRRAALLFEQTAGHFALMETMTTRDYLAFRDKLSPASGFQSAQMREI
T23O_ANADE        -----EGGHALATLKRVLTILKTVVAQVDVIETMTPRQFTAFRSRLEAASGFQSAQFRVL
T23O_HERA2        -----DTGRANQSIRRILTILKTIVAQVDVMETMTPLQFNAFRGSLESASGFQSLQFREI
T23O_BRADU        -----EVQPAMKMLARMSRIFEQLNNAWDVLRTMTPSEYTRFRSQLGQSSGFQSRQYRLI
Q9RYH4_DEIRA      -----ITDAPLKMLTRVVRAQEQLTAAWDVLKTMTPADYLQFRGAFGQASGFQSQNYRMV
T23O_BURPS        -----ALPPAFKMLARVSRVLEQLVQAWNVLATMTPSEYSAMRPYLGASSGFQSYQYREL
T23O1_RALSO       -----DLPPAFKMLARVSRIMDQLVQAWNVLATMTPPEYSAMRPHLGQSSGFQSYQYREI
T23O_BORPE        -----RLQPAFKMLARVSKILEQLVSAWDVLATMTPPEYSALRPYLAHSSGFQSYQYRQI
T23O_PSEAE        -----KLGPALKMLARVSRIFDQLVHAWAVLATMTPTEYNTIRPYLGQSSGFQSYQYREI
T23O_PSEFL        -----QLAGSHRVLARVLRIMEQMVSSWAILATLSPMEFISFRSDLGNASGFQSYQYREI
T23O_BACAN        -----KLQPAFKMLARVSKIQSQIIQSWDILATLTPSEYIEFRDSLGQASGFQSYQYRMI
Q81CK2_BACCR      -----KLQPAFKMLARVSKIQSQIIQSWDILATLTPSEYIEFRDSLGQASGFQSYQYRMI
T23O_CAUVC        -----DVEPAYKALARVSRIQTVMTLSWDILATMTPADYLSFRDDLGTSSGFQSHQFRAL
T23O_XANCP        -----EVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYI
D7AZD8_NOCDD      -----DVPEALAWLRRARNAQDVLNDSWGLLADMTPTEFNRFRDSFGEASGFQSYGYRKL
D7BWH7_STRBB      -----RLDEVLWTLRRARRVQQLLLSCWDALGALTPGEFASFRDALGPASGFQSGMYRRL
Q9X8R3_STRCO      -----RTPVATDALKRSVRELEALNASWTPLAGLTPAQFNSYRSALGEGSGFQSAMYRRL
D2AYJ2_STRRD      -----DAATATVTIKRTVRHFEALNAAWASLSWLTPAQFNQFRDALGEASGFQSALYRHV
B0T9I9_CAUSK      -----DLTGALVLAPRLRRCLELLVKTWDVLSTITTQGFNAFRDQLGTSSGQQSYAYRHV
G1MAF5_AILME      VRDERNMLKVVTRMHRVVVILKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLL
H0WPN4_OTOGA      VRDERNMLKVVTRMHRVTVILKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLL
T23O_HUMAN        VRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLL
G1R355_NOMLE      VRDERNMLKIVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLL
T23O_BOVIN        VRDERNMLKVITRMHRVVVILKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLL
T23O_MOUSE        VRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLL
T23O_RAT          VRDERNMLKVMTRMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLL
G1PKL2_MYOLU      VRDERNMLKIVTRMHRVVVILKLLVEQFSVLETMTALDFNDFREYLSPASGFQSLQFRLL
T23O_XENTR        VRDERNMLKVVTRIHRISMILKLLVEQFSVLETMTAMDFFDFRDYLSPASGFQSLQFRLL
T23OA_DANRE       VRDERNMLKVNTRIHRIVMIFRLLLDQFAVLETMTALDFYDFREYLSPASGFQSLQFRLL
T23OB_DANRE       VRDERNMLKVVSRIHRITMIFKLLVDQFAVLETMTALDFFDFREYLSPASGFQSLQFRLL
T23O_AEDAE        HMEESRTLEILKRLNRIVMILKLLVDQVPILETMTPLDFMDFRDFLSPASGFQSLQFRLL
