CLUSTAL format seed alignment for MF_01973

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LON_CAMC1       ------------------------------------------------------------
LON_CAMJE       ------------------------------------------------------------
LON_HELPY       ------------------------------------------------------------
LON_HELPJ       ------------------------------------------------------------
LON1_BORBU      -----------------------------------------------MDESKKARSGDKK
LON_BORDL       --------------------------------------MKSREIEYFMEEIKDTVSKEKK
LON_LEPIC       -------------------------------------------MEGGPLEPLEDLSGIEE
LON_TREPA       MAKNTDIEHDAHEPAGHGDVRESAVENPSASAVSDGEERATFAPEVAPQTDTESAQGAAQ
LON_CHLMU       ----------------------------------------MNSTNNTDSQNLDPNASEVE
LON_CHLTR       ----------------------------------------MNSTNNTDSQNLDPNASEVE
LON_CHLPN       ----------------------------------------MDSTTNSDSPILDPNPEDVE
LON_PARUW       ----------------------------------------------MLEEPIDALETEFE
LON1_DESPS      -------------------------------------------------MAEEPTILTPD
LON1_PELCD      ----------------------------------------MTDDRDKTNEDPEKIIEADF
LON_MAGMM       ----------------------------------------MSEQRSDEPEVVDAIIEDQQ
LON2_HYDCU      ---------------MTYHNDSTDLETLEIQELETEMDDSMHEEDIEFNEFVDNTSEFEE
LON_CLOB8       ------------------------------------------------------------
LON_METBF       -----------------------------------------------------------M
LON_METST       -----------------------------------MTQEMENENLSFTQQLRKDGFIKDI
LON1_BDEBA      ------------------------------------------------------------
LON_CYTH3       -------------------------------------------MLDTEPVDMIPLITPEE
LON_FLAJ1       -----------------------------MSNHKILTIDNLSLQEFDSEAELIPLLTPED
LON_PARD8       -------------------------MNVYMKEKTRVFCQNSFDDLDDNIGIVMPILTECD
LON_PORG3       -------------------------------MIDRKYIRLGEDDEDDGFPVFFPVLSVCE
LON_AMOA5       -----------------------------------MFKNMTLLGTLIEHSDGLPLLETNM
LON_CHLT3       -----------------------------------MTDHTKEHENTPSMGFLDGLVNSIS
LON_ACIB3       --------------------------------------------------------MSEL
LON_DICNV       ------------------------------------------------------------
LON_BRUAB       ------------------------------------------------MTGIEQKTPVGG
LON_BRUA2       ------------------------------------------------MTGIEQKTPVGG
LON_BRUME       ------------------------------------------------MTGIEQKTPVGG
LON_BRUSU       ------------------------------------------------MTGIEQKTPVGG
LON_RHIME       --------------------------------------------------------MTNK
LON_AZOC5       --------MVNTPVPGLGSCASRGLIAAPASIIRSRPGCDHAGECIVVCVGVFRKDWVMT
LON_AZOBR       ---------------------------------------------------MKEAQSMFE
LON_CAUVC       ------------------------------------------------------------
LON_CAUVN       ------------------------------------------------------------
LON_BUCAI       ------------------------------------------------------------
LON_BUCAP       ------------------------------------------------------------
LON_BUCBP       ------------------------------------------------------------
LON_ECOLI       ------------------------------------------------------------
LON_ECOL6       ------------------------------------------------------------
LON_SHIDS       ------------------------------------------------------------
LON_ERWAM       ------------------------------------------------------------
LON_VIBPA       ------------------------------------------------------------
LON_HAEIN       ------------------------------------------------------------
LON_XANOR       --------------------------------------MQHLADGPITGPSAFLFPQIPI
LON1_HYDCU      ------------------------------------------------------------
LON_FRAP2       ------------------------------------------------------------
LON_NEOSM       -------------------------------------------MSEEELNNRDTESKQEH
LON_WOLPP       -------------------------------------------MSIGRAVNFNSTV----
LON_RICCN       ---------------------------------------------------MHKKS----
LON_RICFE       ---------------------------------------------------MNKKS----
LON_RICPR       ---------------------------------------------------MNKKS----
LON_RICTY       ---------------------------------------------------MNKKS----
LON_RICBR       ---------------------------------------------------MNKKS----
LON_ORITI       --------------------------------------------MAQVLNDISNRV----
LON1_MYXXA      --------------------------------------------------------MFFG
LON3_SORC5      --------------------------------------------------------MFFK
LON1_SYNFM      ---------------------------------------------------------MFK
LON2_DESPS      ------------------------------------------------------------
LON_DESVH       ----------------------------------------------------------MT
LON_SOLUE       ------------------------------------------------------------
LON1_BACSU      ------------------------------------------------------------
LON_BACAH       -----------------------------------------------MYCNIKWLNRSLI
LON_BRECH       ------------------------------------------------------------
LON_DESRM       ------------------------------------------------------------
LON_HELMI       ------------------------------------------------------------
LON_SYNWW       ------------------------------------------------------------
LON_HALOH       ------------------------------------------------------------
LON_CALS8       ------------------------------------------------------------
LON_CLOD6       ------------------------------------------------------------
LON_CLOAB       ------------------------------------------------------------
LON_FINM2       ------------------------------------------------------------
LON_ELUMP       --------------------------------------------------------MIAE
LON_UNCTG       -------------------------------------------------------MSELD
LON_FERNB       --------------------------------------------MPNKNDNKGKYSRLEK
LON_PSELT       --------------------------------------------------MSTKFEKLEK
LON_COPPD       ------------------------------------------------------------
LON1_THET2      ------------------------------------------------------------
LON_AQUAE       -----------------------------------------------------------M
LON_SULSY       -----------------------------------------------------------M
LON_GEOLS       -------------------------------------------------MSKSDQEHTTT
LON_GEOMG       ------------------------------------------------------MEEIED
LON2_BDEBA      ------------------------------------------------------------
LON_DESAL       --------------------------------------------------MAHTDTDDLV
LON_LAWIP       --------------------------MTFDTNDDSIAKNSLAPYNQETEQQQEEGAMKIN
LON_CHLAD       --------------------------------------------------MNEPMSLFDD
LON2_HERA2      ---------------------------------------------------------MAD
LON_KORVE       ------------------------------------------------MANEAHNIEHTD
LON1_HERA2      -----------------------------------------------------------M
LON_DESOH       ----------------------------------------------------MAQPKIPE
LON_SYNAS       -----------------------------------------------------MEVPMPE
LON2_SYNFM      ------------------------------------------------------MASEGE
LON_DICT6       ---------------------------------------------------------MEE
LON_ROSCS       --------------------------------------------------------MSTP
LON_GEOBB       ---------------------------------------------------------MTE
LON2_PELCD      ---------------------------------------------------------MTG
LON_ANADE       -----------------------------------MRERKETAMSDKEKKGAGAGAQVAP
LON2_MYXXA      -------------------------------------------MSDEKKKGS-AASAMPT
LON2_SORC5      -----------------------------------------------------MPTGDPS
LON4_SORC5      -----------------------------------------------------MSQLRSG
LON_METSB       --------------------------------MESFAPTRKGRAVFSADAAATAAPGSAG
LON_PHEZH       ------------------------------------------------------MNGEQS
LON_PARPJ       ------------------------------------------MSADSENETSESSPAGEA
LON_MYCSM       ------------------------------------------------------------
LON_SALAI       ------------------------------------------------------------
LON_CHLAA       --------------------------------------MNDETLREQTTAESEETSPTTP
LON_DEIRA       ---------------------------------------------------------MPD
LON2_THET2      ------------------------------------------------------------
LON1_SORC5      -------------------------------------------------------MRFAQ
LON_NITOC       ------------------------------------------------------------
LON_FUSNN       ------------------------------------------------------------
LON_MYCA5       ------------------------------------------------------------
LON_MYCMO       ------------------------------------------------------------
LON_MYCH2       ------------------------------------------------------------
LON_MYCGE       ------------------------------------------------------------
LON_MYCPN       ------------------------------------------------------------
LON_MYCPE       ------------------------------------------------------------
LON_UREP2       ------------------------------------------------------------
LON_MYCMS       ------------------------------------------------------------
LON_AYWBP       ------------------------------------------------------------
                                                                            

LON_CAMC1       ----------------------------MQINENKGFPTEIPIIVEDELFLYPFMITPLF
LON_CAMJE       ----------------------------MQIEEIQNYPANLPVLVEDELFLYPFMITPIF
LON_HELPY       --------------------------------MTEDFPKILPLLVEEDTFLYPFMIAPIF
LON_HELPJ       --------------------------------MTEDFPKILPLLVEEDTFLYPFMIAPIF
LON1_BORBU      KE----------------------KAVAGILPHSNKPARVPLIAVPS-HPVFPGMFIPIV
LON_BORDL       RS----------------------KNSGGILPHFDKPVRVPLIAVPS-HPVFPSMFIPIV
LON_LEPIC       NS--------------------------IIPLDSILPPELFLIPIKS-RPVFPGIITPLI
LON_TREPA       ESEPEVQRA------GEAEKGVPEKAKAVVPLDELLPQKVHLIPLTG-RPIYPGIFTPLL
LON_CHLMU       KLLD-----------------ESAE-AEEKTDDHTPPSELFILPLNK-RPFFPGMAAPLL
LON_CHLTR       KLLD-----------------ESAE-AEEKVDDHTPPSELFILPLNK-RPFFPGMAAPLL
LON_CHLPN       KLLD-----------------ESEEESEDQSTERLLPSELFILPLNK-RPFFPGMAAPIL
LON_PARUW       NALN-----------------SLED-NQLSKINGQLPEQVHVFPLLR-RPFFPGMAAPLV
LON1_DESPS      GVEN-----------PDHDDLQFPAR-----MEDILPEMLMVIPLYE-RPMFPKMMGPII
LON1_PELCD      NPED-----------PDDADIAEDAKEGLVVATDVLPSTLPIIPLRP-RPAFPGILTPMV
LON_MAGMM       G------------------AQATTDATPPVRIENSLPTELVIYPLGG-RPFFPGMLTPIQ
LON2_HYDCU      AESNQQNEAIDGEHIANDQSDMDSTMTQLVTANSSKPDSLYLLPVKE-RPFFPGQTLPII
LON_CLOB8       -----------------------------MINLDDKNNIGRVIPVSD-IVLLPGMYHTLK
LON_METBF       RRLT------------------------MYPEQPDENRESIVMPLFE-VVVYPKSRAKFL
LON_METST       DTNP------------------------TCFDDTDSQNQLPIIFIPN-TILLPHTDITLN
LON1_BDEBA      --------------------------------MSYVSGYVPVIPLKN-SVLFPDISMPLR
LON_CYTH3       EAE---------------------------MDKEEFPSVLPILPVRN-IVLFPGVVLPIT
LON_FLAJ1       EEE---------------------------MNNEELPVSLPILPLRN-TVLFPGVVIPIS
LON_PARD8       VDED------------------------FTEGIEKVGDTIPILPLRN-MVLFPGVALPVI
LON_PORG3       EDED------------------------FKVKEDHMQEEMPILALRN-MILFPGVAMPIM
LON_AMOA5       KNM---------------------------HKDHNQDASLTLLASKY-NVLFPGIYMPMT
LON_CHLT3       QQPK------------------------AIEEEIKFDGALPVLPLRN-TVLFPDVIVPIG
LON_ACIB3       IMNE------------------------KTDLEPQVPSVLPLLALRD-VVVYPHMQIALF
LON_DICNV       ----------------------------------MTDKIYPILPLRD-VVVFPHVIVPLF
LON_BRUAB       SE------------------------------TGGADGLYAVLPLRD-IVVFPHMIVPLF
LON_BRUA2       SE------------------------------TGGADGLYAVLPLRD-IVVFPHMIVPLF
LON_BRUME       SE------------------------------TGGADGLYAVLPLRD-IVVFPHMIVPLF
LON_BRUSU       SE------------------------------TGGADGLYAVLPLRD-IVVFPHMIVPLF
LON_RHIME       TS------------------------------PATESATYPVLPLRD-IVVFPHMIVPLF
LON_AZOC5       SPKQ------------------------RPPLVPGVAQTFPVLPLRD-IVVFPHMIVPLF
LON_AZOBR       IP---------------------------------RGALYPVPPLRD-IVVFPHMIVPLF
LON_CAUVC       ---------------------------------MSELRTLPVLPLRD-IVVFPHMVVPLF
LON_CAUVN       ---------------------------------MSELRTLPVLPLRD-IVVFPHMVVPLF
LON_BUCAI       -----------------------------MNSERSERITIPVLPLRD-VVIYPHMVIPLF
LON_BUCAP       -----------------------------MNSERSERIKIPVLPLRD-VVVYPHMVIPLF
LON_BUCBP       -----------------------------MNPERSEYIEIPVLPLRD-VVIYPYMVIPLF
LON_ECOLI       -----------------------------MNPERSERIEIPVLPLRD-VVVYPHMVIPLF
LON_ECOL6       -----------------------------MNPERSERIEIPVLPLRD-VVVYPHMVIPLF
LON_SHIDS       -----------------------------MNPERSERIEIPVLPLRD-VVVYPHMVIPLF
LON_ERWAM       -----------------------------MNPERSERIEIPVLPLRD-VVVYPHMVIPLF
LON_VIBPA       -----------------------------MNLERSERIEIPVLPLRD-VVVYPHMVIPLF
LON_HAEIN       -------------------------------MAKNTQRTMPVLPLRD-VVVFPYMVMPLF
LON_XANOR       PAER------------------------PMAQSQPEVLDLPVLPLRD-VVVFPHMVIPLF
LON1_HYDCU      ----------------------------MDIDQIEFKTNVFVLALRD-VVVFPGMVVPLF
LON_FRAP2       --------------------------------MSEVLNVVPVIPLRD-VVIYPSMTLPLN
LON_NEOSM       DENN------------------------SNFEAGSAHMNLPVLPLRE-VIFFPGDYLPIF
LON_WOLPP       ---------------------------------------LPVLPLRD-VVIFPNIMLPLF
LON_RICCN       ---------------------------------------LPLMALRD-MVVFPGVIAPIF
LON_RICFE       ---------------------------------------LPLMALRD-MVVFPGVIAPIF
LON_RICPR       ---------------------------------------LPLMALRD-MVVFPGVIAPIF
LON_RICTY       ---------------------------------------LPLMALRD-MVLFPGVIAPIF
LON_RICBR       ---------------------------------------LPLMALRD-IVVFPGVIAPVF
LON_ORITI       ---------------------------------------LPLFPIRN-TVLFPGLVLPIL
LON1_MYXXA      RDDK--------------------------KEAQKRGLTVPLLPLRD-IIVFPHMVVPLF
LON3_SORC5      NDSD------------------------RGKNAPERG-IVPLLPLRD-IIVFPHMVSQLF
LON1_SYNFM      LTRN------------------------KDEQSGSATFAMPLLPLRD-IVVFPSMVVPLF
LON2_DESPS      -----------------------------------MTKIYPLMPLRD-IVIFPHMVAPLV
LON_DESVH       DTGR------------------------EGLQNREEGFELPLMSLRE-VVMFPRSIVPLF
LON_SOLUE       ---M------------------------LTSKEKSDTKRLPMMPIRD-VVIFPYMMTPFV
LON1_BACSU      -------------------------------MAEELKRSIPLLPLRG-LLVYPTMVLHLD
LON_BACAH       YYGG------------------------AMSSMNTNERIVPLLPLRG-VLVYPTMVLHLD
LON_BRECH       ------------------------------MGERSGKRELPLLPLRG-LLVYPTMVLHLD
LON_DESRM       --------------------------------MNSEIKSLPLLPLRG-ILVFPYMVIHLD
LON_HELMI       --MA------------------------EEEKIRQTIQELPLLPLRG-IIVFPYMVMHLD
LON_SYNWW       ----------------------------MPTEEHQTYRELPMLPLRG-VLVFPYTVIHLD
LON_HALOH       MDQE------------------------MVTKETEKYIELPLLASRG-VVVFPHMVIPLL
LON_CALS8       ------------------------------MMIAVTKRTIPVIPLRG-LVVFPYMMLHFD
LON_CLOD6       ----------------------------MEQNYTKIDHELPLIPLRG-LAIFPYMILNFD
LON_CLOAB       --------------------------------MNQENKVLPLIPLRG-LIVFPYMVVHFD
LON_FINM2       ----------------------------MKEYYTISEKKLPIIALRG-LWLFPNNIQHFE
LON_ELUMP       NKDY------------------------VKPDVNTLPAVLPAVAIRD-VVMFPGMSLPLS
LON_UNCTG       RFSN------------------------DKNEMPKIPDVLPLLPVRD-IILYPAMVLPLA
LON_FERNB       EAKK------------------------AREEKISIPNVLPAIAMRSNMVIFPNTVVPFY
LON_PSELT       LARE------------------------SFQS-PEVPETLPLIHLRNGMIIFPQTVVPVH
LON_COPPD       -----------------------------------MSEKLPVIPLKN-VVMFPGIVLPLL
LON1_THET2      -------------------------------MKDFLRLELPVLPLRN-TVVLPHTTTGVD
LON_AQUAE       NELF------------------------QTPQVEAGIKEYPLMPLRD-IVIFPTMVQPLF
LON_SULSY       GPFE------------------------DKLDLLELPSTYPLIPTRD-VIVFPYMVFPLF
LON_GEOLS       EPTI------------------------VAEEELRIPELLPLLPIRD-VVVYPFMIIPLF
LON_GEOMG       KEPR------------------------QENEELKIPDVLPLLPVRD-VVVYPYMILPLF
LON2_BDEBA      --MS------------------------FDDKVLEIPQTLPMLPVRD-IVVFPYMIIPLF
LON_DESAL       GLLD------------------------ADDQNLDIPATLPMLPVRD-VVVFTHMIIPLF
LON_LAWIP       AGTE------------------------DDVQPQEIPSSIPILPLRD-VVVFNYMIVPLF
LON_CHLAD       LPEE------------------------HDEPQEAPERRLPMVVLGE-MVIMPHMTIPLQ
LON2_HERA2      DRQL------------------------VDEISAATTLELPVLPLIN-TVLFPTMVTPLF
LON_KORVE       PEFR------------------------DDS---ADARTLPLLPVRD-TVLFPHAVLPLT
LON1_HERA2      SEVE------------------------RTT---TIPDEIAILPLLG-TVAYPQTIMPLA
LON_DESOH       YKAN------------------------GTT--DKLPETVPIMPLSD-GVLFPKMIIPVV
LON_SYNAS       STIN------------------------EDSKIFKLPEILPIMPIFH-TVAFPKMMFPMD
LON2_SYNFM      GVLK------------------------KEG----LPEKLRILPLRN-MVLYPDLVLPLH
LON_DICT6       RELN------------------------QTQ---DIPEVLPILPLRE-TVVYPQMLIPLI
LON_ROSCS       LPTQ------------------------DPP---DIPEVLPILPLNN-VVLFPGMFLPLV
LON_GEOBB       NIT------------------------------INMPEIVPLYPLRE-IIAFPYMVFTIF
LON2_PELCD      HPL------------------------------DAIPPELPVYPLHD-QVIFPHMSFPLF
LON_ANADE       AMGP------------------------PVLINKEDIPAVLPILPLRNSVFFPGGVLPLA
LON2_MYXXA      AMAP------------------------PGLINKEDIPQVLPILPLRNSVFFPGGVLPLA
LON2_SORC5      SRTP------------------------PSPD-----ADSVPILPLRNSVLFPMSVVPIN
LON4_SORC5      ASAP---------------------------------RSPFPLLPLRTGVLFPGTVLTLP
LON_METSB       AGET------------------------LDPA-----KDALIIVPVRGFVLFPGIVMPVV
LON_PHEZH       ANGA------------------------RTLP-----DDAVVVVPVSN-VIFPGVVFPIV
LON_PARPJ       TAST------------------------SALP-----DEPLILLPVRNAVLFPGMVLPFT
LON_MYCSM       ---M------------------------AEAK-------TVPVLFLNDSIVLPGMVVPIE
LON_SALAI       ------------------------------MA-------TLPVLPLTDAVLLPGMAIPVT
LON_CHLAA       SPEP------------------------EVVE-------TLPLIPLEGAVVFPYIVVSLT
LON_DEIRA       STAL------------------------PT---------TIPVCPVRGSVIYPTMVQHID
LON2_THET2      --ML------------------------PE---------TMPVCPVRGSVIYPTMVMPID
LON1_SORC5      RPAM------------------------PERR-------SLPVLSLRDTVLFPGIATPIT
LON_NITOC       ----------------------------------MENNAYPTLPLKN-TVLFPHLVLPLS
LON_FUSNN       ------------------------------------MLKAPFLPIRD-LVIFPNVVTPIY
LON_MYCA5       ------------------------------------MKKLPYIAIRNQLIAPYS-TATVK
LON_MYCMO       -------------------------------------MKYPFMATRGVITFIGN-SSTIE
LON_MYCH2       ----------------------------------MPTNSYRFLVASEDIYFQNTLQQSIT
LON_MYCGE       ------------------------MPVTKK---------SQILVVRGQVIFPFV-PFSLD
LON_MYCPN       ------------------------MPAVKK---------PQILVVRNQVIFPYN-GFELD
LON_MYCPE       ------------------------MNNKKNEKTTNNKEIANVLVTRGIVFYPNT-KIRIE
LON_UREP2       ------------------------MKK-------------PILISRAIVVLPYE-TTTIE
LON_MYCMS       ---------------------MLQYLKKIKGVSFMKTIKLPVVVTRGIFILPST-SKTIE
LON_AYWBP       ------------MKTKSKKLKSDLSIGEFEDIFQEIPEQLPVVVISEIMPIPNV-DFRIE
                                                                          . 