T23O_ANOGA        HIEESRTLEILKRLNRIVMILKLLVDQVPILETMTPLDFMDFRDYLSPASGFQSLQFRLL
T23O_DROME        VIDETKTLEIVKRLNRVVLILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLI
T23O_DROPS        VIDETKTLEIVKRLNRVVLILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLI
E0VBN6_PEDHC      TVDEGKTLEILKRLNRIVLILKLLVDQVMILETMTPLDFMEFRDYLSPASGFQSLQFRLL
E9G9M1_DAPPU      EIEERKMLEVLKRMNRIVLIWKLLRDQVMILETMTPLDFMEFREYLTPSSGFQSLQFRLL
T23O_CAEBR        IVDETKTLKIVSGLDRIVKILSLLTEQITLLDTMSPLDFVDFRKYLTPASGFQSLQFRIL
T23O_CAEEL        IVDETKTLKIVSGLDRMTKILSLLTEQITLLDTMSPLDFVDFRKYLTPASGFQSLQFRVL
T23O_DICDI        PTPERLNGVIVNRLGRITEIQKLLVDQISILETMTSVDFLEFRNLLVPASGFQSVQFRMI
F0ZW87_DICPU      PTPERLNGVIVNRLQRVTEIQKLLVDQISILETMTSVDFLEFRNLLVPASGFQSVQFRMI
                                 *              :  ::.  :   *  :  .** **   * :

T23O2_RALSO       EILLGLEDNERIAVCQGGSFKDALKLPNGALSSAAYRVEAREAHGQSLKHCLYAWLSRIP
T23O_SORC5        ELLLGLDDALRIPLGREGSYKEALKTADGAPSAATRRVEARLASGPSLKHFLDEWLSRTP
D0LHK4_HALO1      EILLGLPENERMALGHE-TYMQALRDPDGGETAASLRVQARQRDTPTVRAAIEEWLYRTP
T23O_ANADE        EAMLGR--------------RDDRMLAPYPPDGPGYARIAAAMAAPSLFDSLLRYLATQG
T23O_HERA2        EFVLGY--------------KRPAILQHFAA-LPSHERLEQRYQEPSLWDSFLHYLQLNG
T23O_BRADU        EYLLGN--------------RNHAMLKPHAHDAEVTKLLEAELATPSLYDEVLRLADRNG
Q9RYH4_DEIRA      EFLLGN--------------RNSTLLRPHEHRADLHRPLAAALHAPSVYDLTLRLLAARG
T23O_BURPS        EFILGN--------------KNAQMLRPHAHRPAIHAHLEASLQAPSLYDEVIRLLARRG
T23O1_RALSO       EFILGN--------------KNAAMLQPHAHQPEHYAQVKAALETPSLYDEAIRYMARHG
T23O_BORPE        EYLLGN--------------KNAAMLQPHAHRADLLAQVRAAFEAPSLYDEALRFLARSG
T23O_PSEAE        EFILGN--------------KNATLLKPHAHRAELLAALEQALHTPSLYDEAIRLMAAQG
T23O_PSEFL        EFIFGN--------------KNRAMLLPHQHTPQIAKNLEQCLHTPSLYDAIIQQMTRQD
T23O_BACAN        EYALGY--------------KTPHALKIYEKDPELHARLHTALHAPSLYNVAIQALVKEG
Q81CK2_BACCR      EYALGY--------------KTPHALKIYEKDPELHARLHKALHAPSLYDVAIQALVKEG
T23O_CAUVC        EYLLGL--------------KDQSFLKFHTERPEALAMLKSALESPSLYDVAIAQLPRHG
T23O_XANCP        EFLLGN--------------KNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFG
D7AZD8_NOCDD      EFLLGN--------------KSAAMIRPHKAMDGVADDLTALLERPGLYDAALRLLHRRG
D7BWH7_STRBB      EFLLGN--------------KNPQLLEPHRNTSRYGEVLAQLYE-PSLYDEAIRHLARRG
Q9X8R3_STRCO      EFLLGD--------------KSASMLVPHRGAPRVHAELEKALHEPSLYDEVVRLLARRG
D2AYJ2_STRRD      EFLLGN--------------KSEALIRPHRRNPEAYSELAEALARPSLYDSVLAFLARQG
B0T9I9_CAUSK      EFILGN--------------KSRRLAAAHANNPDVYPAIAEALNSPSLYDDAIALLHRRG