LON_CAMC1       LSDEENLKALELAIQ--G-----ETPILVVPTKPQQDGARDFDG----------------
LON_CAMJE       INDSSNMKALDLAIK--N-----DSMLFVAPSKLEN--GRNFDE----------------
LON_HELPY       LQNNASIKAVAYAKN--N-----KSLVFIACQKDKLN--DNEAP----------------
LON_HELPJ       LQNNASIKAVAYAKN--N-----KSLVFIACQKDKLN--DNEAP----------------
LON1_BORBU      LISDSDMKAIDYAMK--G----NG-IIALFVLNDKFLEKNNNNAQQKLIIDY-------S
LON_BORDL       IVSDIDMKAVDYVIK--G----NG-IISLFVLRDKFLEKSGNNKDGKLTINY-------Q
LON_LEPIC       VPSGKFAKAVEETVK--G----NS-FLGLVLLKDEENEKET------------------S
LON_TREPA       ISDEDDVRSVESAYS--D----SG-FIGLCLVKTD-TQNPT------------------I
LON_CHLMU       IEAGPHYEVLTLLAK--S----SQKHIGLVLTKKEDAN---------TLKIG-------F
LON_CHLTR       IEAGPHYEVLTLLAK--S----SQKHIGLVLTKKEDAN---------TLKVG-------F
LON_CHLPN       IESGPYYEVLKVLAK--S----SQKYIGLVLTKKENAD---------ILKVS-------F
LON_PARUW       IEPGPFYEVLKVVAK--S----DHKCVGLVLTRSEQAE---------IYKVG-------F
LON1_DESPS      IEDMRLQKFILSQKD--K----KVPLFFALLLTRQDPDGQV------KAPES-------A
LON1_PELCD      FTGEKHVALAKRAVD--T----PSKMMGLVLAKEVD------------EPDS-------L
LON_MAGMM       VEGSPYYETIKKAMD--S----HGRLFGILASHAEDG----------QEVFD-------A
LON2_HYDCU      LDKNSWSKTIKKVID--E----KIHYIGIIYVEADDH----------HKAK--------P
LON_CLOB8       FNKFSETQI--ESLS--DED---IVNIALPLKQNFGQSKLKEED----------------
LON_METBF       ADKVTGEILLNDMKN--AES---VSAIGLTVKNGTKASDLSEES----------------
LON_METST       LDKQHTDNL----LH--TVD---DNNHGIILTPKKLEEGNGNVE----------------
LON1_BDEBA      IGREKSIAAL--QKA--LRD---NHWVILLTQKNPNASVDKIED----------------
LON_CYTH3       VGRQKSIRLVKKFYK--G-----DRTIGVVAQENQKSEEPSFQD----------------
LON_FLAJ1       AGRDKSIKLINDANA--G-----GKIIGVVSQINEEDEDPSKDD----------------
LON_PARD8       IGRPKSMRLIKEAVH--K-----KSLIGVVCQKEMGTEDPILED----------------
LON_PORG3       VGREKSLKLIRYVEK--K-----GVYFGAVSQRDMDVEEPDRAD----------------
LON_AMOA5       LENASIIRLVKKVYE--T-----GGIIGIVAQKKEDVEATSAQD----------------
LON_CHLT3       VARQRSIALLESLAP--------NSPVVFLMQTDADIDAPTPDE----------------
LON_ACIB3       VGREKSINAVDVAR-------NSDNLVFVVAQKDSLTEEIDHDN----------------
LON_DICNV       IGREKSIAALDAAM-------NGSQELLLVPQRDPAVVEPTLAD----------------
LON_BRUAB       VGREKSIRALEEV------MGV-DKQILLATQKNAADDDPAPDA----------------
LON_BRUA2       VGREKSIRALEEV------MGV-DKQILLATQKNAADDDPAPDA----------------
LON_BRUME       VGREKSIRALEEV------MGV-DKQILLATQKNAADDDPAPDA----------------
LON_BRUSU       VGREKSIRALEEV------MGV-DKQILLATQKNAADDDPAPDA----------------
LON_RHIME       VGREKSIRALEEV------MGT-DKQIMLVTQINATDDDPEPSA----------------
LON_AZOC5       VGREKSIRALEEV------MRG-DTYILLATQENASDDDPATDA----------------
LON_AZOBR       VGREKSVRALEDV------MKD-DKQILLVTQKNAAQDDPTPAD----------------
LON_CAUVC       VGRDKSVRALEEV------MRG-DKQILLVTQKNSADDDPAPGD----------------
LON_CAUVN       VGRDKSVRALEEV------MRG-DKQILLVTQKNSADDDPAPGD----------------
LON_BUCAI       VGRQKSIKCIETS------MSN-DKKIMLIAQKEASKDEPTPKD----------------
LON_BUCAP       VGRKKSIHCIETS------MNN-DKKIMLIAQKEASKDEPSTND----------------
LON_BUCBP       VGRDKSIKCIEAS------MNK-NKKIMLVTQKEAEIDEPTDND----------------
LON_ECOLI       VGREKSIRCLEAA------MDH-DKKIMLVAQKEASTDEPGVND----------------
LON_ECOL6       VGREKSIRCLEAA------MDH-DKKIMLVAQKEASTDEPGVND----------------
LON_SHIDS       VGREKSIRCLEAA------MDH-DKKIMLVAQKEASTDEPGVND----------------
LON_ERWAM       VGREKSIRCLEAA------MDH-DKKIMLVAQKEASTDEPGIND----------------
LON_VIBPA       VGREKSISCLETA------MET-NKQVLLVAQKQADTDEPTVDD----------------
LON_HAEIN       VGRAKSINALEEA------MND-DKQILLVSQREADLEEPTPED----------------
LON_XANOR       VGRDKSMRALEKA------MEA-DKRILLVAQKSAETDDPAAVD----------------
LON1_HYDCU      VGRPKSMNALNAA------MKE-DKQIFLVTQKNATEETPTIDN----------------
LON_FRAP2       VGRKKSIEAVKQA------SNSYNNYILLATQKNGSSSGDVVDN----------------
LON_NEOSM       IGRKGSIQAMDKALA--E-TSENTGRMLLIAQKNPKKEIPEGKD----------------
LON_WOLPP       VGREKSVHALEYAIS--S-SS-HQNEIFLIAQKDGSIDNPEPEN----------------
LON_RICCN       VGRPKSLQALSHTTI--S-EEDNSKYILVTLQKKFDQENPSTHE----------------
LON_RICFE       VGRQKSLQALSHTTV--S-EEDNSKYILVTLQKKFDQENPSKHE----------------
LON_RICPR       VGRKKSLQALSRTTI--S-EENNSKYILVTLQKKFDQENPSKHE----------------
LON_RICTY       VGRKKSLQALSRTTI--S-EENNTKYILVTLQKKFDQENPSKHE----------------
LON_RICBR       VGRQKSLHALSNTTL--S-EEDNSKYILVTLQKKFDQENPNRNE----------------
LON_ORITI       IGRDDSVKNLLRLGN--D-SE-NQHTILLTTQKNADDIKPSINS----------------
LON1_MYXXA      VGREKSIAALKDAMA--HKGPDDKAVILLAAQKKAKTNDPTPDD----------------
LON3_SORC5      VGRERSIAALDEAMN--R-GKE----IFLAAQRNAKTNDPTPDD----------------
LON1_SYNFM      VGRDKSVNALDKAMA--T-DKK----IFLAAQTKAKTDTPGESD----------------
LON2_DESPS      VGREKSIRALEDAME--K-KTE----IFLVTQLEPTCEDPNEGE----------------
LON_DESVH       VGREASIKAIESAIS--DYGKK----IFLVAQREPELEKPGPED----------------
LON_SOLUE       VGRESSVRALEEAMA--G-DKK----IFLATQHDASIDEPKPNE----------------
LON1_BACSU      VGRDKSVQALEQAMM--H-----DHMIFLATQQDISIDEPGEDE----------------
LON_BACAH       VGRDKSIQALEQAAM--D-----ENIIFLAMQKEMNIDDPKEDD----------------
LON_BRECH       VGREKSIRALEQAMV--D-----DNKILLATQEEVHIEEPDAEQ----------------
LON_DESRM       VGREKSIQAIEEAMV--Q-----DRMIFLATQREAQTDEPTVDD----------------
LON_HELMI       VGRERSVNAIEEAMA--Q-----DRIIFLATQKEAQTDQPGAED----------------
LON_SYNWW       VGRKKSINAIEDAML--G-----SKEIFLATQKEAQTDEPDEED----------------
LON_HALOH       VGREKSIEALEKAMV--K-----DKEIIILSQKDEKIEDPDPED----------------
LON_CALS8       VGRQISLKALEEAMN--S-----DQQVLLLAQKDPKQEEPSPED----------------
LON_CLOD6       IGREISLKALDQAMM--D-----EELIFLTSQKEAEVDEPGEED----------------
LON_CLOAB       VGRDKSIEALEKAMM--N-----DQQIFLSTQKDAKIEEPNEDD----------------
LON_FINM2       VGREVSLNALNASLL--R-----NSEIFICTQKDPMLENITKED----------------
LON_ELUMP       VSRSKSIAAINLALD--S-----NKYVVAVAQKEAEVEDPKAED----------------
LON_UNCTG       VGREKSIKALEESMS--T-----NRLVFIVTQKNIQIEDPTPKD----------------
LON_FERNB       VGREISLMALEEAME--K----TNQIVFVVNQKDPAVETPTEKD----------------
LON_PSELT       VAREKTLLALEQSIE--S----YQQFVFVTSQKDPSVEEPSFDQ----------------
LON_COPPD       IGRPKSIKALEEAMK--G----TKQVILLA-QKDENIDEPAPSD----------------
LON1_THET2      VGRLKSKRAVEEALS--A-----DRLLFLVTQKDPEVDDPAPED----------------
LON_AQUAE       VGRRFSIRAIEEANK--KD-----KLIFLVLQKDKDVEEPKEED----------------
LON_SULSY       IGRPFSIKAVEEALD--NNQ----RYIFLSLQKDKEKEIPTKKD----------------
LON_GEOLS       VGREMSIKAVDQALA--GD-----RMIMLATQHDIGDEDPTPDK----------------
LON_GEOMG       VGREISINAVDQALS--RD-----RLIFLATQKEMGDEEPTPEG----------------
LON2_BDEBA      VGRDASIRSVEEALA--KN-----RLIFLASQKDITEENPSPDN----------------
LON_DESAL       VGRDKSVRAVDAAMA--KD-----RFLFLATQMDGAVENPESDQ----------------
LON_LAWIP       VGRERSIQAVESATT--HG-----QHIFLCAQKDSQIENPTEED----------------
LON_CHLAD       VPQGKSYRAMERAWE--E-----DRDVLLIFVREHQLEGYKSNQP---------------
LON2_HERA2      VARELSMAAIEAAMS--A-----DRQIVAVAQRAIEIEEHDTSQ----------------
LON_KORVE       VGRESSVQLINSLGE--D-----KTIVVVAQREARVDSPQ----P---------------
LON1_HERA2      IGQPESIRLIDDLMA--G-----QRIVGLMALKNEDERPNP-VLP---------------
LON_DESOH       ITQNEYMTLIDEVMS--G-----NRLVALITPKSGERKSD--YGP---------------
LON_SYNAS       IVGNRFIQLVDEAMA--K-----DRLLGLVLTRKAPSAEGPLCQC---------------
LON2_SYNFM      VTRAGYRRLADEVYR--E-----NGLLAVVAQRNEEAEEA---SP---------------
LON_DICT6       VGREKSIRLVEDALS--G-----NKLIGMCMQKT--PVED--PTP---------------
LON_ROSCS       VSGDTWVKLVDEAAL--A-----TKMVGVFMRTQ--PGEG--FDP---------------
LON_GEOBB       LKQED-MPPFEEAVL--F-----NNLVALVKLREEPTGEL----F---------------
LON2_PELCD      IGKEH-MGLVEEALR--N-----NRLLVVLTVLAIDPITG----R---------------
LON_ANADE       VGRQKTIALIKDAV---R----DEQVIGVVTQRRAEEEDPGAAD----------------
LON2_MYXXA      VGRQKTIALIKDAV---R----DDQVIGVVTQRRAEEEDPGAAD----------------
LON2_SORC5      VGRPRSVRLVEDLLG--R----ERALVGVISQRSPDVDEPTFKE----------------
LON4_SORC5      VGRPRSVALLNAVH--------AGDVIGVIAQRDPKREDPRRED----------------
LON_METSB       LNGPAAIAAAQEAV---R----QQRSVGILMQRESGAEEASPLN----------------
LON_PHEZH       LDRPSAVAAAQQAL---R----EQHPLVLVLQQDVQAPDPGPQS----------------
LON_PARPJ       AGRGQVKEDVQAAV---K----RQQPLGVVLQRDPRVQDPTFDD----------------
LON_MYCSM       LDDAARAAVDAARAS--E-----SGELLIAPR--------LEDR----------------
LON_SALAI       LDPTTQAAVDAARAT--G-----DQRLLAVPR--------LDGE----------------
LON_CHLAA       LDELGSASAEAAARE--G-----RQVLLAARRPDAPADAPITDQ----------------
LON_DEIRA       ASRAISINAIEAAMS--G-----EKVILIVSQRDKDVDDPKGED----------------
LON2_THET2      AGRPISIRAIDEALA--R-----DRVLLIVSQRDKEVETPRPSD----------------
LON1_SORC5      VGRLKTLRAVEAALR--VEG--EDKRIFAVAQRD-AAEEPTASG----------------
LON_NITOC       VGRAGSIAAVEAALS--S----EDKLIAVFPQKDPRTDEPAADD----------------
LON_FUSNN       VGRANSIATLEKAIA--N-----KTKLVLGLQKDASQENPTFDGD---------------
LON_MYCA5       IGRPNSLAAIQ-----FAQTGFNGEIYIFYTKDNKMVDSIKKTSDLEEY-----------
LON_MYCMO       VGRPLSLAAID-----LAKSDFENKLVLIPQK-NIKQNEIEFEKDLENV-----------
LON_MYCH2       FSDPESIKVLKDFYHSNSRPTLTNKDFLIVYRKEKEKDTKKKNSSVIKFPRNDFNSFEDS
LON_MYCGE       VGRPRSRKIIK------ALKTLKTKRLVLVTQKFTGEQNP-EFNDIYHV-----------
LON_MYCPN       VGRERSKKLIK------ALKNLKTKRLVLVTQKNSDQLNP-EFDDIYHC-----------
LON_MYCPE       IGREKSIAAIN------DSKE-KKQNMIVVSQENPSIDSP-SKNEIFTV-----------
LON_UREP2       VGRPKSIQAID------LAKQSSSKEIIIISQKDIDTDEVVNFDELYKV-----------
LON_MYCMS       FGRVKSKNALD------ASADLYNNQIVVVSQESPLEEEP-NLEHLFYL-----------
LON_AYWBP       VSDNSYLKALK------ESETNANSFVILLTQKGLSHNKP-KLTNLQRY-----------
                                                                            

LON_CAMC1       --IYDAGVIGTIMRRVPLPD-----GRVKVLFQGIDKGKILKQSGINP------------
LON_CAMJE       --IYNCGVIGTIMRKVPLPD-----GRVKILFQGYAKGKIIEQISNKP------------
LON_HELPY       --YYDVGVIGSVMREANMPN-----GRVKLLFNGIAKGRILEPAKENEQ----------G
LON_HELPJ       --YYDVGVIGSVMREANMPN-----GRVKLLFNGIAKGRILEPAKENEQ----------G
LON1_BORBU      KDIYSVGVTGKIIKKINLPDG-----GYNIFVSTFDRIKFVKVVLND------------K
LON_BORDL       KDIYSVGVTAKIVKKINLPDG-----GYNIFVSTIDRVKFVKVVLNE------------D
LON_LEPIC       ENIYQYGVVAKILKKVNLPDN-----AVNILVNTIRRFKIESFVNKD-------------
LON_TREPA       SDLYEVGSVARIVKKINLPDG-----GLNVFISTQKRFRIRKHVHHS------------K
LON_CHLMU       NQLHRVGVSARILRIMPIEGG-----SAQVLLSIEDRIRIVKPVQD-------------K
LON_CHLTR       NQLHRVGVSARILRIMPIEGG-----SAQVLLSIEDRIRIVKPIQD-------------K
LON_CHLPN       NQLHKTGVAARILRIMPIEGG-----SAQVLLSIEERIRIIEPIKD-------------K
LON_PARUW       SDLYQIGVLARVLRIIPMEQG-----GAQVILNMERRIKIEKPTSET------------K
LON1_DESPS      DDFYDVGVVAKVIQISPLTIGE----PLQFIVEIKARFDVVKLIKKE------------P
LON1_PELCD      ENLHRFGVVGRVMKVLHTD-DD----SIHLLVNCLERFSIRELTESE------------E
LON_MAGMM       NQLFGIGTVVRILEASVNEEAK----QIKLLAEGLWRFEVRDVVSVG------------P
LON2_HYDCU      KDFAKTGTLIRIHEPKIKED------YIQLIAEGVCRFQIADWLSSS------------A
LON_CLOB8       --FHRVGVTFQVNAIEKTEKG------YKAEIKILDRVEIKTFSI------------EED
LON_METBF       --LYKIGNLLNITYVQPSDDG------YLVVAKGIERVEAVSLYQ------------KNG
LON_METST       --FYDVGVILEIKSLTEDKENELLPEEYVLELKVKDKVYVNKILK------------KDG
LON1_BDEBA      --LYQVGTLAKVESFRMEEDG-----SYNIFVKAHQRVRLIHSRD------------SEG
LON_CYTH3       --IFKVGTVAKILR-MFVLP----DGNTTIIIQGKRRFKIEEQVQ------------DEP
LON_FLAJ1       --IHKIGTVARILR-VLKMP----DGNVTVILQGKKRFEIDEVVS------------EEP
LON_PARD8       --LYTTGVIADIVR-VLEMP----DGSTTVILQGKKRFELNELTE------------TDP
LON_PORG3       --LYDVGVVAEIIR-VLEMP----DGTTTAIVQGRQRFALQEITA------------TEP
LON_AMOA5       --IFTIGTTARILK-LINLP----DERVRILLQGEEKFQIEDVIA------------ETP
LON_CHLT3       --LHKNGSVGLVLR-TLRMP----DNSMSVIVQGVKRVVVEAFTQ------------TEP
LON_ACIB3       --LYQYGTVAKIVQ-VVNHEN--DENCIKVLIEGLHRSKLKKIID------------EDS
LON_DICNV       --LHEIGSLGRIVQ-MAKL----SDGTVKALVEGLYRVHLEALND------------DEK
LON_BRUAB       --IYEIGTIANVLQ-LLKLP----DGTVKVLVEGTARAKISKFTD------------RED
LON_BRUA2       --IYEIGTIANVLQ-LLKLP----DGTVKVLVEGTARAKISKFTD------------RED
LON_BRUME       --IYEIGTIANVLQ-LLKLP----DGTVKVLVEGTARAKISKFTD------------RED
LON_BRUSU       --IYEIGTIANVLQ-LLKLP----DGTVKVLVEGTARAKISKFTD------------RED
LON_RHIME       --IYKVGTIANVLQ-LLKLP----DGTVKVLVEGRSRAEIERYTP------------RDD
LON_AZOC5       --IYRVGTLATVLQ-LLKLP----DGTVKVLVEGVTRAQVVQYTD------------RAD
LON_AZOBR       --IYSVGTVGTVLQ-LLKLP----DGTVKVLVEGGQRASITKFAE------------NED
LON_CAUVC       --IFEVGVLATVLQ-LLKLP----DGTVKVLVEGKARAAVVSFTD------------QES
LON_CAUVN       --IFEVGVLATVLQ-LLKLP----DGTVKVLVEGKARAAVVSFTD------------QES
LON_BUCAI       --LFDIGTISAILQ-MLKLP----DGTVKVLIEGLQRAHIKNLTN------------NGE
LON_BUCAP       --LFNIGTISSILQ-MLKLP----DGTVKVLVEGLQRACIKNIES------------NGE
LON_BUCBP       --LFTIGTTASILQ-MLKLP----DGTVKVLVEGLQRAKVKKINN------------ENG
LON_ECOLI       --LFTVGTVASILQ-MLKLP----DGTVKVLVEGLQRARISALSD------------NGE
LON_ECOL6       --LFTVGTVASILQ-MLKLP----DGTVKVLVEGLQRARISALSD------------NGE
LON_SHIDS       --LFTVGTVASILQ-MLKLP----DGTVKVLVEGLQRARISALSD------------NGE
LON_ERWAM       --LFSVGTVASILQ-MLKLP----DATVKVLVEGLQRARISALSD------------NGD
LON_VIBPA       --LFEVGTVATILQ-LLKLP----DGTVKVLVEGQQRAKINHFKE------------S-D
LON_HAEIN       --LFDVGTIANIIQ-LLKLP----DDTVKVLVEGQNRAKINSLED------------GEK
LON_XANOR       --LHTVGTLAQVLQ-LLKLP----DGTIKVLVEGLSRVTVDKVVE------------QDG
LON1_HYDCU      --LYQTGVMANILQ-LLKLP----DGTLKVLVEGVKRFELLALND------------EEN
LON_FRAP2       --IYDIGTLAKVVQ-IMKLP----DGSLKIIVEGIAKRLVAKYES------------IDG
LON_NEOSM       --LYEVGVIAKIAEPKINLQ----DGGVKLMVIVECRARAVNFRK------------SEG
LON_WOLPP       --LYEVGVLANIIQPLIKLP----DNAVKVMIHGVRRGRVIEYIS------------SHT
LON_RICCN       --LYNTAILAKIIQ-IVKLP----NNTAKILIEAVARVKLSNIK-------------GEE
LON_RICFE       --LNNTAILAKIIQ-IVKLP----NNTAKILIEAVARVKLSNIK-------------GND
LON_RICPR       --LYNTAILAKIIQ-IVKLP----NNTAKILIEAVARVKLSNIK-------------DEE
LON_RICTY       --LYNTAILAKIIQ-IVKLP----NNTAKILIEAVARVKLSDIK-------------DEE
LON_RICBR       --LYDVGILAKVIQ-IVKLP----NTTAKILVEAIARVKISNIK-------------GDE
LON_ORITI       --LYKIGVLAKITE-LVQLP----NDNYKILIKVLDRVKLTIRR-------------SHD
LON1_MYXXA      --IFHFGTLGHVIQ-LLPLP----DGTVKVLVEGVRRAKVKKFH------------PNDA
LON3_SORC5      --IFGVGSVGAIMQ-LLRLP----DGTVKVLIEGKRRARIRRYV------------QSDA
LON1_SYNFM      --IYRVGTVANILQ-ILRLP----DGTVKVLVEGDFRARISSFI------------PHPD
LON2_DESPS      --IYQCGTLSTVMQ-LLRLP----DGTIKALVEGQRRARIVSRV------------PHEE
LON_DESVH       --LFEVGTVSKILQ-LLRLP----DGTIKVLFEGLYRARWDGTADAIIG-------ADDA
LON_SOLUE       --IYSVGTIVNIVQ-SLKLP----DGNIKVLVEGVERAKVVSVAD------------DEG
LON1_BACSU      --IFTVGTYTKIKQ-MLKLP----NGTIRVLVEGLKRAHIVKYNEHE------------D
LON_BACAH       --IYSVGTVAKVKQ-MLKLP----NGTLRVLVEGLHRAEVVEFIEEE------------N
LON_BRECH       --IYSIGTVARVKQ-MLKLP----NGTIRVLVEGLQRAKIEEYLQKE------------D
LON_DESRM       --IYNIGTVAEVKQ-LLKLP----GGTIRVLVEGIARAKIEKYEHQD------------P
LON_HELMI       --IYQIGVIAEIKQ-LLKLP----GGTIRVLVEGLARAEILEYIDME------------P
LON_SYNWW       --IYEVGTVAEIRQ-ILKMP----GGTMRVLVEGLFRAEINAYLAND------------P
LON_HALOH       --LYTIGTIAEVKQ-LVKLP----NGMLKVVVEGIKRARIIDFIEID------------E
LON_CALS8       --LYQYGTVAKIKQ-MLKLP----SETSRILVEGLSRAKVIGYVSVD------------P
LON_CLOD6       --FYHVGTICKVKQ-MIKLP----GDTVRVLVEGVSRGRVKKIEQED------------G
LON_CLOAB       --INSVGTICSIKQ-ILRLP----GDAVRVLVEGISRGKIDKYLKQE------------P
LON_FINM2       --FYHTGVLASIKQ-TIKMP----NGNIRVLVEAYDRAKIVDFVEND------------S
LON_ELUMP       --IYRFGVLSEITQ-SLKMP----DGSIKVFLQGIARVKIEHLDFNNI-----------A
LON_UNCTG       --VYNIGTICEVLQ-MLKMP----DGTLKALVEGISRAQWTDFKLSDK-----------G
LON_FERNB       --LYKVGTIVRIIQ-VGKLP----DETFKVLVEGIARAKWIKNVG-------------EK
LON_PSELT       --LYEIGTVSKVLQ-VVQLP----DGSFRVLLEGLERARAYEVVQ-------------DN
LON_COPPD       --LYDVGVIGEVIQ-IFRAP----DGTVRMVVEAKTRVKASVSDS-------------GE
LON1_THET2      --LYAVGTLAVVKQ-AMRLP----DGTLQVMVEARSRARLLSYVA-------------AP
LON_AQUAE       --IYKVGVVAYILR-TVPIE----DARVKVLVQGLKRGVIKKLEW------------KED
LON_SULSY       --IHEIGVVATIIR-MMKLE----DNRIKILVQGVSRGRIKELKK------------VDD
LON_GEOLS       --IYNVGTVAMIMR-MLKLP----DGRVKILVQGLVKARIAEFVE------------FKP
LON_GEOMG       --MYTVGTVAMIMR-MLKLP----DGRVKVLVQGLAKGLITEFVE------------SKP
LON2_BDEBA      --IYTVGTVAMIMR-MRKLS----DGRVKILIQGVAKGRVKNFTK------------TSP
LON_DESAL       --IFKHGTAARILR-VLKLP----DGRVKVLVQGLAKAKIVRYTK------------KSD
LON_LAWIP       --LYSVGTVALILR-LLKMP----DGRLKALVQGISRARCLTIHN------------EDG
LON_CHLAD       QNLPPIGVIAQLQE-FAKLN----DGTARVILEGQSRAQIIEAIQ------------ITP
LON2_HERA2      --LYQVGVIAHIER-VLKLP----DGTTSVLVQGQQRVQIVDWLA------------TEP
LON_KORVE       SDLFAIGSLAVVHK-VVKMP----NQSLFVFAEGLERVRVTEYVQ------------LNP
LON1_HERA2      EDFYQLGSAAVVHK-LMKLP----DGTLRAAMQVLERIEIVEIIQ------------TEP
LON_DESOH       GDLSPIGTLALILK-MAKPD----ESRIHLMLQGISRIRTKNFIK------------TDP
LON_SYNAS       EDLHRVGTCVSILK-LAKQA----GEKAQLVVQGLARFRIVEFLE------------EEP
LON2_SYNFM      ADIYQVGTVGSIIK-LLKQA----DGTYQIIVGASEKVRLRNISQ------------AGD
LON_DICT6       DDIYRIGTVGIIVR-SLRFP----DNTLRLFVQGLQRIRVIEFLE------------TEP
LON_ROSCS       LALARTGAVALIVR-MLRLP----HGAVQILVQGQARIQIRQLIV------------TEP
LON_GEOBB       PALHEIGTLCKVMQ-INKLA----GGGAKVVLEGVIRVRLLAIVQ------------QTP
LON2_PELCD      EQFARVGTICRINQ-VLRFP----EGGCKIILEGVNRVRLITTLQ------------VTP
LON_ANADE       --LYTVGTVARVVK-LLKMG----EDNYSLVVQGLARFKVLELVQES------------P
LON2_MYXXA      --LYTMGTVARIVK-LLKMG----EDNYSLVVQGLARFRVVELVQEA------------P
LON2_SORC5      --LYSVGTVARVVK-VIRLG----PNNYSVVLNGLGRFRVKSAFSLE------------P
LON4_SORC5      --LHDIGTFARVVD-ISRVS-----NGYRLVIEGLDRFALSALVETE------------P
LON_METSB       --MHRFGVVANILRYITAQ-----DGGHHLICQGEQRFHVEEFLRER------------P
LON_PHEZH       --LHRMGTLANVLRYVTGP-----DGAPHVACQGVERFEIDEWVEGF------------P
LON_PARPJ       --LNTIGTVANVVRYVTSPE----DGAHHLICQGVERFRLIAPVEGL------------G
LON_MYCSM       --YPAYGVLASIVQ-IGRLP----NGDAAAVVRGERRAHIGSGTSGP------------G
LON_SALAI       --YGPVGVVATIEK-VGRLP----SGEPAAVVRGLARARIGSGVPGP------------G
LON_CHLAA       --LFNVGVVARIEQ-LGTLP----NGASGVVVRGLVRAVLGEAVQTT------------P
LON_DEIRA       --LYDVGTACNVLR-VRKNP----DGTLQMLVSAVARVQVSAY-QLG------------D
LON2_THET2      --LFEVGTACNILK-MRKNP----DGSVQVLVQAFARVRVREWLDLG------------D
LON1_SORC5      --LFSIGVIARITQ-VQRFG----SG-LQLVLYCERRAAAPRYTEVD------------G
LON_NITOC       --LFRFGTVGIIKK-MVRSE-----DTVQILVQGIERVEQLEMVQ------------KQP
LON_FUSNN       --IYEVGVIANIVQ-IIRMP----NNNIKVLVEAEDRVKIKNIEKEE------------N
LON_MYCA5       ------GVKAKIKEIVEQGK-LQNVVFEVEELVKVKEIYKELGKYSFT-------SDIFA
LON_MYCMO       ------GILTKIKSIKILSNGNRKIIVEGVERIKLDSIEKDKNN-----------NDIIA
LON_MYCH2       KNDIQNQAKILNGKVGDFENSLLPRIYDLDELSKYASLARIQSYRAKTSPDKSEWQTVIL
LON_MYCGE       ------GTLCEIDEIVDVPGVDSKTVDYRIKGRGLQRVLIEKFS------------DADI
LON_MYCPN       ------GTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFS------------DADL
LON_MYCPE       ------GTLCSFEIDNKHP--DG---SYSIIFTGIKRVKINKLS------------EKAS
LON_UREP2       ------GTLVKIKSIIDNFD-----EGYSIEVEGLKAVYINNEN------------DVID
LON_MYCMS       ------GTVADLSVKKVWKD-----GTISVELNYNQKIKIDEFV------------EEDN
LON_AYWBP       ------GVLAQIITKVKIPH-----GDFKVRFRILQRVKIDKFL------------QKEP
                                                                            

LON_CAMC1       -LRGIVDMLHVKRPSQV---------------------KTDALIVVLREKVRELSQFNHF
LON_CAMJE       -LEAKIELIKEDFLEGT---------------------KKEALLEVLKEKVKNLANISHY
LON_HELPY       FLEAQISPIEYLEYDKE---------------------NIQAIVEVLKEKVITLANVSSL
LON_HELPJ       FLEAQISPIEYLEYDKE---------------------NIQAIVEVLKEKVITLANVSSL
LON1_BORBU      FPIIEIDYLKQIPVRKD-------------------DIQSKAVYGSILLRTKEIFAHRKM
LON_BORDL       FPIIEVDYLKQIPIKKY-------------------DVNLKAIYSSILLKTKEIFSHRKM
LON_LEPIC       PLVARVSYPEEEPGA-P-------------------KNTTKAMMRTLLVMTRELAQNNPL
LON_TREPA       PIVAAVQYLSDLIEG-D-------------------PLEIKALVRGLIGEMKELSENNPL
LON_CHLMU       YLKAKVAYHKEN--KEL-------------------TEELKAYSISIVSIIKDLLKLNPL
LON_CHLTR       YLKAKVSYHKEN--KEL-------------------TEELKAYSISIVSIIKDLLKLNPL
LON_CHLPN       YLKARVSYHADN--KEL-------------------TEELKAYSISIVSVIKDLLKLNPL
LON_PARUW       TLKANVSYIEDD--PIL-------------------TTELKAYAISILSTIKELLKLNPL
LON1_DESPS      LFQVEVKYWQEE-KIKV-------------------TDELKAYSTAIIDSIKELVHLNPI
LON1_PELCD      GLFARVDYHYAT-ELSV-------------------NPELKAYSMAIITTLKELVQINPL
LON_MAGMM       PIVAQVTHHNNPVSVVD-------------------TDALKPYTMAVINTLKEILKYDSL
LON2_HYDCU      PFRARVNYPNDIRNGSP-------------------KE-FKAYGLAIMNAFKELLPLNPL
LON_CLOB8       SIKAEFEFAPDIIDLTE--------------------KSKDEMVEYIKKVTREISENFKG
LON_METBF       LFYATYRPVHDLPDFDE--------------------DAETEVMANIKKTIHEISARFQG
LON_METST       FFHAQYKILPEENTLTE--------------------DEITELNKNIDETVLEIAKFLPN
LON1_BDEBA      HIEAQTEALEDSGRLDK--------------------KTEEALLSSLRQLSDDLLDLLPG
LON_CYTH3       FMQAKVSMLKDIHPDM-------------------SKKEVKALLQSVKESATKILKMNPE
LON_FLAJ1       YMTASIKEVSEERPDE-------------------NDSEFTAILDSVKELAIQIIKESPN
LON_PARD8       YLSGKITVLEDTKPDK-------------------TDREFEALISTIKDLTIKMLGAVAE
LON_PORG3       FMKGRVKLLPDILPGKN------------------KDHEFEALVSTIQDMSLKMMELMVE
LON_AMOA5       YLLASISRLKDKTSNT-------------------QSKHFKAVVSSIKETVAKLISLQPE
LON_CHLT3       YLAAKVTPKDE---EEL------------------EGVEFDAYARTTKQLASKIIELSPN
LON_ACIB3       YLTAEHELSPMTINVDK--------------------ATQETRLQELRNLFAQYAEAKLR
LON_DICNV       MFSAKKRNMLEKNSTKS--------------------EEHDSIVEILIEEFAKYLRNQER
LON_BRUAB       YHEAYAAALQEPEEDA---------------------VEIEALARSVVPDFENYVKLNKK
LON_BRUA2       YHEAYAAALQEPEEDA---------------------VEIEALARSVVPDFENYVKLNKK
LON_BRUME       YHEAYAAALQEPEEDA---------------------VEIEALARSVVSDFENYVKLNKK
LON_BRUSU       YHEAYAAALQEPEEDA---------------------VEIEALARSVVSDFENYVKLNKK
LON_RHIME       FYEAMAHALPEPDEDP---------------------VEIEALSRSVVSEFESYVKLNKK
LON_AZOC5       LYEAEAISLPDEVGDV---------------------VEAEALARSVVNEFENYVKLNKK
LON_AZOBR       FFQAHADLVEEKVGES---------------------QELEALGRAVVSQFEQYIKLNKK
LON_CAUVC       YYEAQIGEVSEDDGAG---------------------PEAEALSRAVVEQFENYVKLNKK
LON_CAUVN       YYEAQIGEVSEDDGAG---------------------PEAEALSRAVVEQFENYVKLNKK
LON_BUCAI       HFIAEVELISSSNLLD---------------------KNQEVLIRTTMNQFESYIKLNKK
LON_BUCAP       HLVAEVELIISPTVID---------------------KEQEVLIRTTVNQFESYIKLNKK
LON_BUCBP       YFTAQIQLICTPEITE---------------------KEQSILIRTTLNQFENYVKFNKK
LON_ECOLI       HFSAKAEYLESPTIDE---------------------REQEVLVRTAISQFEGYIKLNKK
LON_ECOL6       HFSAKAEYLESPTIDE---------------------REQEVLVRTAISQFEGYIKLNKK
LON_SHIDS       HFSAKAEYLESPTIDE---------------------REQEVLVRTAISQFEGYIKLNKK
LON_ERWAM       HFTAKAEYLTSPEIEE---------------------REQEVLVRTAINQFEGYIKLNKK
LON_VIBPA       FFLAEAEFIVTPELDE---------------------REQEVIVRSAINQFEGFIKLNKK
LON_HAEIN       CFSAQITPIETTYGDE---------------------KELVVAKSAVLSEFENYLTLNKK
LON_XANOR       ALQGQGTEVEASDAREP--------------------REVEAIARSLMSLFEQYVKTNRK
LON1_HYDCU      FLTGDIQQVESDEQLD---------------------NDGVVLVRTIQERFQDYAALKKK
LON_FRAP2       CIYANLDSLHIDDNYDPSQ----------------IDKELKAILLSITDSLKKFVDISGK
LON_NEOSM       VLEADVLPIEEEES---------------------DNVDIEAYRRAVVQNFEKCVKLSE-
LON_WOLPP       LLQARVALDGHYEYGEN-E----------------DNIDLEALRRSVIDAFDNWCKLSKK
LON_RICCN       AFEANYEIIPDEEI----F----------------DVNNMRSLVDNAVQLFSKYAINDKK