G1MAF5_AILME      ENKIGVLQSLR------VPYNRRHYRDNFKGEDNELLLK--SEQEKTLLQLVEAWLERTP
H0WPN4_OTOGA      ENKIGVLQSLR------VPYNRRHYRDNFKGEDNELLLK--SEQEKTLLQLVEAWLERTP
T23O_HUMAN        ENKIGVLQNMR------VPYNRRHYRDNFKGEENELLLK--SEQEKTLLELVEAWLERTP
G1R355_NOMLE      ENKIGVLQNMR------VPYNRRHYRDNFKGEENELLLK--SEQEKTLLELVEAWLERTP
T23O_BOVIN        ENKIGVLQSLR------VPYNRRHYRDNFRGKDNELLLK--SEQERTLLQLVEAWLERTP
T23O_MOUSE        ENKIGVLQSLR------VPYNRKHYRDNFGGDYNELLLK--SEQEQTLLQLVEAWLERTP
T23O_RAT          ENKIGVLQSLR------VPYNRKHYRDNFEGDYNELLLK--SEQEQTLLQLVEAWLERTP
G1PKL2_MYOLU      ENKLGIFQSLR------VPYNRRHYRDNFKGEENELLLK--SEQDKTLLQLVEAWLERTP
T23O_XENTR        ENKIGVPEILR------VPYNRRHYRDNFKGETNELLLK--SEQELTLLGLVEAWLERTP
T23OA_DANRE       ENKIGVPHNQR------VPYNRRHYRDNFRDQESELLLH--SEQEPTLLQLVEQWLERTP
T23OB_DANRE       EQKIGVADHLR------VPYNRRHYRDNFHGEESETLLS--SEQEPTLLQLVEQWLERTP
T23O_AEDAE        ENKLGVKTEHR------VKYNQ-KYSEVFASDPCAIERLSITESEPSLADLVQKWLERTP
T23O_ANOGA        ENKLGVKSEHR------VKYNQ-KYTEVFASDPGAIERIGTTETEPSLADLVQKWLERTP
T23O_DROME        ENKLGVLTEQR------VRYNQ-KYSDVFS-DEEARNSIRNSEKDPSLLELVQRWLERTP
T23O_DROPS        ENKLGVLTEQR------VRYNQ-KYSDVFGGDEQALSAIRSSEYEPSLLELVQRWLERTP
E0VBN6_PEDHC      ENKLGVKLDHR------MRYSQ-RYSKVFDRDPEAVAAIKKSETEPSLGKLVESWLERTP
E9G9M1_DAPPU      ENKLGIRQEHR------VRYNQSNYIKVFGNDKAAMIELERSESEPSLCELVQKWLERTP
T23O_CAEBR        ENKLGVKQERR------IKYNAQHYKNVFNDDDLKALNT--TEDEKSLLTLIESWLERTP
T23O_CAEEL        ENKLGVRQERR------IKYNAQHYKNVFNDTDLKTLNV--TEEEKSLLTLIESWLERTP
T23O_DICDI        ENKLGILPNTR------VQYQQHHYHSFFNEKDRKALQA--TENEVSLLQLVIQWLERNP
F0ZW87_DICPU      ENKLGILPQTR------VQYQQHHYSSFFNEDDRKKLSD--TENETSLLQLVIQWLERNP
                  *  :*                                          :            

T23O2_RALSO       IDGSN-----EPAAVKRFLRDYIGSVRAESQRRLQTAIDRQLAPAEVERLRARYQADDVG
T23O_SORC5        IDGSS-----EPEGVVGFLRSYTRSMRQENERRVQMAIDKALTPPDVERLRARYEAESAA
D0LHK4_HALO1      IDGFTPDSEGDAEAVAAFIDSYLEAHRRELAGIQARAVASALTEADRTRLGERYERELAS
T23O_ANADE        FETPV-------------------------------------------------------
T23O_HERA2        YAIPS-------------------------------------------------------
T23O_BRADU        LTMPA-------------------------------------------------------
Q9RYH4_DEIRA      LPVPA-------------------------------------------------------
T23O_BURPS        FPIAP-------------------------------------------------------
T23O1_RALSO       FAFDA-------------------------------------------------------
T23O_BORPE        LAVPA-------------------------------------------------------