LON_RICFE       AFEANYEIIPDEEI----F----------------DVNNMRSLVDNAVQLFSKYAINDKK
LON_RICPR       AFEANYEIIPDEEI----L----------------DIHNMRSLVDNAVQLFSKYAMNDKK
LON_RICTY       SFEANYEIIPDEEI----L----------------DMHNMRSLVDNAVQLFNKYAMNDKK
LON_RICBR       AFEANYEIIPDEEI----F----------------DANNMRSLVDNAVQLFAKYAGSDKK
LON_ORITI       LLVAEYVIVPDDEI----N----------------NADEIKDKLANAIVLFNKYIRLSKK
LON1_MYXXA      FFMVEVEEVEEQTEKTV---------------------ELEALVRSVHSVFEAFVKLNKR
LON3_SORC5      YFLIEYDEIVESSVASV---------------------EVEALMRSVQSTFEMYVKLNKK
LON1_SYNFM      HFFVSLEGLEESEDESV---------------------EIEALRRGVRAAFDAYSKHNKK
LON2_DESPS      FMQVEVEECTEVLPGQD---------------------ELIAYERELRKAFQQFAHLGKK
LON_DESVH       YPRVRVTRIEQESSED----------------------DDEALVRATHEALDEYGKINKK
LON_SOLUE       FFRATVRTSGFKVETGP---------------------QLDALISRVTTLFEQYVKLSQN
LON1_BACSU      YTSVDIQLIH--EDDSK-------------------DTEDEALMRTLLDHFDQYIKISKK
LON_BACAH       VVQVSIKTVT--EEVEA-------------------DLEEKALMRTLLEHFEQYIKVSKK
LON_BRECH       YFVVSITYLK--EEKAE-------------------ENEVEALMRSLLTHFEQYIKLSKK
LON_DESRM       YFRVEVQQYS--EEFEK-------------------GAEVEALMRSLVYQFEQYVKLSKR
LON_HELMI       LIRVRVREHI--EPDVK-------------------SNAVEALMRSLINQFEQYVKISKK
LON_SYNWW       YMKVRVEELR--DKKIK-------------------SPELEALMRNLVGQFEQYVRMSKK
LON_HALOH       YFEVRAEILD--QTVPEV------------------DLEMKALMKAVLNKFQEYIKYNRN
LON_CALS8       YFLVEVEEYKEKGGNLD-------------------DPELEALIRNVVSAFEEYARLTSR
LON_CLOD6       YFRAVIEEIVFDSDNLDSE----------------TEVEIEAFVRNVFDAFEEYINIGNR
LON_CLOAB       FIEAEITEFK-DEDNYE-------------------EYEIKALMRIITKEFGKYVKLSGA
LON_FINM2       FLEANVEVMEYDKTKYHP------------------TDKSLTMIRMIISSFESLAEIIKK
LON_ELUMP       NSWFASVFYPADEKVSG--------------------PEVTALMRQLLDEFEEYATVSRR
LON_UNCTG       YIEVGLKVFDENTLKM---------------------PEVEAIMRQTIALFEQYVKLNPR
LON_FERNB       FFKFEIEILRTRYGKSK---------------------RLIALMRMVKEELHKYVQYSRK
LON_PSELT       PFLVKLEILKVNYRKTK---------------------KLEALIRSVRESFAKYAYYTQR
LON_COPPD       FLEGNYEVLEEVEGDAT---------------------RTEALVKATIARFEEYARLSGR
LON1_THET2      YLRAVGEAIPEPPLKDP--------------------ELARVLVNEVQEAFERYLQNHKT
LON_AQUAE       HYVAQVDVIEERDIPPESQ-----------------TIEDKALIKAVKESIDKLVSLGKQ
LON_SULSY       YYQVGVEIIED---PEVEE-----------------TLEVQALKHSLKDLLDKAISLGKQ
LON_GEOLS       FHTVRIERLVEP-VAVDN-------------------LETEALMRTVREQLAKIAELGKQ
LON_GEOMG       AYTVRIERIVEPSVPEES-------------------LETEALMRAVKEQLTQIVSLGKA
LON2_BDEBA      SFEVAVEKIEETPVQKTV-------------------VENEALIRTAKEHIERIIALGRP
LON_DESAL       MFRVRIELLHEEDLGDLD-------------------METEALMRNVKESCEKILGLRGE
LON_LAWIP       YLTATVELLQEPQPTVKP-------------------TEQEALLRYAREQCEKILALRGI
LON_CHLAD       FYRVRCRPYTDPPVSGL---------------------EVEALMETVKQQVDEFVEHLGE
LON2_HERA2      YINAQVQIIEPDHESSL---------------------AIEAMMRGVLASYEKVVKLSRT
LON_KORVE       YMRATVETVPEAFP-P-------------------KSAEIEALQRNVLTLFQQIVTGSPT
LON1_HERA2      YYRAKIRVMPDALAES-------------------EQLEVTALMRSIGTIASQIAPLIPQ
LON_DESOH       YLEAAFAQIT-ENEK--------------------KDKETEGLMSNISNVYQELVRISPA
LON_SYNAS       YIQARVEKIE-ADILI-------------------KDLEIEALMANLSTLFDRVIKLSPF
LON2_SYNFM      YLEAEVEAVP-EDRS--------------------TSPEIEALALNLRMGFQKFVSLAS-
LON_DICT6       YFKAKVEVIE-EKVE--------------------KTVEIEGMMRNLLNLFQKMASLIPQ
LON_ROSCS       YPQARVAIHR-DPAV--------------------LSVEVSGLARAALAAFQQIIQLSPT
LON_GEOBB       VALSRLEPVR-EFAE--------------------KSMVSEALVGSLNALLKIALSYGRP
LON2_PELCD      FAMASVSLIP-EREN--------------------RNSVAQALMQSIIALLRVAQSLGQM
LON_ANADE       YLKARIEAVEDR--SVVDD------------------VEVEALAINLKKLAREVIELMPE
LON2_MYXXA      YLKARVDAVEDK--TSSEN------------------VEVEALGINLKKLAREVIELMPE
LON2_SORC5      YMRARIERIPE---SLVRD------------------VELEALGAGLREATREVLGLMPN
LON4_SORC5      TWRAEGTLAPE---FLGDA------------------EEARLLAASLRERAREV---GPK
LON_METSB       YLAARVKRIEE---PDERS------------------PDIEARFVHLQGQASEALQLLPQ
LON_PHEZH       FLVARGRRIPE---PEAEG------------------AAIEARFLHLRSQALEALQLLPQ
LON_PARPJ       FRAARVEFLPE---TTARN------------------PAVDARALVLRQRAGEMIGLLPN
LON_MYCSM       AALWVQVEEVT---DPEPT------------------DETKKLAGEYKKLLLAMLQRRD-
LON_SALAI       AALWVEAAELA---EPAPA------------------GRARELAREYRALMTSVLQQRG-
LON_CHLAA       YLRFRFTRRPD---VFERT------------------PELEQLMVEVHAAIDAVLELRPG
LON_DEIRA       YLTADIEPLDA---GKSGG------------------VELQALSRELKDKFETVASGG-R
LON2_THET2      HLEARGEVLAD---EPGEP------------------ILVKALVREVKDKFQALLKEGKY
LON1_SORC5      VIRAPVIELADLPLRPEED------------------GALEALSREVRERAVEYGRHRGA
LON_NITOC       YLSLKIATLSEPSDTGT---------------------EIEALHRTVIELAGKMIELVQP
LON_FUSNN       EYVTTYTVIKETLKDSK---------------------ETEAIYRKVFTRFEKYVSMIGK
LON_MYCA5       SVTEVEYSGNFDILSDYRS---------------KAKMLIEKLSNLHDEIGSYIYGGRRG
LON_MYCMO       NLSL------YPVLKNENG---------------SSETIIEKMQTSLNNI----------
LON_MYCH2       DFIVTEKVQLVELINDPQNPKVGQIIIKPVRETIKSPEIHINLINDLLEMARKAKNFRIP
LON_MYCGE       N-EVSYQLLNSTVKDEANV-----------------DRFLQRIFPEKEEIEQ-LMEGAEK
LON_MYCPN       T-KYDHHFLNSTLTENKAL-----------------DKLLERIFPDKEDFAE-ILDSLNS
LON_MYCPE       DGEIKTKFFYADYSEIEED-----------------TKLSK---SNEEAIKD-LHAKFEN
LON_UREP2       AIEYEYEDVITNPILSNKD-----------------EIAINGINSEIFNIIN-KRSR-HK
LON_MYCMS       IIYAIGSVFEDKLPKTDAQ-----------------KTKIKEALEELQEKHS-FNTSELL
LON_AYWBP       FLKVSYEKVKTVYGSIEEE-----------------KALIKLVIEKIMDKPF--------
                                                                            

LON_CAMC1       FPPDLLKTIE------ESAEAVRVCDLVSSALR---LKKQIAYSFFVEENLEQRLLKLID
LON_CAMJE       FSPDLLRTIE------EGFDASRICDLILNTVR---IKKQVAYEFFVLTDLEQKLVKLID
LON_HELPY       FPPDLIKALE------DNDDPNRIADLIAAALH---LKKDQAYSLFANNNTEQRLLDLID
LON_HELPJ       FPPDLIKALE------DNDDPNRIADLIAAALH---LKKDQAYFLFANNNTEQRLLDLID
LON1_BORBU      --PEVQLNM-----VNIEDK-GKLCDIVASTIS---SSKNDHQIVLETLNVKDRLKKVLE
LON_BORDL       --PEFQLNM-----VNIEDK-GRLCDVVAGMIA---SSKESHQEVLETLSVKDRLKKVLE
LON_LEPIC       FTEEMKLTM-----LNVNEP-GKMADFVCSILN---LEKEEYQSVIESNILKTRIEKVLL
LON_TREPA       FSEEMRLNM-----INIDHP-GKIADFIASILN---ISKEEQQRTLEILDVRKRMEEVFV
LON_CHLMU       FKEELQIFLG---HSDFTEP-GKLADFSVALTT---ATREELQEVLETTDMHDRIDKALV
LON_CHLTR       FKEELQIFLG---HSDFTEP-GKLADFSVALTT---ATREELQEILETTDMHDRIDKALV
LON_CHLPN       FKEELQIFLG---HSDFTEP-GKLADFSVALTT---ATREELQEVLETTNMHDRIDKALI
LON_PARUW       FKEELQIFLG---HSDFTEP-GKLADFAVALTT---ASREELQDVLETFDIRKRIDKALI
LON1_DESPS      FREGLSLLIE---RINLHEP-GSLADFSAAMTT---SSGPEIQKVLATRSVRKRIELALV
LON1_PELCD      YSEEIKMFLN---RQSMDDP-GRLTDFAANLTS---GDGQLLQEILETIDVRNRIDKVLV
LON_MAGMM       YQEQVKMFLS---RHNFSEP-DRLADFVASMTS---SSREELQEVLETLPIMARLEKVLT
LON2_HYDCU      YSEELKYFLN---RYSASDS-QHLADFAASLTA---ASNEKLQDLLDTLDLSERLEKVLS
LON_CLOB8       -SEKFMLAVE--GQKDLNKLMGYLSHFMQISS-------EEKYDLLETQSLKDRGLKFID
LON_METBF       -SEQFTKSID--KMDSIDQIMGFVMPYIPVKL-------AEKQRLLELASVRERYLLFLH
LON_METST       -TDKYTRKIL--GKLDTQDKLAEVFPFLKVPI-------NKKQELLELDSVKIRALKVIQ
LON1_BDEBA      NTRQIREMIA--EIEDLQTLVNMCAAYADINI-------SDKQEILEIPLLKDRALKLLD
LON_CYTH3       -IPQDAQI----AINNIESE-NFLTHFLSSNIN---AELKDKQKLLEFDDAVERATWLLQ
LON_FLAJ1       -IPSEATF----AIKNIESQ-SFLINFVSSNMN---LSVKEKQGLLSINGLKERALETLR
LON_PARD8       -PPRDLIF----SIKNNKNV-LYVVNFSCSNIP---SGSAEKQQLLLIGDLKERAYRLLF
LON_PORG3       RPPRELIL----SMRRNKNP-MYQINFASANIS---TSIAVKQELLEISKMKDRGYRLLY
LON_AMOA5       -FPTEIKL----LLDNINDF-NLLTYFLASGLD---TDIKSKQKLLEIHDSKKRGTVLLK
LON_CHLT3       -SPNEASY----AIQSIENT-RFLIHFIASNIS---VPAAEKQKMIEAEGMKARAERLIH
LON_ACIB3       -NARELVA----AANKIEDL-LQLMFFVATRV---PLNIEIKQKFLEYDEFEAHLQELMN
LON_DICNV       -SADELLE----TLRGINDI-GRISDTIAAHM---DFRIEERVHLLAMEDAYERSQRLMI
LON_BRUAB       -ISPEVVG----AASQIDDY-SKLADTVASHL---AIKIPEKQEMLSVLSVRERLEKALS
LON_BRUA2       -ISPEVVG----AASQIDDY-SKLADTVASHL---AIKIPEKQEMLSVLSVRERLEKALS
LON_BRUME       -ISPEVVG----TASQIDDY-SKLADTVASHL---AIKIPEKQEMLSVLSVRERLEKALS
LON_BRUSU       -ISPEVVG----AASQIDDY-SKLADTVASHL---AIKIPEKQEMLSVLSVRERLEKALS
LON_RHIME       -ISPEVVG----VASQIEDY-SKLADTVASHL---SIKIVEKQEMLETTSVKMRLEKALG
LON_AZOC5       -VSPEVVG----VVGQIEDH-AKLADTIASHL---AVKIPEKQAVLETVKVADRLEKVLG
LON_AZOBR       -IPPEVLV----SINQIEEP-GKLADTVASHL---ALKIPEKQQLLECATVSERLERVYA
LON_CAUVC       -VPPEALA----SIPQIAEP-GKLADSIAAHL---SVKIGDKQNLLEIFDVVKRLEKVFA
LON_CAUVN       -VPPEALA----SIPQIAEP-GKLADSIAAHL---SVKIGDKQNLLEIFDVVKRLEKVFA
LON_BUCAI       -IPLEILN----VLNNIKNS-EKLADTIAAHM---PLKLNDKQSVLEIRNINDRLEFLMA
LON_BUCAP       -IPSEILN----TLSQTKNA-EKLADTIAAHM---PLKLADKQSVLEIYNVNERLEFLMA
LON_BUCBP       -ISPEILN----SLNNITNA-SQLSDMIAIHM---PLKLSEKQSILETYNTNERLERLMA
LON_ECOLI       -IPPEVLT----SLNSIDDP-ARLADTIAAHM---PLKLADKQSVLEMSDVNERLEYLMA
LON_ECOL6       -IPPEVLT----SLNSIDDP-ARLADTIAAHM---PLKLADKQSVLEMSDVNERLEYLMA
LON_SHIDS       -IPPEVLT----SLNSIDDP-ARLADTIAAHM---PLKLADKQSVLEMSDVNERLEYLMA
LON_ERWAM       -IPPEVLT----SLNSIDDA-ARLADTVAAHM---PLKLSDKQSVLEMSDVDERLEYLMA
LON_VIBPA       -IPPEVLT----SLNGIDEA-ARLADTIAAHM---PLKLVDKQQVLEIIDVTERLEFLMG
LON_HAEIN       -VPTDILN----ALQRIDDV-DRLADTMAAHL---PVSIRHKQNALELANVQERLEYLLG
LON_XANOR       -LPPELLQ----TLAGIDEP-GRLADTIAPHI---GVRLADKQRLLEITDIGERLELLVG
LON1_HYDCU      -IPSEVLK----SVQKITDP-NRLVDTISANL---KLGIEEKQTLLEILTINDRLEHILK
LON_FRAP2       -VSKESLA----TLINTEEP-HKFIYEISTIL---NTEIAKKQKILEATDIKNKALLLLS
LON_NEOSM       -TIPDEII---GLLSQIDST-SRIADLVTASI---NLKLSVKQEILETVDLLERIKKVHA
LON_WOLPP       -SRPEIII---DPIDQVKEV-NQIVDMIASHL---NIKVSDKQNILEVYNPKERLKKVFA
LON_RICCN       -VNAEIIETINKEISNSTNF-IDIINILASHL---ITSLEAKQHLLEETSPFKRITTVIS
LON_RICFE       -VNAEIIETINKEISNSTNF-INIINILASHL---ITSLEAKQHLLEETSPFKRITTVIS
LON_RICPR       -VNAEIIETINKEISNRTNF-INIINILSSHL---ITSLETKQQLLEETNPVKRITTVIT
LON_RICTY       -VNTEIIETINKEISNKTNF-INIINILASHL---ITSLETKQQLLEETSPVKRITTVIT
LON_RICBR       -INAEIIETINKEISETSNF-INIINILASHL---ITSLEEKQRLLEETSPFKRISTIIN
LON_ORITI       -INPDLLV----HVLSYTNQ-SYVVNALAANL---ICNVANKQSLLEITDVKQRIERLTD
LON1_MYXXA      -IPPEMLM----QVASIDDP-ARLADTIVAHL---SLKLNDKQALLETESPAKRLEKLYE
LON3_SORC5      -IQPEVLM----AVQAIDEA-SRLADTIIANLP--TIKLTDRQALLEMEEPQKRLERLIE
LON1_SYNFM      -INQEILD----AVAAIDNA-SRLADTIAAYM---PFKLDVKQKLLETLGVAKRLEKLFG
LON2_DESPS      -IGEEVVV----SCSSIEDP-VKLANVICSHL---PLSSKEKQEVLEVETLGGRIELLLE
LON_DESVH       -LAQETLV----AISALSDA-ARLADAIMPHL---KVDYRRKQELLEVESGAERLEKVYE
LON_SOLUE       -LNYETMV----AAIRVDEP-GKLADTVGANL---QLTIEEKQELLEIFDPIDRLTRVAE
LON1_BACSU      -ISAETYA----AVTDIEEP-GRMADIVASHL---PLKLKDKQDILETADVKDRLNKVID
LON_BACAH       -VSNETFA----TVADVEEP-GRLADLIASHL---PIKTKQKQEILEIISVKERLHTLIS
LON_BRECH       -VSPETLT----SVQDIEEP-GRLADVIASHL---PLKMKDKQEILETVNIQERLEILLT
LON_DESRM       -IPPETVV----SVVNLEEP-GRLADIIASHL---ALKIEDKQNVLESVEIVDRLEKLCG
LON_HELMI       -IPPETFV----SVVAVEDP-GRLTDTISSHL---TLKTQDKQRILEALDVTERLEILTE
LON_SYNWW       -IPPETVV----SVVAIEEG-GRLADVIASHL---NLRINEKQRILELSDINKRLNYLCE
LON_HALOH       -LPSETIM----TVTNIEEP-ARFSDTIASHL---ELKFRQEQDLLEAISIKERLNKLLE
LON_CALS8       -IPPDAIL----SVTTIQNP-GQLADVIAANV---IVKLEDKQLLLEQVDLKERLTKLYE
LON_CLOD6       -VSPEILI----SLADIEDV-DRFIDTIAANI---YLKSSQKQEILEEFDIRKRLELIYS
LON_CLOAB       -VTKDAVD----FLKDIKEP-GKFADIVSSYL---IIKQEQKQSVLNSIDEKERLENVLT
LON_FINM2       PLPQDLLG----GLLNEEDP-SSLIDTIAMLI---SLNDKDSILLLETLDMDERIELVYK
LON_ELUMP       -IAVEGVS----FFRQIEDP-SRLADTIASNI---IVKTSDRQDVLEAVNPKDRLELLIK
LON_UNCTG       -IPIDISV----SVSNIADP-ARLADTIASHL---VIKNNDKQTILELVDPVKRLEKIIQ
LON_FERNB       -IPPETLM----LLEDVDNP-DVFADIAASLC---PGNIEEKQQLLEIVHPANRLERILD
LON_PSELT       -YSQETLS----AMSEISDA-NRLADFVASLL---PLQLKQRQSLLEQLKPAKRLEMILE
LON_COPPD       -IPIEVVA----GIGGLDNP-GKIADMVAANM---FISYYEKQKVLELLSIPERLEHVLQ
LON1_THET2      LRLDRYQQ---EAVKSTRDP-AILADLVAHHA---TWTLEEKQTILETPEVEERLKRVLA
LON_AQUAE       -IIPDLVV----LIKELEEP-GKLADMVASIL---DIKSSQAQEILETFDPRERLKKVYK
LON_SULSY       -IVPDLVE----IIKSVEEP-GRLADLVASIL---DIKAEEAQQILEILDPVERLRVVHD
LON_GEOLS       -ISPEVMV----ILENITDP-GSMADLIASNL---GLKLSEAQMLLEIEDPVRRLTKVND
LON_GEOMG       -VSPEVLV----IVENMQEP-GSLADLIASNI---GLKVDDAQALLEIIDPVQRLQKVNE
LON2_BDEBA      -LSPDILL----VLDDVSDP-GRIADLIASNL---GIKVQDAQKVLETSDATERLKLVNE
LON_DESAL       -LTPDVTM----VLDGIDHP-GRLADLVASNL---NLKIEEAQSIFETIDPVQRLLAVNG
LON_LAWIP       -PTGEIMG----VLSNVNEP-GRLADLIAANL---RLKTEEAQEILQCLEPIDRLHLVIT
LON_CHLAD       -VPQEAVQ----FVHRIDRP-GHLADIVTWGP---AFDFKDRLEVLNTLDPVERLRKVYL
LON2_HERA2      -MPDDAYV----AALNLEDA-SALADLIASTL---PLDIVRRQQLLELFEVEERLRRLSV
LON_KORVE       -LSDELST----VAMNIEEPGRLVDFVASSLP---SLSTKDKQEILETADVQIRLDKINQ
LON1_HERA2      -FPTELLN----SVLSEEDP-RRLAYLVASYA---RMSVTDRQAVLAEPSIKQKLLKLNE
LON_DESOH       -IPNELGA----MAVTIDEP-GSLADMVASTI---NSSTEEKQNILETLDVKLRLKKVTR
LON_SYNAS       -LPQEFAA----MAKSIQEP-GDLADIIASIV---NASVEDKQKILETLDIRQRLREITL
LON2_SYNFM      -LPLDLAN----FALNAERP-MQLVYAVASHL---ALSVVERQSILEMPETKAALEHVTF
LON_DICT6       -FPEELLI----NAMNIQEP-GRLADFIAFNT---NLNINEKQEILETIDVKERLQKVTY
LON_ROSCS       -LPDELAI----VAANTAQP-GMLADLIAANL---NLKPEDQQLVLDTLDVQERLRQVLS
LON_GEOBB       -LPDDVMK----MIDFIDNP-ARLSDLVALYL---NLPIDELQKLLETVDPLERLKKVYM
LON2_PELCD      -LPEDAHH----AIDRIDES-GKLADSLAVYL---NMEVKDQQRLLETLDPLERLKDVYL
LON_ANADE       LPAAATELVE-----SIT-HPGHLADLIAAN---VDVPIEEKQQVLETVELKARMKLVLE
LON2_MYXXA      LPAAATELVE-----SIT-HPGHLADLIAAN---VDVPIEEKQAVLETVDLKARMKLVLE
LON2_SORC5      LPRDTAGILD-----NVR-EPGALADLIASNFPQAQASVGDKQEILEAFDVKARVRLVLA
LON4_SORC5      TGTNLAEIAA-----TSRAEPGVFADQVAGA---LGLPTEKEMEVLSELRVVPRLQRVAG
LON_METSB       TPP-ELIAAV-----NSAPSPGALTDLVAAY---MDASPAQKQDILETIDLRARMDMVAK
LON_PHEZH       SPPGELVAAV-----EGASSPAALADLVAAY---LDLQPPEKQQILETIDLEARLDKVSA
LON_PARPJ       AGG-ELVRAL-----DAIELPGLLADTIAGL---LDIPPERKQEILETLDVCKRLDKVLD
LON_MYCSM       -AWQIVDMVN-----KIT-DPSALADTAGYA---SYLTGTQKRELLETTDVDRRLSLLIG
LON_SALAI       -AWQVIDAIE-----RMT-DLSELADSAGYV---SWLSLAQKTELLAAPDVTTRLELLVG
LON_CHLAA       VTQEIRNFVR-----SID-DPGHLADNTGYS---PDYTFAERQELLETFDVSERLRKVLM
LON_DEIRA       INAESVQTIN-----SKD-DIGEMADHIAFN---LDFKLEDKQAILEAANVTERLKKLLT
LON2_THET2      LAPEVAQFIL-----NLE-DPSQLADYVAFH---MDFRLEDKQKVLETANVAERLRAVLV
LON1_SORC5      PEDVLKQFVG-----SMY-GPAELVNHIAFY---LDLPTPEKQALLEILSTEERMRSLAL
LON_NITOC       QIQVGIHH----IISDVEKP-LHQIYLLTSIL---SLDFDKEKELLAAATQVEALQLMHR
LON_FUSNN       FSSELILN-----LKKIEDY-SNGLDIMASNL---NISSEKKQEILEISNVRDRGYRILD
LON_MYCA5       IKELEKAFSANTNISPLTHDSFNVDIWKIIDALTIEHSWKEYFAIINETNLEKNYELAIN
LON_MYCMO       ---IESNLPLVANQELSKHES--SERYTYILAHYLTMPFEKKFEIFAKKSLTEMLELIFS
LON_MYCH2       TELLLIVDKFGANSEYSTNEY--IKGVTNTLSCSPSLTYPQKYQLFSYNSYPAKIKKLYE
LON_MYCGE       FLELENISKTVNVPKG----LKQLDIITFKLANLVPNTESIKQAILEENEIANRLEKIIQ
LON_MYCPN       FLELQELKKLSKVPKD----IKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKIIG
LON_MYCPE       ELNNLTFFPKKDLALS----KENRHTIVDWLPIALKFSLEEKQQLLEEPSLSKRIEKILS
LON_UREP2       NINFDNMHALISLEKEKFAYLAAATYINDYDNEISEKTIEDRINILLQPNLLLVHETILH
LON_MYCMS       LVFNENDFNKLNSLIYQIIDKMPLVSLNTKLLLIQSTSILEKLELLKELIINRPKSTIKL
LON_AYWBP       QLLVQNTNNFLDIIKT----EPETENITDIIIFNLKIDDLDKYKYLKESHLNKRIFYILQ
                                                             :              

LON_CAMC1       YVIEEI--------------EANKLQKEIKNKVHSKIDKTNKEYFLKEQLKQIQAELG--
LON_CAMJE       LIAQEI--------------EANKIQKEIKNKVHSRIDKVNKEYFLKEQLRQIQKELG--
LON_HELPY       IVIEET--------------KTQKLQKEIKSKVHQKMEQTNKEYFLKEQLKQIQKELG--
LON_HELPJ       IVIEET--------------KTQKLQKEIKSKVHQKMEQTNKEYFLKEQLKQIQKELG--
LON1_BORBU      LIYEEL--------------NLIEIQNKIAKGIQERLEKQQKEFFLKEQLKAIKAELGIG
LON_BORDL       LLYEEL--------------NLIEIQNKIAKGIQEKLEKQQKEFFLKEQLKAIKTELGVG
LON_LEPIC       FLKKEI--------------ELVSIQREISDQIQDKIDKQQRQFFLREQLKAIQNELGIK
LON_TREPA       YIKKEK--------------DLLEIQRKIQNDLNSRVEKNQREYFLREELRSIKEELGLT
LON_CHLMU       LLKKEL--------------DLSRLQSSINQKIEATITKSQKEFFLKEQLKTIKKELGLE
LON_CHLTR       LLKKEL--------------DLSRLQSSINQKIEATITKSQKEFFLKEQLKTIKKELGLE
LON_CHLPN       LLKKEL--------------DLSRLQSSINQKIEATITKSQKEFFLKEQLKTIKKELGLE
LON_PARUW       LLKKEL--------------DISILQHNINQKIEATINKSQKDFFLREQLKTIKKELGIE
LON1_DESPS      LIKKEL--------------EISKLKVKISSRIEEQLSKQQREFFLKQQLQEIKKELGLT
LON1_PELCD      LLKKEL--------------EVSRLQTKISKQIEQKVSAQQREFFLREQLKAIKKELGLE
LON_MAGMM       LLKKEL--------------EVVKLQNKIQRQVEEGIAEHQRQFFLREQLKEIQKELGIT
LON2_HYDCU      LFKHEI--------------EVTKLQFNIRERVEENLSQQQREFFLHQQLKEIQKELGMV
LON_CLOB8       YLLKQK--------------ESLKLQFELAEKFTEKANKNYRETVLREQLKAIQEELN-E
LON_METBF       ILTKHK--------------ENINLQIEMAKKVTDKISKSNREAMLREQLKVIQEELN-E
LON_METST       LLLEQK--------------DAIGIQMELAKKLNKKMNETHKNTLLREQMKLIQEELN-M
LON1_BDEBA      RLQELK--------------ERLKIQRGIRDKLQESFQQNQKESILREQMRVIREELG-D
LON_CYTH3       LMDKDI--------------QMLEIKREIHTKVHTDIDQQQRDYFLRQQIKVLQDELG--
LON_FLAJ1       YMNVEL--------------QKLELKNDIQSKVRFDLDQQQREYFLHQQMKTIQEELG--
LON_PARD8       ILNREY--------------QLVELKASIQMKTHEDINQQQKEYFLQQQIKTIQEELG--
LON_PORG3       LLHKEL--------------QVMELKASIQMKTREEMDKQQKEYFLQQQIKTIQEELG--
LON_AMOA5       YLLKDL--------------EVSKLRKKIQDKVHTDIEQLQHDFYIRRQIKVLQEELG--
LON_CHLT3       FLNREV--------------QVLELSKQIQTKVKTDMDRSQREFILRQQLKTIQQELG--
LON_ACIB3       YLMNQS--------------AEQQIEQTLHDSVKRQMEKNQREYFLNEKMKVIQRELS-D
LON_DICNV       LLAQES--------------EKNELNKKIKNRVKQQMERNQREYYLNEKIKAIQKELG-E
LON_BRUAB       FMEAEI--------------SVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAIQKEL--G
LON_BRUA2       FMEAEI--------------SVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAIQKEL--G
LON_BRUME       FMEAEI--------------SVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAIQKEL--G
LON_BRUSU       FMEAEI--------------SVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAIQKEL--G
LON_RHIME       FMEGEI--------------SVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAIQKEL--G
LON_AZOC5       LMESEI--------------SVLQVEKRIRTRVKRQMEKTQREYYLNEQMKAIQKEL--G
LON_AZOBR       FMEGEI--------------GVLQVEKRIRNRVKRQMEKTQREYYLNEQLKAIQKEL--G
LON_CAUVC       LMEGEI--------------SVLQVEKKIRSRVKRQMEKTQREYYLNEQMKAIQREL--G
LON_CAUVN       LMEGEI--------------SVLQVEKKIRSRVKRQMEKTQREYYLNEQMKAIQREL--G
LON_BUCAI       IMESEI--------------DLLQVEKRIRHRVKKQMEKSQREYYLNEQIKAIQKEL--G
LON_BUCAP       IMETEI--------------DLLKVEKRIRNRVKKQMEKSQREYYLNEQIKAIQKEL--G
LON_BUCBP       IMESEI--------------DLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKEL--G
LON_ECOLI       MMESEI--------------DLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKEL--G
LON_ECOL6       MMESEI--------------DLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKEL--G
LON_SHIDS       MMESEI--------------DLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKEL--G
LON_ERWAM       MMESEI--------------DLLQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKEL--G
LON_VIBPA       QMESEI--------------DLLQVEKRIRGRVKKQMEKSQREYYLNEQMKAIQKEL--G
LON_HAEIN       MMESEA--------------DILQVEKRIRGRVKKQMEKSQRNYYLNEQIKAIRKEMDGG
LON_XANOR       LVDGEI--------------DVQQLEKRIRGRVKSQMEKSQREYYLNEQMKAIQKEL--G
LON1_HYDCU      TIETEI--------------DLLESEQRINSRVKKKMDQTQRNFYLNTKLQAIHEELG-D
LON_FRAP2       CLYEEL--------------EILELEAKIKDRVKSQVDKNQREYYLNEQVKAIYKEL--G
LON_NEOSM       LLEKEL--------------GVLQVKQQIKEKTESQIKKSHKVYLLNEQLKAITKELYDK
LON_WOLPP       LIEREI--------------SILSAQNRLYKTIKSQVESTQKVYYLNEQLKAIQKELGEF
LON_RICCN       MLNSNI--------------VNSETEQALQKRVRKQIEKTQRDYYLHEQMKAIQKELDED
LON_RICFE       TLTSNI--------------VNSETEQALQQRVRKQIEKTQRDYYLHEQMKAIQKELDED
LON_RICPR       TLTSNI--------------VNSETEHALQQRVRKQIEKTQRDYYLHEQMKAIQKELDED
LON_RICTY       TLTSNI--------------VNSETEHALQQRVRKQIEKTQRDYYLHEQMKAIQKELDED
LON_RICBR       ILTSNI--------------VNSETEQALQQRVKKQIEKTQRDYYLHEQMKAIQKELDED
LON_ORITI       HVAKEI--------------IIMETDELITSKAQKNLEKMQRDCFLNEKMKIIKNVLGVD
LON1_MYXXA      LMQGEI--------------EILQVEKKIRTRVKKQMEKTQKEYYLNEQMQAIQKELG--
LON3_SORC5      LMQAEI--------------EILQVEKKIRSRVKKQMEKTQKEYYLNEQMQAIQKELGGG
LON1_SYNFM      QIRSEI--------------EILQTEERIKGRVKKQMEKTQREYYLNEQMRAIQKEMG--
LON2_DESPS      ILFREL--------------QLAEVERKINIKVKQKLSRAQRDYYLGEKIREMQKEIG--
LON_DESVH       LLQGEI--------------AVASLEKRIKSRVKNQMERNQREYYLNEQIKAIHKEMG--
LON_SOLUE       MLDIEI--------------EKLNVDRTIQGRVKRQMEKAQKEYYLNEKIKAIQKELG--
LON1_BACSU      FINNEK--------------EVLEIEKKIGQRVKRSMERTQKEYYLREQMKAIQKELG--
LON_BACAH       IIQDEQ--------------ELLSLEKKIGQKVKRSMERTQKEYFLREQMKAIQTELG--
LON_BRECH       ILNNER--------------EVLELERKIGNRVKKQMERTQKEYYLREQMKAIQKELG--
LON_DESRM       IVAKEL--------------EIVELERKINIRVRKQMEKTQKEYYLREQMKAIQKELG--
LON_HELMI       ILAREM--------------EILELERKINVRVRKQMEKTQKEYYLREQIKAIQKELG--
LON_SYNWW       LLAKEM--------------EVLELERKINIRVRKQMEKTQKEYYLREQIKAIQKELG--
LON_HALOH       IIKDEI--------------EILKVEQKIQKKVRKQVEKTQKEYYLREQLKAIKEELD--
LON_CALS8       LILREK--------------EIIEIERKITIKVKKQIDKMQKEYYLREQLKAIQSELG--
LON_CLOD6       ILLEEI--------------DILKIEKKITLRVKKQMNKVQKEYYLREQLKAIQKELG--
LON_CLOAB       VIKDEL--------------QILELERNIGVKVKEKIDKSQREYYLREQIKVMQDQLG--
LON_FINM2       FVIKEI--------------EFLKIKEDIEERTNKEISDTQKEYFLQEQLRQIKMELG--
LON_ELUMP       ILANEV--------------EIISLEEKIHSKVRAQIEKNQKEYYLNEQMKAIQKELS--
LON_UNCTG       ILNAEI--------------EILNIERRIQNRVRNQIEKTQKEYYLTEQMKAIQKELK--
LON_FERNB       ILARET--------------ELLEIEQQLDQKVKERIEKSQREYYLREKLRVIRDELGG-
LON_PSELT       ILSHEN--------------EILEIERELDTKVKKRIEENQKEFFLREKLKAITEELG--
LON_COPPD       LLLREI--------------EVLKLSQEIEETVRERMEKNQREYILREQLKAIQEELGEK
LON1_THET2      LLLRDL--------------ERFELDKKIAARVKEQMDQNQREYYLREQMKAIQKELG--
LON_AQUAE       FLQDEI--------------GLLEVKQRISEIARERMEKEQREYYLRQQLKAIQEELG--
LON_SULSY       KFLKEV--------------GILELQQKIRISAREAIEKDQREYFLRQQIKAIQEELG--
LON_GEOLS       LLAREH--------------EMLSVQAQIQNAAREEMGKNQKEYYLREQMKAIQQELG--
LON_GEOMG       HLNKEH--------------ELLDMQVKIQSAAKEEMGKSQREYFLREQLRAIQQELG--
LON2_BDEBA      ILAAEL--------------EVMQTQSKNRTGAKDDMSKSQREYFLREQMKAIKNELG--
LON_DESAL       FVSREV--------------ELSAMQARIQSSVRDEISKSQKDYFLREQMRAINRELG--
LON_LAWIP       HLTHEA--------------EVATMQVKIQTSAREGMDKAQKDYFLREQLKAIRKELG--
LON_CHLAD       VLARQL--------------ELLKLRVKIQQDTKEVLDQSQREYFLREQLRIIRRELG--
LON2_HERA2      VLSQEI--------------DVLELEHHIQNQVQKEVDKSQRDFFLREQLKAIQTELG--
LON_KORVE       HLAKEL--------------EVQQLRNKIQSEVQDRVQQTQREYYLREQLKAIQKELG--
LON1_HERA2      VLTREL--------------NVLQIGQQIQSQVQDEMSKTQREYVLREQLKAIRKELG--
LON_DESOH       QLNHQL--------------EILKLGDKIQSQIKEDMDKQQKEFYLRKQLKAIREELG--
LON_SYNAS       IVNHQL--------------EILELGSKIQSQVQEDIDKSQRDFYLRQQLKAIREELG--
LON2_SYNFM      YMTRQL--------------EKLELAQRIQDRVKSVMDKRQRDYYLREQLQAIRKELG--
LON_DICT6       YLTREL--------------EILEIANKIQNEVKNEIEKSQKEYFLRQQMKAIQKELG--
LON_ROSCS       FLERER--------------EILTIGRKAQEEMS----KSQREYVLRQQLEAIKRELG--
LON_GEOBB       HLTNEV--------------QRLQIKGEVQAEVTKKVGKSQKEFLLREQMKQIQEELG--
LON2_PELCD      FLTTEI--------------QKMQARGGGSADRSRQAVRSQKEHLLREQLKHIQNQLG--
LON_ANADE       LLNRKR--------------EILKLSNKIDSAVKGEMSKTQREYYLRQQLKAIKEELG-E
LON2_MYXXA      LLNRKR--------------EILKLSNKIDSAVKGEMSKTQREYYLRQQLKAIKEELG-E
LON2_SORC5      MVGRQL--------------EVLRVKKEISSMVQEEMGKSQREYILRQQMKSIKEELG-E