T23O_PSEAE        LPVSQ-------------------------------------------------------
T23O_PSEFL        LPICA-------------------------------------------------------
T23O_BACAN        FPIHK-------------------------------------------------------
Q81CK2_BACCR      FPIHK-------------------------------------------------------
T23O_CAUVC        LTVPD-------------------------------------------------------
T23O_XANCP        HAIPQ-------------------------------------------------------
D7AZD8_NOCDD      LPVPE-------------------------------------------------------
D7BWH7_STRBB      LDIPP-------------------------------------------------------
Q9X8R3_STRCO      YDIPD-------------------------------------------------------
D2AYJ2_STRRD      YAIPR-------------------------------------------------------
B0T9I9_CAUSK      FVIPQ-------------------------------------------------------
G1MAF5_AILME      GLEPHG--------------FNFWGKFENNIVKGLEEEFIKIQAKE--ESEEKEEQMAEF
H0WPN4_OTOGA      GLEPHG--------------FNFWGKFEKNIVKGLEEDFIRIQARE--ESEEKEEQMAEF
T23O_HUMAN        GLEPHG--------------FNFWGKLEKNITRGLEEEFIRIQAKE--ESEEKEEQVAEF
G1R355_NOMLE      GLEPHG--------------FNFWGKLEKSITRGLEEEFIRIQAKE--ESEEKEEQVAEF
T23O_BOVIN        GLEPHG--------------FNFWGKLEKNIVKGLEEEFTKIQAKE--ESEEKEEQMAEF
T23O_MOUSE        GLEPNG--------------FNFWGKFEKNILKGLEEEFLRIQAKT--DSEEKEEQMAEF
T23O_RAT          GLEPHG--------------FNFWGKFEKNILKGLEEEFLKIQAKK--DSEEKEEQMAEF
G1PKL2_MYOLU      GLEKHG--------------FNFWEKLEKNIVKGLEEEFSMIQAKN--ESEEKEEQMAEF
T23O_XENTR        GLEEEG--------------FHFWGKLEANIFRGLEEELQTVKTKP--DSEEKEEQLAEL
T23OA_DANRE       GLEEDG--------------FNFWGKLEKNIFEGLRREKEHIEQKP--ASERKEEMLAEL
T23OB_DANRE       GLEKDG--------------FNFWGKLQANIEEGLKREKHQVEKME--DTEVKQELLEDL
T23O_AEDAE        GLETNG--------------FNFWGKFEESVEQLLADQEASAMEEE--HENVKNYRLMDI
T23O_ANOGA        GLEQDG--------------FNFWGKFQESVEQLLAEQEASAMSEE--HENVREYRLMDI
T23O_DROME        GLEESG--------------FNFWAKFQESVDRFLEAQVQSAMEEP--VEKAKNYRLMDI
T23O_DROPS        GLEESG--------------FNFWKKFQQSVDQFLAAQVEIAMEEP--VEQAKNYRLMDI
E0VBN6_PEDHC      GLETEG--------------FNFWKKYKDAVDRMLMNQSEAADKIT--NEDEKKRSQSDV
E9G9M1_DAPPU      GLDEEHP-------------SNFWTQYQETVEALIRDQQKEAEVTT--DESLKVHLLNEC
T23O_CAEBR        GLKSTSED------------EGFWSKYESSVNKYLSDLAKQAEDPSN-TEEIKKQLRAEY
T23O_CAEEL        GLKSTSED------------EGFWIKYEKSVNKYLADLAKQAADPSN-TEEIAKQLTAEY
T23O_DICDI        FLYYKG--------------YDFWSSYKSAVDQILENDLQRIQANNDLSQDMKDQSTKEA