LON4_SORC5      LLAEAS--------------ALADLKKKIDGDVRRELGKGQREVILREQLRAIQKELA-G
LON_METSB       LLAQRI--------------EVLRLSQEIGRQTKASLDERQREMLLREQMASIQRQLG-E
LON_PHEZH       FLAQRL--------------EVLRLTSEIAQRTRQSLGERQRETLLREQMAAIQRELG-E
LON_PARPJ       AVAGRI--------------EVLRLSQEIGEQTRGRIDQRQREMMLREQLRTIQNELG-E
LON_MYCSM       WTGDHL--------------AETEVNDKIAEDVRTGMEKQQKEFLLRQQLAAIRKELG-E
LON_SALAI       WVRAHL--------------AEQEVAEQINTDVREGLEKSQREFLLRQQLATIRKELG-E
LON_CHLAA       FYRKQF--------------ALLEVQAKLRQEVQESAARQQREFYLRQQLRAIQKELG-E
LON_DEIRA       LLDTEQ--------------EVQAVQAKIRAQVKEEIDKNQREYYLREQMKVIQKELQ-G
LON2_THET2      LLEAEL--------------ALIETQRRIQQQVKEEIDRNQREYFLREQMKAIQRELH-G
LON1_SORC5      HLYRQI--------------GIVETQEKIRTTVEEELGERQREIYLREQLRAIQKELG-E
LON_NITOC       YLNHEV--------------QVLEVRQKITSTAQTEIDKKQREYVLRQQLEAIQEELG--
LON_FUSNN       EIVAEM--------------EIASLEKTIDDKVKNKMNEAQRAYYLKEKISVMKEELG--
LON_MYCA5       MLINAI--------------KMGKLDEEVNSTMRGDLENQQRDFLLRERLRQIKKLLK--
LON_MYCMO       FLVELK--------------NIQKLDVDLDKDIKKNLDSQQREYLLRERLKVIQKKLG--
LON_MYCH2       HIHTFA--------------EQIKLEDEINVILKTNLDKQQTEFILKEKIKAIRKKLG--
LON_MYCGE       AGIEDLQKIQDYGRSKNKETEFDKLDSKITRKINEQLSRQQRDFYLREKLRIIREEIG--
LON_MYCPN       SGIEDLGHISEEARAKQRESEFDKIDNRITRKVNEQLSRQQRDFYLREKLRVIREEIG--
LON_MYCPE       FTID--------------ERVSQKIDSEISKKINTNLSKQQKEFYLRERVRAIKEELG--
LON_UREP2       LLFDQL---------VDKRVIEDEVEKTITDKINNNFQKQQREFYLREKLKVVKEQLG--
LON_MYCMS       NNNLN---------------NNSTVDSEINKKLKDKMDKQQKEYYLREKMRIIKEELD--
LON_AYWBP       DIQSLL--------------IGLDLEQKINEKVKQSIDENQKEFYLREKMKAIQLELG--
                                                             :  .:  :   :   

LON_CAMC1       ADTSREEELEEYRKKLDAKKKFMAEDAYKEIKKQIDKLSRMHPD-SADANTLQSYLDWVL
LON_CAMJE       SDTQKEDEVREYQKRLELKKKFMHEDAYKEIKKQIEKFERIHQD-NSEASMIQTYIETAL
LON_HELPY       TDKQRDEDLNQYYQKLESIKPFLKEEAFKEIKKQIDRLSRTHAD-SSDSATLQNYIETML
LON_HELPJ       TDKQRDEDLNQYYQKLESIKPFLKEEAFKEIKKQIDRLSRTHAD-SSDSATLQNYVETML
LON1_BORBU      --DKKSSDLEKLKTKLKA--LELKGEPLEVVEKELEKFSLLETS-SAEYIVVRNYLELIT
LON_BORDL       --DEKNSEFLKMKSKIDA--LALKGEALDAVGRELEKFSFLERH-SSEYIVVRNYLELIT
LON_LEPIC       D-DKFEKKYEKFLERLKN--LNADPEVIEEVTRELDKFSYADPN-TGDYNVIRNYLDILE
LON_TREPA       T-DPKERDQRKFRALIDS--FHFEGEVKEAVESELEKLSLTDPN-SPEYSVGRTYLETVL
LON_CHLMU       K-DDHAVDLEKFMERLNK--RDVPQYAMDVIQDEMDKLQTLETS-SAEYAVCRNYLDWLT
LON_CHLTR       K-DDHAVDLEKFMERFNK--RDVPQYAMDVIQDEMDKLQTLETS-SAEYAVCRNYLDWLT
LON_CHLPN       K-EDRAIDIEKFSERLRK--RHVPDYAMEVIQDEIEKLQTLETS-SAEYTVCRNYLDWLT
LON_PARUW       R-DDKSLDREKFEARLKE--RVVPSDVMKVITEELEKLSVLDMQ-SAEYSVVRGYLDWLT
LON1_DESPS      K-DDTQTEMEKYENRIKD--LHLPEEAQERIDEELEKIRLLGPS-SPEFNVSRTYLDWLT
LON1_PELCD      K-EGKVSEIEKYQKRLKN--LTLSEEAQKTIDEEIEKLRLIEPS-SPEYNVSRNYLDWLT
LON_MAGMM       K-DDRTAEIDRFRERLEK--LTLSEEAEQKIEEELDKLAILETG-SSEYGVTRNYVDWLT
LON2_HYDCU      K-DDRTADADLFQERLDK--LELSEEATKKAEEELGKINMLDPQ-SPEYGVARNWLDWLT
LON_CLOB8       GKSSPSKKDKNYLNRIEE--AQMPDEIKEVALEELGKLESQSPN-SAEYNVIKNYLELLI
LON_METBF       GDDS-ASGDAAYREKIEN--STMPDEVKKKAFSELKKLETGGSH-NPEAPGIRNYLDLLL
LON_METST       TDDT--PAHKTYRERIKD--AQLPKEVEEAALEEVTKLERQGQN-NAEENIIRNYLDTIL
LON1_BDEBA      HEGE--DLFAKFKDKIDK--AGMPPEALELAKNQLRRLETSNSA-SPEYQMIRTHLELMT
LON_CYTH3       DF-SSEQEFERLKEKALT--KKWSDKVRAHFDKEMSKLQRVNPM-APDYPVTFNYLELLV
LON_FLAJ1       GV-SQEEEMDEMGQKAKT--KKWDEKTQKHFEKELSKMRRMNPQ-SPDFGIQRNYLELFL
LON_PARD8       GN-INELEIKELREKASR--KKWPAEVAQVFEKELRKLERLHPQ-SPDYSVQTQYVQNIV
LON_PORG3       GN-INDIEVQELRTKATT--MKWSSEVAETFEKELRKLERLHPQ-SPDYSVQMQYVQTII
LON_AMOA5       EN-EFEDEIDELRAEGEK--KQWPKEVADYFYKALDKAERLSPN-SADYPVLISHAELML
LON_CHLT3       EQDAQMQDVEKLREAVEK--KNLPEEVTSVVSKEIDKLSRIPQA-SPDYSVTRNYVDTIL
LON_ACIB3       MNGGAEDDVAEIEKRLAE--ADLPEHVRKKAEAEFRKLKAMQPA-SSEAAVVRNYLEVIL
LON_DICNV       MDE-AQNDIELLEAQIKK--AKMPVDVEKKALSELNKLKQMSAM-SSEANVIRNYLEWLI
LON_BRUAB       DSEDGRDEVAEIEERITK--TKLSKEAREKALAELKKLRSMSPM-SAEATVVRNYLDWLL
LON_BRUA2       DSEDGRDEVAEIEERITK--TKLSKEAREKALAELKKLRSMSPM-SAEATVVRNYLDWLL
LON_BRUME       DSEDGRDEVAEIEERITK--TKLSKEAREKALAELKKLRSMSPM-SAEATVVRNYLDWLL
LON_BRUSU       DSEDGRDEVAEIEERITK--TKLSKEAREKALAELKKLRSMSPM-SAEATVVRNYLDWLL
LON_RHIME       DSEDGRDEMAELEERISK--TKLSKEAREKADAELKKLRQMSPM-SAEATVVRNYLDWLL
LON_AZOC5       D-EDGRDDLQELEDRIKR--TKLTKEAREKATHELKKLRQMSPM-SAEATVVRNYLDWLL
LON_AZOBR       ETEDGRDESAELEEKINK--TRFSKEARDKALAELKKLRSMSPM-SAEATVVRNYLDWML
LON_CAUVC       DPDDARDELIDLEKRIKK--TKLSKEARTKAESELKKLRNMSPM-SAESTVVRNYLDWLL
LON_CAUVN       DPDDARDELIDLEKRIKK--TKLSKEARTKAESELKKLRNMSPM-SAESTVVRNYLDWLL
LON_BUCAI       DMDEIPDENKILKRKIKS--SKMPKEAREKTELELQKLKMMSPM-SAEATVVRSYIDWMI
LON_BUCAP       DMDEIPDENKILKRKIKS--LKMPKEAKEKTESELQKLKMMSPM-SAEATVVRSYIDWMI
LON_BUCBP       EMDETLDEHEILKRKITT--IKMPKEAQEKMASELHKLKMMSPM-SAEATVVRSYIDWMI
LON_ECOLI       EMDDAPDENEALKRKIDA--AKMPKEAKEKAEAELQKLKMMSPM-SAEATVVRGYIDWMV
LON_ECOL6       EMDDAPDENEALKRKIDA--AKMPKEAKEKAEAELQKLKMMSPM-SAEATVVRGYIDWMV
LON_SHIDS       EMDDAPDENEALKRKIDA--AKMPKEAKEKAEAELQKLKMMSPM-SAEATVVRGYIDWMV
LON_ERWAM       EMDDAPDENEALKRKIDA--ARMPKEAREKTEAELQKLKMMSPM-SAEATVVRGYIDWMV
LON_VIBPA       EMEDAPDEFETLQKKIDE--SKMPQEAREKTEQELQKLKMMSPM-SAEATVVRSYIDWMV
LON_HAEIN       ENEDTIDEVEQLHQKVEA--AGMPADVRDKVENELQKLKMMSAM-SSEATVIRSYIEWMI
LON_XANOR       DLDDVPGELEELARKIAE--AGMPKPVETKAKAELNKLKQMSPM-SAEAAVVRNYLDWLL
LON1_HYDCU      SSEDGVSEFTRLKEQIEQ--AGMTKDALKVAEDELKKLKMMSPQ-SPEANIIRTYIEWLV
LON_FRAP2       EADEES-EVTALKSRIEA--TKMSKEAKEKCLKELKKLKAMPPS-SSESAVSRNYIETIL
LON_NEOSM       E-GEEYDELVDLEKKIGN--GKLSAEAKEKVSKELKKLKNMVPM-SAEATVVRNYVDWII
LON_WOLPP       ENGDEGNILNEFEKKINE--TKLSEEAKEKAITDLKRYKKMNPI-SPEATVISSYLHWLL
LON_RICCN       -----KSELADIENKIKS--LKLSKEAKEKAEAELKKLRTMNQM-SAESGVTRNYLETLL
LON_RICFE       -----KSELADIEKKIKS--LKLSKEAKEKAESELKKLRSMNQM-SAESGVTRNYLETLL
LON_RICPR       -----KSELADIEKKIKS--LKLSKEAKEKAESEFKKLRAMNQM-SAESGVTRNYLETLL
LON_RICTY       -----KSELADIEKKIKS--LKLSKEAKEKAESEFKKLRAMNQM-SAESGVTRNYLETLL
LON_RICBR       -----KSDLAEFDKKIKA--AKLSKEAREKAEAELKKLRTMNQM-SAESGVTRNYLETLL
LON_ORITI       D---EKSDIAELQKKIDT--LHLSKEAKAKAESELKKLKMMNPI-SAEAALTRNYLDILL
LON1_MYXXA      ERDEFKNEIQEIEEKLKN--KRMSKEATLKVKKELKKLRMMSPM-SAEATVVRNYIDWII
LON3_SORC5      ERDEFKNEIQEIEEALKT--KRMSKEAAAKVKKELKKLKMMHPT-SAEATVVRNYIDWIL
LON1_SYNFM      EKDDFKSELEELEKRIKR--KKLSQEAAAKVRAEFKKLKLMSPM-SAEATVVRNYIDWIL
LON2_DESPS      QGEDGVDEMTELENIIKA--KKMPAYARARVQKELKKLRGMPAM-SAETTVVRSYIDTIL
LON_DESVH       REDDPQAEVNELEARLAE--KSMPEEAREKALREMKKLRQMPPS-SAEYTVVRNYVDWIL
LON_SOLUE       -RGE-KSEIDELKRRIEE--AGMTADAQEKAMAELKRLENMPPM-SAESTVSRNYLDWLL
LON1_BACSU      DKEGKTGEVQTLTEKIEE--AGMPDHVKETALKELNRYEKIPSS-SAESSVIRNYIDWLV
LON_BACAH       DKEGKGGEVEELREKIEQ--SGMPEETMKAALKELDRYEKLPAS-SAESGVIRNYMDWLL
LON_BRECH       DKDGRQGEVDELRAQLEK--SDAPERIKAKIEKELERLEKMPST-SAEGSVIRTYIDTLF
LON_DESRM       EKDERVAECEEFREKISK--AKFPKEAEEKALKEVERLEKMPPM-AAEAAVVRNYLDWML
LON_HELMI       EKEDRQAEGEDLRNKIAK--AKLPKEVEEKALREVERLEKMPPM-VAEATVVRNYLDWLL
LON_SYNWW       EKDERSSEVEEFRERIKK--ANMPKDAEEKAFKELERLEKMPPM-VAEAVVVRNYLDWIL
LON_HALOH       E-DEEDDEIEEYRNKAEE--LDLPEKIREKVDKEIEKLKKTPSM-SPEATVIRNYLDCVL
LON_CALS8       EKDSLFSEAQEYREQVQK--LGLSNENLQKVYKEIDRLEKLPPN-SPEIGVIRTYLEWII
LON_CLOD6       EEEDINSEADEYREKLKK--IKAPKTTKEKIEKEIDKFSKISSM-SPDVSVSRNYLDTIF
LON_CLOAB       DDDEEKAEIKEYTQKIKK--GKLTKEAKEKALHELKKLENAGAY-SPEGAGIKTYLDWIL
LON_FINM2       EEYDI-EDTDDYANRVKK--LKLKKDSEEHVLKEINRLSSMNPN-NPESTVIRNYIDQVL
LON_ELUMP       QKDDFQKEIDELRSKIKK--NGLPKNAKESAEKELDRLAKMAPF-SPESTVSRTYLDWLV
LON_UNCTG       QKDEAQKDLDDLKGKLKK--TKMPQAAKSAADKEMSRLEKMMPM-SPEATVIRTYLEWIL
LON_FERNB       ---EEDIEIKELKEKIEN--NNYPEFVKEKARAEINRLEKMSPY-APEATVVRTYLDWIL
LON_PSELT       ---EKDTEADQLKARLQK--LKLPEHAKQKATLEIERLEKMSPY-SAEATVIRTYLDWLF
LON_COPPD       D--ERTIEIEQYKKRIEE--SGMPEEARKKAEEELDRLQRMPPY-SAELAVIRTYLDWLV
LON1_THET2      GGEDFLTEIEELRERIEK--KGMPEPVKEKALKELKRLERMQPG-SPEATVSRTYLDWLL
LON_AQUAE       EAGGIKAEIEEYTKKFEEVKECMPEEGVKEVEKNIKRLERLHPE-SAEAGVIRTWLDWVL
LON_SULSY       ERDEKQEEIENYKKKIEE--SGMPDEIKEEALKQLKRLEKMHPD-SAEAGVIRTYLDWLV
LON_GEOLS       DHDGK-EELEELRKAIET--ARMPENVEKEALKQLGRLERMHGD-SGEAGVIRTYLDWLI
LON_GEOMG       ETDPRSEELNELRKAIEQ--AKMPPVVEKEAFKQLGRLEQMHPD-AAEAGMLRTFLDWMV
LON2_BDEBA      EGDSKSEEMDELREKLVN--AGMPTHVEAEALKQLGRLERMHPD-ASEATMVRTYLDWMA
LON_DESAL       EMDEKTQEIKEYQDKIRK--AKMPKEAKEEAERQLKRLEQMHPE-AGEAPTVRTYLDWLV
LON_LAWIP       DAIDADEEIEEVSSALNK--AGLPAEVRKEVDKQLRRLSTMHAD-SAEAGVIRTYLDWIA
LON_CHLAD       EDEEGDDPIDELRRKIHE--LDAPEYVKNQALHELKRLAQQGMN-NPESGVIRTYLDWIL
LON2_HERA2      QEDPLTRELNELHDRIVA--ANLPAKAQAKALEELGRLEMMPPA-APEYSVIRTYLDWLL
LON_KORVE       EQDDSTRDADELREKVEA--AGMPDDVKKEALKELGRLARMSPM-AADYSVTRNYIEWLA
LON1_HERA2      ENNEQEVEVDRLAEQIEA--AGMSAEAHQQAMRELDRLRQMPTA-AAEYSVIRGYLETLI
LON_DESOH       EKEEGNVEAEEYRTKIEE--GNLPEEAYKAATRELERFSRMHPS-SSEYTVSSTYLDWLT
LON_SYNAS       ESDENRVEVAEYRKKIEE--KMLTEEARKEAFRELDRMSRMHPA-SAEYSVATTYLDWIT
LON2_SYNFM      EGEDTSEEVHELAARLRD--LEMPAEARGAAEKEIERLGRMSPS-APEYHVSRNYLDWLL
LON_DICT6       EIDPREMEINELRQKLQE--AKLPPEAMKEAERELERLSLMPPG-SAEYTVTRTYLDWLI
LON_ROSCS       ETDDHAAEIAELRRRLEA--ANLPEEARKEAEREISRLERMPPG-AAEYVVARTYLDWLL
LON_GEOBB       EEDSRLGEANELRSKVES--AHMPEDVRRIAEKEMRRLERINPA-SPEYTVSRTYLDYLT
LON2_PELCD      EEDPHQADIRQFRSIVQS--DEMPEVVRSVAEKELARLERINPS-SPEYTVARSYVEYLC
LON_ANADE       LGEEEEE-LDELQERLKK--AGLPPEVEKVAQKELNRLKSIPTA-SSEYTVARTYLDWIA
LON2_MYXXA      MGEEEEE-LDELQERLKK--AGLPPDVEKVANKELNRLKTIPAA-SSEYTVARTYLDWIA
LON2_SORC5      GGDDDE--IEELRERIRR--AKVPAEVDKVVRKQLSRLRSMAQQ-SAEFNVTKTYLEWIA
LON4_SORC5      GEEGEDE-LSALRRRLDE--AGLPEEARAVADRELRRLESVGPQ-SAEHNVIRTYLEWIA
LON_METSB       GDGKAQE-IAELTEAIAK--AKMPAEVEEAARKELRRLERMPDA-SAEYGMIRTYIDWLI
LON_PHEZH       GE--REE-LVELEAAIEN--AGMPEEVVQQARKELRRLARTPEA-AAEYGMVRTYLEWLV
LON_PARPJ       NIESREE-VRKLTEAIEA--AHMPPEVESHARKELGRLERMPEA-SSEYSISVSYLEWLT
LON_MYCSM       LDDNGDGSSDDYRARIEQ--ADLPEKVREAALREVGKLERASDQ-SPEGGWIRTWLDTVL
LON_SALAI       DEPEG---SADYRARVEA--ADLPAPVRDAALREVGKLERASDA-SPEAGWIRTWLDTVL
LON_CHLAA       DTSEA-AELDDLRQKLAA--ADLPEVARKEADRELSRLARINAS-SPEYQMVRTYLEWLA
LON_DEIRA       GDEEEGDEAEAFRAKIDA--LGLNPEVKKEIDREVNRLARMHPD-AAEASVIRTYLTWVT
LON2_THET2      --EEGEQEVEEFRRKLEA--LDLPPVVRQEVERELNRFARMHPD-SAEASVIRTYLDWIV
LON1_SORC5      --EDDENAAARLEHKLQR--ANLPAEILQEARRDLARLRRMGRETSPEAQVLMTWLEWVA
LON_NITOC       ETNPEQAEIKELRQRMEE--TELPELVRKEVEKEITRLERMPSA-APDYQLTRGYVELAL
LON_FUSNN       -DFSQDDDVIEIVDRLKN--TELPKEVREKLEAEVKKLTKMQPF-SAESSVIRNYIEAVL
LON_MYCA5       DDEAGAKAIENMEDAEEN-ARQYPDYVIEALKTEQNRLASMMPA-SPEANISKTYIDLIT
LON_MYCMO       DDENDEEEIEEKLNSKYG-KEQYPEEVIKTIKNEKRRLKNMMSS-SPEANTSRTYIEWLT
LON_MYCH2       EDSRYEDEIEELLHSELG-KKVFPKEVAKTIMRETNKLKSMIVT-SPESNITKSYLDLLV
LON_MYCGE       ISSKKEDEVASIRKKLD--ENPYPEAIKKRILSELEHYENSSSS-SQESTLTKTYIDTLL
LON_MYCPN       MTSKKEDEVSNIRKKLE--ENPYPEHIKKRILSELDHFENSSSS-SQESTLTKTYIDTLM
LON_MYCPE       DISSKEDDAESIRDRVR--NNPYPEHIKKRILSEVNKLE-SSSN-SNEYSMSKTYIDWLI
LON_UREP2       ELSSREEDADKIRAKIE--DLELPPNVKERALAELNRFENAMSS--NESSVIKSYLDWLL
LON_MYCMS       DENSDASQLDKYKKRLE--EEPFPESVKEKILSSIKRIETMQPG-SAEVNVERNYVDWMM
LON_AYWBP       DKAKKEEEIAELRDKIK--KTPLPPEIKKKALQELSRYQ-TSSL-MAESFVIKNYLDFLL
                                                    :          :            

LON_CAMC1       EIPFENVAKK--KSSIAEVSKHLNADHYSLEKPKERIEEYFALRELLELR---GVGEKVN
LON_CAMJE       DIPFEKISKK--KLDIKEVSKQLNHDHYALNKPKERIEEYFAVRELLEKR---KIAEKDG
LON_HELPY       DVPFGQYGKK--ALDIKHVREQLDKDHYSLKRPKERIVEYFATMQLLEMRRK-KKPEKKD
LON_HELPJ       DVPFGQYEKK--ALDIKHVKEQLDNDHYSLKRPKERIVEYFATMQLLEMRHK-KKPEKKD
LON1_BORBU      ELPWRDFKINFDKLDLQKSKKILDKTHYGMNEVKDRIIEYISVLKLRKTQ----------
LON_BORDL       NLPWEDTKVDFDKFNLQRAEKILDKTHYGMREVKDRILEYISVLKLRKSQ----------
LON_LEPIC       SLPWEPAPV--REIDLEKAKKTLDKDHYKLEDVKDRILEFLAVKKLKNDE----------
LON_TREPA       SLPWHAPEK--EEYDLKKAQKLLDEDHYGLENVKERIVEYLAVRKLRADT----------
LON_CHLMU       IVPWGIQTK--EYHDLKKAESILNKDHYGLEDIKQRILELISVGKLANGM----------
LON_CHLTR       IVPWGIQTK--EYHDLKKAESILNKDHYGLEDIKQRILELISVGKLANGM----------
LON_CHLPN       IIPWGIQSK--EYHDLKKAEIVLNKDHYGLDEIKQRILELISVGKLSKGL----------
LON_PARUW       TIPWGIYSQ--ENHNLEEAEKILAHDHYGLEDIKQRILEFIGVGKLAKGV----------
LON1_DESPS      MMPWGVYTK--DNYSVKKARKILDDDHHGLDDVKDRIIELISVGSIKGEL----------
LON1_PELCD      ILPWGKFSK--DNYNIERARRVLDRDHYGLKDVKDRILEFIAVGMLKGDI----------
LON_MAGMM       SLPWGVHST--DKLNIARARRILDRDHDGLEDVKERILEFLAVGKLKGEI----------
LON2_HYDCU      QLPWGKYSD--DKLDLGRARKILNKGHDGLDDVKDRILEFLAVGALKGEI----------
LON_CLOB8       QLPWKKQ-EFK-DIDLEEARRILDEQHYGLEKVKDRIIQHLAVMQLKNDK----------
LON_METBF       DLPWITE-EKK-SIDIAEARRVLESNHNGLEKVKERIIQHLAVMKLKHEK----------
LON_METST       QLPWHKE-ENP-TIDIVKAKKQLNDDHYGLKKVKTRIIQHLTVLKMKKDK----------
LON1_BDEBA      SLPWNQSSAQQ-DIDLEAAERVLNEDHYGLEKIKKRILQHLAVMKLRKSQ----------
LON_CYTH3       DLPWGENSTD--NFDLVRAKEILDEDHFGLTKVKQRILEYLAVLKLKNNM----------
LON_FLAJ1       ELPWGEYSKD--KFDLKHAQKVLDKDHFGLDEVKKRMIEHLAVLKLRNDM----------
LON_PARD8       NLPWNEYSKD--NFNLSHAQKVLDRDHYGLEKVKERIIEHLAVLKLKGDM----------
LON_PORG3       SLPWGVFSKD--NFNLKRAQSVLDRDHFGLEKVKERIIEHLAVLKMKGDM----------
LON_AMOA5       ELPWSVYTTD--NMDLKMAKKVLDTEHYGLEKVKERLLEYLAVRKLTQNM----------
LON_CHLT3       ALPWGHFSET--VINLHEAEKILNQDHYGLGKVKDRILEYLAVLKLKSNM----------
LON_ACIB3       DTPWNKASKV--SINLNKAQEILDADHYGLDDVKDRIVEYLAVQ--SRVKKL--------
LON_DICNV       DYPWAIEKPA--RYDLEEAARILDRDHYGLEDVKERILEYLAVQ--KRINEHNQKEA-GT
LON_BRUAB       SIPWGKKSKV--KQDLNFAQEVLDAEHFGLGKVKERIVEYLAVQ--ARSTKI--------
LON_BRUA2       SIPWGKKSKV--KQDLNFAQEVLDAEHFGLGKVKERIVEYLAVQ--ARSTKI--------
LON_BRUME       SIPWGKKSKV--KQDLNFAQEVLDAEHFGLGKVKERIVEYLAVQ--ARSTKI--------
LON_BRUSU       SIPWGKKSKV--KQDLNFAQEVLDAEHFGLGKVKERIVGYLAVQ--ARSTKI--------
LON_RHIME       GLPWGKKSKI--KTDLNHAEKVLDTDHFGLDKVKERIVEYLAVQ--ARSSKI--------
LON_AZOC5       SIPWGIKSKV--KKDLPFAQSVLDSDHYGLDKVKERIVEYLAVQ--SRANKL--------
LON_AZOBR       SIPWKKRTKV--KKDLKLAQKILDADHYGLEKVKERILEYLRVQ--NRMNKV--------
LON_CAUVC       SIPWGKAKTK--KIDLVESEGILDADHYGLEKVKERILEYLAVQ--ARTNSL--------
LON_CAUVN       SIPWGKAKTK--KIDLVESEGILDADHYGLEKVKERILEYLAVQ--ARTNSL--------
LON_BUCAI       QVPWYLKTKI--KKDLQQAKKILDIDHFGLETVKDRILEYLAVQ--SRKNKI--------
LON_BUCAP       QVPWNIKTKI--KKDIQEAKKILDIDHFGLEKVKERILEYLAVQ--SRTNKV--------
LON_BUCBP       QIPWNIRSKV--KKNLTQAQKILDSDHFGLDKVKERILEYLAVQ--SRINTV--------
LON_ECOLI       QVPWNARSKV--KKDLRQAQEILDTDHYGLERVKDRILEYLAVQ--SRVNKI--------
LON_ECOL6       QVPWNARSKV--KKDLRQAQEILDTDHYGLERVKDRILEYLAVQ--SRVNKI--------
LON_SHIDS       QVPWNARSKV--KKDLRQAQEILDTDHYGLERVKDRILEYLAVQ--SRVNKI--------
LON_ERWAM       QVPWNARSKV--EKDLQKRRQTLDTDHFGLERVKDRILEYLAVQ--SRVSKI--------
LON_VIBPA       SVPWTKRSKV--KKNLAKAEEILNEDHYGLERVKERILEYLAVQ--NRINKL--------
LON_HAEIN       QVPWHQRSKV--KKDIVKAQQVLDTDHYGLDRVKERILEYLAVQ--ARLNKV--------
LON_XANOR       GVPWKKRTKV--RKDLKVAEDTLDADHYGLDKVKERILEYLAVQ--SRVKQM--------
LON1_HYDCU      SIPWKKRSRV--SKDLNKAQTILDKQHYGLEKVKERIIEYLAVQ--KRVNKM--------
LON_FRAP2       SLPWGKKAKV--KKDINLAEKVLEKDHYGIKKVKERILEHLAVQI-KRDTNA--------
LON_NEOSM       SLPWKKKGKM--ITDIAASERILKASHYGIEKVKERIIEYLAVQ--NRTKSF--------
LON_WOLPP       DLPWGKYKDA--KINLNAAKKILDENHYGIEKVKDRIIEFLAVL--KRVKEI--------
LON_RICCN       SLPWGKYDNS--KIDINQAEKILNRDHFGLEKVKERIIEYLAVL--QRSSKI--------
LON_RICFE       SLPWGKYDNS--KIDINQAEKILNRDHFGLEKVKERIIEYLAVL--QRSSKI--------
LON_RICPR       SLPWGKYDNS--KIDINQAEKILNRDHFGLEKVKERIIEYLAVL--QRSSKI--------
LON_RICTY       SLPWGKYDNS--KIDINQAEKILNRDHFGLEKVKERIIEYLAVL--QRSNKI--------
LON_RICBR       SLPWGKYDNS--KIDINQAEKILNRDHFGLEKVKERIIEYLAVL--QRSSKI--------
LON_ORITI       GLPWKKEKESKININIDKALQDLNADHHGLEKVKERITEYLAVL--QRTKKS--------
LON1_MYXXA      SLPWYDETQD--RLDVTEAETVLNEDHYGLKKPKERILEYLAVQ--QLVKKL--------
LON3_SORC5      ELPWYDKSEE--RYDLVEAERILDEDHYGLKKIKERILEYLAVQ--ALTKKL--------
LON1_SYNFM      SLPWYEKTRD--KLDIDESIRILDEDHYGLEKPKERIIEYLAVQ--ALVKRI--------
LON2_DESPS      GLPWKKRSKG--QLNVLKAEGILNKDHYGLEKPKERILEFLAVQ--SQVAKL--------
LON_DESVH       DLPWNTLKET--EIDIDNARSILDADHYGLEKPKERILEYLAVQ--KLVNRL--------
LON_SOLUE       AVPWKKKSKE--IRDLKFAEGVLEADHYGLEKIKERILEFLAVR--RLVKNP--------
LON1_BACSU      ALPWTDETDD--KLDLKEAGRLLDEEHHGLEKVKERILEYLAVQKLTKSL----------
LON_BACAH       ALPWTDATED--MIDLAHSEEILNKDHYGLEKVKERVLEYLAVQKLTNSL----------
LON_BRECH       ALPWTKTTED--NLDIKHAEEVLDEDHYGLEKPKERVLEYLAVQKLVNSM----------
LON_DESRM       SLPWSKSTKD--RIDINAAEEVLEADHYGLKDPKERITEYLAIRKLAKKM----------
LON_HELMI       ALPWAKQTKD--RLDIDKAEAILNEDHFGLDKVKERIIEYLAIRKLAQKM----------
LON_SYNWW       SLPWSLETRD--RLDLKAAEAILDEDHYGLEKPKERILEYLAIRKLAKKM----------
LON_HALOH       DLPWNKVREE--KIDLDEAKNVLDSEHYGLEDVKERILEYLAVRKLAPQK----------
LON_CALS8       DLPWNVKSEE--KIDINVVKNVLDEDHYGLTKVKERILEYIAVRKLKNNL----------
LON_CLOD6       SLPWNKETKD--KLDITKAKDILDEDHYGLEKVKERILEYLAIRTLAKSL----------
LON_CLOAB       SLPWKDKTKD--NLDIKRAREILNKEHYGLSDVKDRIIEYLAVKKMSKSL----------
LON_FINM2       DIPWNKKSKS--SIDLKVAEKVLNDGHFGLEDVKKRILEYLAVKKMTGSL----------
LON_ELUMP       NMPWNSSTND--ILDLKKAKEVMDADHYGLDKPKERILEYLAVSKLTNSL----------
LON_UNCTG       DLPWEKSTID--NLDLNRAKEVLDQDHYGLEKVKDRVLEYLAVLSRVQKI----------
LON_FERNB       NLPWHEKTDD--TDDINFAEKVLNEDHYGLDEPKRRILEYLATRKVSQKA----------
LON_PSELT       NLPWDNSTED--RQDISQAEKILQASHYGLKEAKERILEFLAVRKRSNSV----------
LON_COPPD       SLPWNARTED--EDDLKTVKQKLDKSHYGLDDAKERIVEFIATKKLSSNP----------
LON1_THET2      EVPWTEADPE--VLDISVTKRVLDEDHYGLKEVKERILEYLAVRQLTQGKEVK-------
LON_AQUAE       DLPWCTRTED--NYDLERAREILDRDHYDLEKVKDRIIEYLAIRKLTQ----------GK
LON_SULSY       ELPWNKRTKD--RLDLKIAKKILDEDHYDLEKIKERILEYLAVLKLKKESSK------DK
LON_GEOLS       EIPWSKTTRD--SLDIIRAKKILDEDHSYLDKVKERILEFLAVRKLNK------------
LON_GEOMG       ELPWGKATKD--VLDIKRARQILDEDHFYLEKIKERILEFLAVRKLRK------------
LON2_BDEBA      DLPWSKKSED--HIDLKRSKEILDEDHYELEKAKDRIMEFLAVRKLKP------------
LON_DESAL       EVPWKKATKD--TLDIKKAKEILEEDHYGLEKVKDRILEYLAVRKLNP------------
LON_LAWIP       ELPWKKTSKD--QLDIHKAKTILNEDHYGLVKIKDRILEYLSVRKLNP------------
LON_CHLAD       SLPWADEELP--EISITEAQKVLDADHYGLEKVKERILEYLAVRKLAGDKM---------
LON2_HERA2      ELPWSKTSAD--VADLEVAAKVLENNHYGLKKVKERILEFIAVRMLAGDST---------
LON_KORVE       VLPWQKSSGAG-EIDIPKAKDILDEDHYDLQKVKDRILDYLSVRRLKPNM----------
LON1_HERA2      ALPWQKRS-DD-TIDVAQATEVLDADHYGLDEIKERILDYLAVRELRRKRSPER-----D
LON_DESOH       TLPWDKQT-ED-HLDIKKARAILDKDHFGLEKPKKRILEYLAVRKLNPDS----------
LON_SYNAS       SLPWNERT-QD-NQDIRQARRILDEDHYGLDKAKKRIIEYLAVRKLKPDT----------
LON2_SYNFM      EMPWSVST-ED-RIDVRQAAVILDEDHFDLEKVKRRILEYLAVLQLKKDL----------
LON_DICT6       SLPWAIST-ED-NLDIKRAEEILNEDHYDLEKVKERILEYLAVRKLKSDM----------
LON_ROSCS       DLPWNVST-ED-NLDLTQARQVLDEDHYDLERIKERIIEYLAVRKLRLEQDAS------G
LON_GEOBB       TIPWQVST-PD-NRDINQAETILNEDHYDLKKVKERILEYLAVRSLKDKM----------
LON2_PELCD      NMPWQRGT-SD-ILDIDRAQQTLDDDHYDLVEVKERILEFLAVHSLKSSL----------
LON_ANADE       DLPWTKRTDD--NLDIENARQILDTDHYGLDKIKKRILEYLAVRKLKND-----------
LON2_MYXXA      DLPWAKISED--NLDIENARQQLDKDHFGIKKVKKRILEYLAVRKLKND-----------
LON2_SORC5      DLPWSKTTVD--KLSVESVRRCLDEDHLGLEKVKKRIVEYSAIRQLRTD-----------
LON4_SORC5      DLPWSARAEV--KDDLDAVKAKLDEEHRGLDDVKRRILEHMAVLKLTGK-----------
LON_METSB       ELPWSLPEEA--PIDIAEARRILDADHFGLDKIKQRIVEYLAVRKLAPQ-----------
LON_PHEZH       ELPWGVPEAA--PIDLAEARRILDEDHFGLEKIKQRIIEHLAVRRLAPE-----------
LON_PARPJ       ELPWPLPAEA--PIDIARARQILDEAHFGLDKVKRRILEYLGVRKLNPH-----------
LON_MYCSM       DLPWNVRTED--STDLARAREILDTDHHGLSDVKDRIVEYLAVRGAA---PQRGMAVVGG
LON_SALAI       EMPWNTRTED--NTDLVAARAVLDADHAGLTDVKDRILEYLAVRNRR---VERNLGVVGG
LON_CHLAA       ELPWNKYTGQ--PIDIAFARQVLDEDHHGLQKVKERILEYLAVKQRR---AALGEENLRA
LON_DEIRA       ELPWNERSDD--RLDVEEAAQVLDEDHYGLEKVKDRVLEFLAVRRLRKERAERGEISAEE
LON2_THET2      NLPWNTRTED--NLDLERAKEILERDHYGLEKVKDRVLEYLAVRKLKAERAKRGEIPPDE
LON1_SORC5      DLPWSQRTDD--HVDLDRARAILDEDHYGLGDVKDRVLEFLAVRKLRLEQARSEGERSRA
LON_NITOC       ELPWNKTTED--RLDLKRAREILDEDHFDLEDVKERIIEHLAVMKLNPEA----------
LON_FUSNN       ELPWNSETND--VLDLKKASQILERDHYGLKDAKEKVLDYLAVKKLNPSM----------
LON_MYCA5       TLPWKKVSGE--LLDIDNVRKILDKHHYGLEKPKERILEFISVLTYTKKENEKNEYVPVK
LON_MYCMO       NLPWRKVSVD--KTNLVKSKEILDSYHYGLKEVKERIIEFLAVMINNNKKHPEDEKTKIQ
LON_MYCH2       ALPWKKVKKD--ILDIKNVREKLEEAHYGLDEIKKRIIEYLAALIHRR---SQSEGKPEL
LON_MYCGE       NLPWWQKSKD--NSDVKNLIKTLDKNHTGLDKVKERIVEYLAVQLRTQ------------
LON_MYCPN       NLPWWQESKD--NADVKNLIKILNKNHSGLDKVKERVVEYLAVQLRTK------------
LON_MYCPE       DLPYWQKTDD--VDSLADVENVLNNNHYGLEKVKERIIEYLAVRMKSK------------
LON_UREP2       DLPWTQQGVD--NTDLMSVRTHLDDNHYGIEKVKERILEYLALRMRNP------------
LON_MYCMS       SIPWWEQSED--IDDLKYAQEILEKHHFGLKKVKERIIEYLAVKQKTK------------
LON_AYWBP       ELPWGKTSQD--ENDLVAIEKSLNNQHYGLQKVKERILEYAAVKIMTK------------
                  *:          .:      :   *  :   * ::                       

LON_CAMC1       -----------------------------NGAILCFAGPPGVGKTSLANSIAKALKRELV
LON_CAMJE       -----------------------------AKVILCLYGPPGVGKTSLANSVSKALKRELI
LON_HELPY       K---------------------------TKGTILCFYGPPGVGKTSLANSIAKAIERPLV
LON_HELPJ       K---------------------------TKGTILCFYGPPGVGKTSLANSIAKAIERPLV
LON1_BORBU      -----------------------------KGAIILLVGPPGVGKTSIGAAIAKVLRTKFF
LON_BORDL       -----------------------------KGAIMLLVGPPGVGKTSIGAAIAEVLNTKFF
LON_LEPIC       -----------------------------KGTILLLVGPPGVGKTSIARSIAEAMGRKFF
LON_TREPA       -----------------------------KGSIILLVGPPGVGKTSVGKSIARAIHKPFF
LON_CHLMU       -----------------------------KGSIICLVGPPGVGKTSIGRSIAKVLHRKFF
LON_CHLTR       -----------------------------KGSIICLVGPPGVGKTSIGRSIAKVLHRKFF
LON_CHLPN       -----------------------------KGSIICLVGPPGVGKTSIGRSIAKVLHRKFF
LON_PARUW       -----------------------------RGSIICLVGPPGVGKTSIGKSIARALNRKFY
LON1_DESPS      -----------------------------TGTILLLTGPPGVGKTSVGQSIARSLGRKFF
LON1_PELCD      -----------------------------SGSILCLVGPPGVGKTSIGKSIAAALNRTFY
LON_MAGMM       -----------------------------GGSIILLVGPPGVGKTSIGRSVATAVGREFY
LON2_HYDCU      -----------------------------SGSIICLVGPPGVGKTSIGRSIADTLGRKFY
LON_CLOB8       -----------------------------KGSILLLVGPPGVGKTSLGKSIAEALNRKYV
LON_METBF       -----------------------------QGSILLLIGPPGTGKTSLGKSIADALGRKYI
LON_METST       -----------------------------QGSILLFVGPPGTGKTSLGKSIAAALERPYV
LON1_BDEBA      -----------------------------QGSILMFIGPPGVGKTSLGKSIARALGKKYV
LON_CYTH3       -----------------------------KAPILCLYGPPGVGKTSLGKSIAKALDRKYI
LON_FLAJ1       -----------------------------KSPIICLTGPPGVGKTSIGRSVAEALGREYV
LON_PARD8       -----------------------------KSPIICLYGPPGVGKTSLGRSIAEALRRKYV
LON_PORG3       -----------------------------KSPIICLYGPPGVGKTSLGKSIAESLGRKYV
LON_AMOA5       -----------------------------KGPILCLYGPPGVGKTSLGKSIAKALNRKYV
LON_CHLT3       -----------------------------KAPILCFCGPPGVGKTSLGRSIARALGRKFI
LON_ACIB3       -----------------------------KGPILCLVGPPGVGKTSLGESVAKATGREFV
LON_DICNV       I---------------------------GKGPIICLIGPPGVGKTSLGKSIAEATGRDFD
LON_BRUAB       -----------------------------KGPILCLVGPPGVGKTSLARSIAKATGREYV
LON_BRUA2       -----------------------------KGPILCLVGPPGVGKTSLARSIAKATGREYV