F0ZW87_DICPU      FLYNKG--------------YDFWSSYKSAVDKILENDLARIQSNTELTQDMKDQSTKEA
                                                                              

T23O2_RALSO       AETFLLAEEDPQAD-------AMTREKRRAVRAAMLFVESYRELPQLAWPRELLESILEL
T23O_SORC5        AEAFLLAEDDPAAD-------AATREKRRAVRAAIVFIESYRELPRLAWPREVLDRILEM
D0LHK4_HALO1      ARAWLEGRDVSAAHDDSEGTIERTRARRSRIRAALVFIESYRELPLLAWPREVLDAIVAL
T23O_ANADE        --------VPEPRP--------AGWRQ-PSEAVQRVLLEVYRADG---EAALVCERFVDL
T23O_HERA2        --------EQIGRD--------VTQSLVASPAIQTILITVYRQNP---LVSNLCERLIDL
T23O_BRADU        --------AVLSRD--------VRETHSFNEGVLQAWRVVYEAPETHWMLYELAEKLVDF
Q9RYH4_DEIRA      --------EVLQRD--------YAQPYQTNEAVLASWLSVYCDTETYWDLYELAEKLVDV
T23O_BURPS        --------ERLDAD--------WTQPTRHDRTVEAAWLAVYREPNAHWELYEMAEELVDL
T23O1_RALSO       --------DCIERD--------WSRPVTYNASVEAAWLEVYRDPTHHWELYELAEKFVDL
T23O_BORPE        --------GALQRD--------WTQPYRADDQVEQAWLTVYRQSERYWNQYQLGEKLTDL
T23O_PSEAE        --------ERLARD--------AAAGTCYEASVEAAWRQVYQAPERYWDLYQLAEKLIDL
T23O_PSEFL        --------LRLDAD--------PSEPTRSDASVEAAWVQVYRQPERYWDLYQLGEKLMDI
T23O_BACAN        --------DVLNRD--------ITQPYEEDATVEAAWLEVYADVKKYWNLYQLAEKLIDI
Q81CK2_BACCR      --------DVLNRD--------ITQPYEEDATVEAAWLEVYADVKKYWNLYQLAEKLIDI
T23O_CAUVC        --------AALHRD--------FSQTYVPSPEVEAAWLEVYRDPKRYWELYQLAEKLVDL
T23O_XANCP        --------QYQARD--------WTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDV
D7AZD8_NOCDD      --------DRVERD--------WTLPYEASPAVEEAWKAVYAHDVPGNELFLLAEALLDV
D7BWH7_STRBB      --------VHADRD--------FSLPYQPDEKVAAAWRLIYEQPGRHPGLFLLAEALMDT
Q9X8R3_STRCO      --------AVLQRD--------LTRKYEAAPEVEAAWTAVYSGD-QNGELARLGEALTDV
D2AYJ2_STRRD      --------EAVERD--------YAADYEPRSDVEAVWAEVYGG-----PLAPLAEALTDL
B0T9I9_CAUSK      --------DRLERD--------WAEDYAPSPAVAAAWLAVYDTPTPENDLYQLGEMLIEI
G1MAF5_AILME      QKQKEVLLSLFDEKRHEHLYSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDI
H0WPN4_OTOGA      QKQKEVLLSLFDEKRHDHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDI
T23O_HUMAN        QKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDI
G1R355_NOMLE      QKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDI
T23O_BOVIN        QKQKEVLLSLFDEKRHEHLLSKGERRLSYKALQGALMIYFYREEPRFQVPFQLLTFLMDV
T23O_MOUSE        RKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDI
T23O_RAT          RKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDI
G1PKL2_MYOLU      HKQKEVLLLLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVAFQLLTSLMEI
T23O_XENTR        QKQKELFGALFDERRHEHLLSKGERRLSYKALKGALMIYFYREEPRFQVPFQLLTSLMDI
T23OA_DANRE       IKQRDIFLSLFDEKRHDHLVSTGQRRLSYKALQGALMIYFYREEPRFQVPFQLLTSLMDI
T23OB_DANRE       NKQMETFTALFDSKRHEHLLSKGERRLSYKALQGALMINFYREEPRFQVPFQLLTALMEI
T23O_AEDAE        EKRREVYKSIFDASVHDALVARGDRRFTHRALQGAIMITFYRDEPRFSQPHQLLMLLMDI
T23O_ANOGA        DKRREVYKSIFDAQVHDALVARGERRFTHKALQGAIMITFYRDEPRFSQPHQLLMLLMDI
T23O_DROME        EKRREVYRSIFDPAVHDALVRRGDRRFSHRALQGAIMITFYRDEPRFSQPHQLLTLLMDI
T23O_DROPS        EKRREVYHSIFDPAVHEALVKRGDRRFSHRALQGAIMITFYRDEPRFSQPHQLLTLLMDI
E0VBN6_PEDHC      ERKKEMFASVFDKQIHDAFVLKGERRFSHKALQGAIMITFYRDEPRFSQPHLLLTLLMDI
E9G9M1_DAPPU      QKKKELFDSIFDVDIHNALVARGERRFSHKALQGAIMITFYRDEPRFNQPHQLLSILMDI
T23O_CAEBR        SKTSDAFQSILDPRQHEQHIRNGNRLLSHDATKGAMMIYFYRDMPRFSQPYQILTFLMDI
T23O_CAEEL        HKTADAFQSILDPRQHEQHIRNGNRLLSHDATKGAMMIYFYRDMPRFSQPYQILTFLMDI
T23O_DICDI        KKNMESFSTLFDEVAYNERLEKGEVRLSYKALQSAILIYLYKDEPIFHTPFLILNLLTEI
F0ZW87_DICPU      QKNMESFSTLFDEKTYNSKLEKGEVRLSYKALQSAILIFLYKDEPIFHTPFLILNLLTEI
                                                          *           :   :   

T23O2_RALSO       EQSMLIWRQRHARMVERIIGR-RVGTGGSSGVDYLD-QTALRYRVFTDLWTVRSLLLRKS
T23O_SORC5        EQAMLIWRQRHARMVERVIGR-RTGTGGSAGVDYLD-QTALRYRVFGDLWTVRSLLLRKP
D0LHK4_HALO1      EQAFTIFRQRHARMVERVIGR-RTGTGGSAGVDYLD-RTALTYRVFRDIWATRTVLLRES
T23O_ANADE        DEGVQEWRYRHVKMVERTIGD-KPGTGGSAGARYL--RSTLFTPAFPDLWAVRGAL----
T23O_HERA2        DEGFQEWRYRHVKMVERTIGM-KQGTGGSSGAAYL--ASTI-KPFFPDLWAIRADL----
T23O_BRADU        EDYFRRWRFNHVTTVERVIGF-KRGTGGTGGVSYL--KRMLEVELFPELWRVRTIL----
Q9RYH4_DEIRA      EDNFRRWRFNHLTTVERTIGF-KRGSGGTSGVGYL--RGALDVVLFPELWDVRTQL----
T23O_BURPS        EDAFRQWRFRHVTTVERIIGF-KQGTGGTSGAPYL--RKMLDVVLFPELWHVRTTL----
T23O1_RALSO       EDAFRQWRFRHVTTVERVIGF-KRGTGGTEGVNYL--RKMLDVVLFPELWKLRTDL----
T23O_BORPE        EDAFRLWRFRHVTTVERIIGF-KRGTGGTSGVTYL--RKMLEVVLFPEIWKLRTDL----
T23O_PSEAE        EDSFRQWRFRHVTTVERIIGF-KPGTGGTEGVGYL--RSMLDTILFPELWRLRSNL----
T23O_PSEFL        EDAFRQWRFRHVTVVERVIGF-KKGTGGTEGVEYL--RKMLGTVLFPELWSLRSSL----
T23O_BACAN        EDWLQQWRFRHMKTVERIIGH-KMGTGGSSGVSYL--KRVLDQRFFPELWNVRTKL----
Q81CK2_BACCR      EDWLQQWRFRHMKTVERIIGH-KMGTGGSSGVSYL--KRVLDQQFFPELWNVRTKL----
T23O_CAUVC        DDALVTWRHKHVLTVERIIGG-RPGTGGTDGVGYL--ASTLRRRAFPELWSLRTKL----
T23O_XANCP        ETQFQLWRFRHMRTVMRVIGF-KRGTGGSSGVGFL--QQALALTFFPELFDVRTSVGVDN
D7AZD8_NOCDD      AERVTRWRQRHLVAVKRTLGG-RPGSGGSNGLRWL--ARNAEQDVFPELWSLRSTV----
D7BWH7_STRBB      ADLFARWRYTHLVTVQRLLGN-RPGTGGTEGSPWL--AAIAEHRFFPELWSIRSTGE---
Q9X8R3_STRCO      AELVWRWRNDHLVATRRAMGS-KTGTGGSAGVAWL--EKRARNNVFPELWTARSYV----
D2AYJ2_STRRD      ATQFSDWRYRHLMAVRRSMGA-KPGSGGSSGLSWL--ERSMRREIFPELWTARTLM----
B0T9I9_CAUSK      DDLFSQFRWRHFVSVQRILGL-KPGTGGSAGVGWL--RAAVDLRFFPELWSIRTEMGA--
G1MAF5_AILME      DTLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYQYLRSTVSDRYKVFVDLFNLSTYLVPRH
H0WPN4_OTOGA      DTLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYMVPRH
T23O_HUMAN        DSLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRH
G1R355_NOMLE      DSLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRH
T23O_BOVIN        DSLMTKWRYNHVCLVHRMLGS-KAGTGGSSGYQYLRSTVSDRYKVFVDLFNLSTYLVPRH
T23O_MOUSE        DTLMTKWRYNHVCMVHRMLGT-KAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRH
T23O_RAT          DTLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYYYLRSTVSDRYKVFVDLFNLSSYLVPRH
G1PKL2_MYOLU      DTLMTKWRYNHVCLVHRMLGS-KAGTGGSSGYQYLRSTVSDRYKVFVDLFNLSTFLIPRH
T23O_XENTR        DTLMTKWRYNHVCMVHRMIGS-KAGTGGSSGYQYLRSTVSDRYKVFVDLFNLSTYLVPRH
T23OA_DANRE       DTLMTKWRYNHVCMVHRMIGS-KDGTGGSSGYQYLRSTVSDRYKVFVDLFNLATFLIPRD
T23OB_DANRE       DTLMTKWRYNHVCMVHRMIGS-KAGTGGSSGYHYLRSTVSDRYKVFVDLFNLATFLVPRS
T23O_AEDAE        DSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFIDLFNLSTFLIPRG
T23O_ANOGA        DSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFLIPRQ
T23O_DROME        DSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFLIPRE
T23O_DROPS        DSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFLIPRE
E0VBN6_PEDHC      DSLITKWRYNHVIMVQRMIGSLQLGTGGSSGYQYLKSTLSDRYKVFLDLFNLSTFLIPRN
E9G9M1_DAPPU      DSLITKWRYNHVMLVQRMIGSQRIGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFILPRK
T23O_CAEBR        DSLFTKWRYNHVLLVQRMLGA-KQGTGGSSGYMYLRSTVSDRYKVFLDLFNLSTWLIPRE
T23O_CAEEL        DSLFTKWRYNHVLLVQRMLGA-KQGTGGSSGYMYLRSTVSDRYKVFLDLFNLSTWLIPRE
T23O_DICDI        DELLTMWRFRHTMMVQRIIGA-KIGTGGSSGYHYLRTTVGDRYKIFLDLFNISSYLIPKN
F0ZW87_DICPU      DEQLTLWRFRHTMMVQRIIGA-KIGTGGSSGYHYLRTTVGDRYKIFLDLFNISSYLIPKN
                     .  :*  *   . * :*  : *:**: *  :*          * :::          

T23O2_RALSO       SVPPIRQGASYAFAEEALV--------------------------------
T23O_SORC5        SVPEIEHASDYGFRVEDSP--------------------------------
D0LHK4_HALO1      ALPPLVHADYYGFAGSGA---------------------------------
T23O_ANADE        ---------------------------------------------------
T23O_HERA2        ---------------------------------------------------
T23O_BRADU        ---------------------------------------------------
Q9RYH4_DEIRA      ---------------------------------------------------
T23O_BURPS        ---------------------------------------------------
T23O1_RALSO       ---------------------------------------------------
T23O_BORPE        ---------------------------------------------------
T23O_PSEAE        ---------------------------------------------------
T23O_PSEFL        ---------------------------------------------------
T23O_BACAN        ---------------------------------------------------
Q81CK2_BACCR      ---------------------------------------------------
T23O_CAUVC        ---------------------------------------------------
T23O_XANCP        RPPQGSADAGKR---------------------------------------
D7AZD8_NOCDD      ---------------------------------------------------
D7BWH7_STRBB      ---------------------------------------------------
Q9X8R3_STRCO      ---------------------------------------------------
D2AYJ2_STRRD      ---------------------------------------------------
B0T9I9_CAUSK      ---------------------------------------------------
G1MAF5_AILME      WIPKMNPIIHKFLYTAEYCDSSYFS--SDESD-------------------
H0WPN4_OTOGA      WLPKMNPTIHKFLYTAEYCDSSYFS--SDDSD-------------------
T23O_HUMAN        WIPKMNPTIHKFLYTAEYCDSSYFS--SDESD-------------------
G1R355_NOMLE      WIPKMNPTIHKFLYTAEYCDSSYFS--SDESD-------------------
T23O_BOVIN        WIPKMNPVIHKFLYTAEYCDSSYFS--SDESD-------------------
T23O_MOUSE        WVPKMNPIIHKFLYTAEYSDSSYFS--SDESD-------------------
T23O_RAT          WIPKMNPIIHKFLYTAEYSDSSYFS--SDESD-------------------
G1PKL2_MYOLU      WIPKMNPITRKFLYTTEYCDSSYFS--SEESD-------------------
T23O_XENTR        WVPRLNPSIHKFLYTAECCDSSYFS--SDDSD-------------------
T23OA_DANRE       WVPKLDPSEHTFLYMAECCDSSYCS-SSDDSD-------------------
T23OB_DANRE       WVPKLNPNIHKFPYTAECYDSSYNSCSSEDSD-------------------
T23O_AEDAE        SIPPLTCEMQKALNLAWGSPVHQAKQINYAAK-------------------
T23O_ANOGA        SIPPLTNEMQKALNLAWGSPAHFARNGSLH---------------------
T23O_DROME        AIPPLDETIRKKLINKSV---------------------------------
T23O_DROPS        AIPPLDETIRKKLVHKSV---------------------------------
E0VBN6_PEDHC      YIPPLNKDMKFKLGNPQS---------------------------------
E9G9M1_DAPPU      YIPPLSRHMKTRLSIREEPHTQNRPSNSEDDNKSQSGSSTSGLETSGELSL
T23O_CAEBR        YIPMLSPRMVKTLSEHSNLSHSQSS----ESE-------------------
T23O_CAEEL        YIPMLSPRMVKTLSEHSNLSHSQSS----ESD-------------------
T23O_DICDI        TLPQLPKVVKEQMDFAWSIL-------------------------------
F0ZW87_DICPU      TLPQLPSVVKEQMDFAWSTL-------------------------------