LON_BRUME       -----------------------------KGPILCLVGPPGVGKTSLARSIAKATGREYV
LON_BRUSU       -----------------------------KGPILCLVGPPGVGKTSLARSIAKATGREYV
LON_RHIME       -----------------------------KGPILCLVGPPGVGKTSLAKSIAKATGREYI
LON_AZOC5       -----------------------------AGPILCLVGPPGVGKTSLGRSIAKATGREFV
LON_AZOBR       -----------------------------KGPIQSLVGPPGVGKTSLGKSIAKSTGRNFV
LON_CAUVC       -----------------------------KGPILCLVGPPGVGKTSLGKSIAKATGREFV
LON_CAUVN       -----------------------------KGPILCLVGPPGVGKTSLGKSIAKATGREFV
LON_BUCAI       -----------------------------KGPILCLIGPPGVGKTSLGKSIARSTGRKYV
LON_BUCAP       -----------------------------KGPILCLIGPPGVGKTSLGKSIAKSTGRKYV
LON_BUCBP       -----------------------------KGPILCLVGPPGVGKTSLGQSIARATGRKYI
LON_ECOLI       -----------------------------KGPILCLVGPPGVGKTSLGQSIAKATGRKYV
LON_ECOL6       -----------------------------KGPILCLVGPPGVGKTSLGQSIAKATGRKYV
LON_SHIDS       -----------------------------KGPILCLVGPPGVGKTSLGQSIAKATGRKYV
LON_ERWAM       -----------------------------KGPILCLVGPPGVGKTSLGQSIAKATGRKYV
LON_VIBPA       -----------------------------KGPILCLVGPPGVGKTSLGRSIASATGRKYV
LON_HAEIN       -----------------------------KGPILCLVGPPGVGKTSLGQSIANATGRKYV
LON_XANOR       -----------------------------KGPILCLVGPPGVGKTSLGQSIAKATNRKFV
LON1_HYDCU      -----------------------------KGPILCLVGPPGVGKTSLARSIAEATNRKYV
LON_FRAP2       -----------------------------KAPILCLVGPPGVGKTSIGQSIARATGREYV
LON_NEOSM       -----------------------------KGSILCLLGPPGVGKTSLASAIAEATGRPFV
LON_WOLPP       -----------------------------KGPILCLVGPPGVGKTSLAKSMAKAVGRDFV
LON_RICCN       -----------------------------RGPILCLIGPPGVGKTSLVKSIAEGMGRKYT
LON_RICFE       -----------------------------RGPILCLIGPPGVGKTSLVKSIAEGMGRKYT
LON_RICPR       -----------------------------RGPILCLIGPPGVGKTSLVKSIAEGMGRKYT
LON_RICTY       -----------------------------RGPILCLIGPPGVGKTSLVKSIAEGMGRKYA
LON_RICBR       -----------------------------RGPILCLIGPPGVGKTSLIKSIAEGMGRKYT
LON_ORITI       -----------------------------IGTILCFIGPPGVGKTSLVKSIAEATKCKYA
LON1_MYXXA      -----------------------------KGPVLCFVGPPGVGKTSLARSIARATGRKFV
LON3_SORC5      -----------------------------KGPVLCFVGPPGVGKTSLAKSIARATGRKFV
LON1_SYNFM      -----------------------------KGPILCFVGPPGVGKTSLAKSIARAMNRNFI
LON2_DESPS      -----------------------------KGPILCFVGPPGVGKTSICQSIAKSMGREFA
LON_DESVH       -----------------------------KGPILCLVGPPGVGKTSLAKSVAKATGREFV
LON_SOLUE       -----------------------------KGSILCFVGPPGVGKTSLGMSIAKATGRKFV
LON1_BACSU      -----------------------------KGPILCLAGPPGVGKTSLAKSIAKSLGRKFV
LON_BACAH       -----------------------------KGPILCLVGPPGVGKTSLARSIATSLNRNFV
LON_BRECH       -----------------------------RGPILCLVGPPGVGKTSLARSVARALGREFV
LON_DESRM       -----------------------------KGPILCLVGPPGVGKTSLGRSVARALDRKFV
LON_HELMI       -----------------------------KGPIICFVGPPGVGKTSLARSIARALERKFV
LON_SYNWW       -----------------------------KGPILCLVGPPGVGKTSLGKSVGRSLGRKFI
LON_HALOH       -----------------------------KSPILCLIGAPGVGKTSLGRSIARALGRDFV
LON_CALS8       -----------------------------KGPILCLVGPPGVGKTSIAKSIARALNRNYV
LON_CLOD6       -----------------------------KGPIICLVGPPGTGKTSIVKSIARALNRKFV
LON_CLOAB       -----------------------------KGPILCLVGPPGVGKTSIAKSIANAVNRNFV
LON_FINM2       -----------------------------KGPILCLVGPPGVGKTSIARSIADATNRKFV
LON_ELUMP       -----------------------------KGPILCFAGPPGVGKTSLAKSIASAVGRKFV
LON_UNCTG       -----------------------------KGPILCFIGPPGVGKTSIAKSVARSLGRNFV
LON_FERNB       -----------------------------KAPIICFVGPPGVGKTSLAKSIARAMNRKFG
LON_PSELT       -----------------------------KAPILCFVGPPGVGKTSLARAVSQALNRKFA
LON_COPPD       -----------------------------KAPILCLVGPPGVGKTSLAKAIATALNRKLV
LON1_THET2      ----------------------------GHAPILCFVGPPGVGKTSLGKSIARSMNRRFH
LON_AQUAE       E---------------------------APTQILAFVGPPGVGKTSLGRSIAEALGRKFV
LON_SULSY       S---------------------------IKGPILCFVGPPGVGKTSLGRSIAKALNRKFV
LON_GEOLS       Q---------------------------MKGPILCFVGPPGVGKTSLGKSIARALNRKFV
LON_GEOMG       K---------------------------MKGPILCFVGPPGVGKTSLGKSIARAMGRKFV
LON2_BDEBA      N---------------------------LKGPILCFGGPPGVGKTSLGKSIARAMGREYF
LON_DESAL       K---------------------------MKGPILCFVGPPGVGKTSLGKSIARAMGRKFY
LON_LAWIP       K---------------------------SKGPILCFAGPPGVGKTSLGRSIAKSLGRKFQ
LON_CHLAD       -----------------------------RSPILCFVGPPGVGKTSLGRSIARALGRKFV
LON2_HERA2      -----------------------------KSPILCFVGPPGVGKTSLGRSVAEALGREFV
LON_KORVE       -----------------------------KGPILCFSGPPGVGKTSLGKSIARALGRKFV
LON1_HERA2      P---------------------------GRGAILCFVGPPGVGKTSLGRSIAKAMNREFV
LON_DESOH       -----------------------------KGPILCFLGPPGTGKTSLGRSIARALGREFI
LON_SYNAS       -----------------------------KGPILCFVGPPGTGKTSLAQSIARALGRKFY
LON2_SYNFM      -----------------------------KGPILCFVGPPGVGKTSLGQSIARTLGRKFL
LON_DICT6       -----------------------------KGPILCFVGPPGVGKTSLGKSIARALGRKFV
LON_ROSCS       S---------------------------ARGPILCFVGPPGVGKTSLGTSIARALGRKFV
LON_GEOBB       -----------------------------KGPILCFVGPPGVGKTSLGKSIARTLGRKFI
LON2_PELCD      -----------------------------KGPILCFVGPPGVGKTSLGRSIARSLGRKFI
LON_ANADE       ----------------------------MRGPILCFVGPPGVGKTSLGQSIARATGRKFV
LON2_MYXXA      ----------------------------MRGPILCLVGPPGVGKTSLGQSVAKATGRKFV
LON2_SORC5      ----------------------------KKGPILLFIGPPGVGKTSLGKSIARSMGRRYE
LON4_SORC5      ----------------------------ARATILCFAGPPGVGKTSLGQSIADATGRPFV
LON_METSB       ----------------------------GKAPILCFVGPPGVGKTSLGQSIARAMGRKFV
LON_PHEZH       ----------------------------GKAPILCFVGPPGVGKTSLGQSIARAMHRPFV
LON_PARPJ       ----------------------------GKAPILCFLGPPGVGKTSLGQSIARALERPFV
LON_MYCSM       R---------------------------GSGAVMVLAGPPGVGKTSLGESVARALDRKFV
LON_SALAI       R---------------------------GSGAVLALAGPPGVGKTSLGESVARALGRRFV
LON_CHLAA       N---------------------------RE-PILAFVGPPGVGKTSLGQSIARALGRSFV
LON_DEIRA       V---------------------------NKGPILVFTGPPGVGKTSIAQSIAKSLGRKYV
LON2_THET2      V---------------------------NKGPILLFVGPPGVGKTSIAKSIAEALGRKYV
LON1_SORC5      I---------------------------SRGPILLFLGPPGTGKTSIAESIARALGRKYV
LON_NITOC       -----------------------------KSPILCFVGPPGVGKTSVGQSMARALGRKFE
LON_FUSNN       -----------------------------NGVILCLSGPPGIGKTSLVKSIAESMGRKFV
LON_MYCA5       G-EENRFIDKNLFVNKTGN---FLKDRVNNIPILTLIGPPGTGKTTLAKSIAEALGRQFV
LON_MYCMO       IPNSDYEINKNLFTKKNASDDTYSYKSSNNVPILALVGPPGTGKTSLAKAIAETLDRKFI
LON_MYCH2       EKVGSDYIDSNLFLSHKIR-----KVRSNSIPILTLVGPPGTGKTSIAMAVAEAIGKEFV
LON_MYCGE       ---------------------------KNKGPIMCLVGPPGVGKSSLAKSIAEALDKKFV
LON_MYCPN       ---------------------------KLKGPIMCLVGPPGVGKSSLAKSIAEALNKCFV
LON_MYCPE       ---------------------------SAKGSIICLVGPPGVGKTSLAQSIAEALKKKFV
LON_UREP2       ---------------------------NLKGPIICLVGPPGVGKTSLVTSIAQALNKKFV
LON_MYCMS       ---------------------------SLKGPIITFVGPPGVGKTSLARSIAEALGKKFV
LON_AYWBP       ---------------------------KNPQNILCLVGPPGVGKTSLASSIAKALGRQFV
                                                :  : *.** **:::  ::.        

LON_CAMC1       RIALGGLEDVNELRGHRRTYIGAMPGRIVQGLIEAKQMNPVVVLDEIDKVGRSYRGDPTA
LON_CAMJE       RIALGGLEDVNELRGHRRTYIGAMPGRITQGLIEAKQINPVIVLDEIDKLNRSFRGDPSA
LON_HELPY       RIALGGLEDVNELRGHRRTYIGSMPGRIVQGLIEAKKMNPVMVLDEIDKVDRSVRGDPAS
LON_HELPJ       RIALGGLEDVNELRGHRRTYIGSMPGRIVQGLIEAKKMNPVMVLDEIDKVDRSVRGDPAS
LON1_BORBU      RFSVGGMRDESEIKGHRRTYVGALPGKIIQGLRITKTNSPVFLIDEVDKISASSYGDPFS
LON_BORDL       RFSVGGIRDESEIKGHRRTYVGALPGKIIQGLRITKTNSPVFLIDEIDKVSSSHYGDPFS
LON_LEPIC       RFSVGGMRDEAEIKGHRRTYIGSMPGKIISALRITKERDCVILLDEIDKLSIGIQGDPAS
LON_TREPA       RFSVGGISDEAEIKGHRRTYIGALPGKVLQGLKIVKTKAPVFMIDEVDKIGSGARGDPAG
LON_CHLMU       RFSVGGMRDEAEIKGHRRTYIGAMPGKLVQALKQSAIMNPVIMIDEVDKIGSSYHGDPAS
LON_CHLTR       RFSVGGMRDEAEIKGHRRTYIGAMPGKLVQALKQSQIMNPVIMIDEVDKIGSSYHGDPAS
LON_CHLPN       RFSVGGMRDEAEIKGHRRTYIGAMPGKMVQALKQSQAMNPVIMIDEVDKIGASYHGDPAS
LON_PARUW       RFSVGGMRDEAEIKGHRRTYVGAMPGKMIQALKYCQTMNPVIMLDEVDKMGKSFQGDPAS
LON1_DESPS      RFSLGGMRDEAEIKGHRRTYIGAMPGKVIQAIKSCKSANPLIMLDEIDKIGASFRGDPAS
LON1_PELCD      RFSLGGMRDEAEIKGHRRTYIGAMPGRFIQAMKSAGTANPVLMLDEIDKVGASFQGDPAS
LON_MAGMM       RFSVGGMRDEAEIKGHRRTYVGAMPGKFVQAIKHTKVANPLIMLDEVDKIGASYQGDPAS
LON2_HYDCU      RFSVGGMRDEAEIKGHRRTYIGAMPGKFVQALKDCETANPVIMLDEIDKIGSSYQGDPAS
LON_CLOB8       RLSLGGVRDEAEIRGHRRTYVGAMPGRIIQSIKKAGEINPVMVLDEVDKLMASYNGDPAS
LON_METBF       RISLGGVKDEAEIRGHRRTYIGALPGRIIQGMRKAGTKNPVFILDEVDKLSASYSGDPAS
LON_METST       RVSLGGVNDESEIRGHRRTYLGALPGRIINGMKKAGKTNPVFVLDEIDKMTESLNGNPTS
LON1_BDEBA      RVALGGVRDDAEIRGHRRTYIGALPGRIIAGIKKAGENDPVFILDEIDKLTRGFGGDPAS
LON_CYTH3       RMSLGGVHDESEIRGHRKTYIGAMPGKIIQGIKRSETSNPVFILDEIDKISKDFRGDPSS
LON_FLAJ1       RISLGGLRDEAEIRGHRKTYIGAMPGRIIQSLKKAGTSNPVFILDEIDKLSSGNSGDPSS
LON_PARD8       RVSLGGLHDEAEIRGHRRTYIGAMCGRIIQNIQKAGTSNPVFILDEIDKITNDFKGDPAS
LON_PORG3       RISLGGLHDEAEIRGHRRTYIGAMCGRIIQSLQRAGTSNPVFVLDEIDKIDSDYKGDPSS
LON_AMOA5       KVSLGGLHDEAEIRGHRKTYVGAMPGRIIKGIQNSGSSNPVFMLDELDKIT-DLRGDPAA
LON_CHLT3       RISLGGVRDEAEIRGHRRTYIGSMPGRIIQGIKTAGTSNPVFMLDEIDKIGADFRGNPSS
LON_ACIB3       RMALGGVRDEAEIRGHRRTYIGAMPGKIVQSLTKVGVKNPLFLLDEIDKMAQDYRGDPAS
LON_DICNV       RIALGGLHDEAEIRGHRRTYIGALPGKIVQKLCKLGSNNPVILLDEIDKIGHDHHGDPAA
LON_BRUAB       RMSLGGVRDEAEIRGHRRTYIGSMPGKVIQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSS
LON_BRUA2       RMSLGGVRDEAEIRGHRRTYIGSMPGKVIQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSS
LON_BRUME       RMSLGGVRDEAEIRGHRRTYIGSMPGKVIQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSS
LON_BRUSU       RMSLGGVRDEAEIRGHRRTYIGSMPGKVIQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSS
LON_RHIME       RMALGGVRDEAEIRGHRRTYIGSMPGKVVQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSS
LON_AZOC5       RVSLGGVRDEAEIRGHRRTYIGSMPGKIIQSMRKAKKSNPLFLLDEIDKMGADFRGDPSA
LON_AZOBR       RMSLGGVRDEAEVRGHRRTYIGSMPGKVIQGMKKAKSSNPLFLLDEIDKLGADWRGDPSS
LON_CAUVC       RMSLGGVRDEAEIRGHRRTYIGSMPGKVVQSMKKAKTTNAFVLLDEIDKMGSDYRGDPAS
LON_CAUVN       RMSLGGVRDEAEIRGHRRTYIGSMPGKVVQSMKKAKTTNAFVLLDEIDKMGSDYRGDPAS
LON_BUCAI       RIALGGIRDEAEIRGHRRTYIGSMPGKLIQKMAKAKVKNPLFLLDEIDKMSRDIRVDPAS
LON_BUCAP       RMALGGIRDEAEIRGHRRTYIGSMPGKLMQKMVKAKVKNPLFLLDEIDKMSCDIRVDPAS
LON_BUCBP       RMALGGIRDEAEIRGHRRTYIGSMPGKIIQKMAKVGVKNPLFLLDEIDKMSCDIRVDPAS
LON_ECOLI       RMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPAS
LON_ECOL6       RMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPAS
LON_SHIDS       RMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPAS
LON_ERWAM       RMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPAS
LON_VIBPA       RMALGGVRDEAEIRGHRRTYIGSLPGKLIQKMSKVGVKNPLFLLDEIDKMSSDMRGDPAS
LON_HAEIN       RMALGGVRDEAEIRGHRKTYIGALPGKLIQKMAKVGVKNPLFLLDEIDKMASDMRGDPAS
LON_XANOR       RMSLGGIRDEAEIRGHRRTYVGSMPGRLVQNLNKVGSKNPLFLLDEIDKMSMDFRGDPSS
LON1_HYDCU      RMSLGGVRDEAEIRGHRKTYLGALPGRVIQKMKTAGTRNPLFLLDEIDKMARDLRGDPAS
LON_FRAP2       RMALGGVRDESEIRGHRRTYIGSMPGQIIQKIIKSKTENPLFLLDEIDKISSDFRGDPSA
LON_NEOSM       RMSLGGIKDESEIKGHRRTYIGAMPGKIIQHMKKAKLSNPVFLLDEIDKMSSDFRSDPAF
LON_WOLPP       RISLGGIRDESEIRGHRKTYIGSMPGKIIQHMKKANSCNPLFLLDEIDKMGSDSRGDPAS
LON_RICCN       KLALGGVRDEAEIRGHRKTYLGSMPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPAS
LON_RICFE       KFALGGVRDEAEIRGHRKTYLGSTPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPAS
LON_RICPR       KFSLGGVRDEAEIRGHRKTYLGSMPGKILGQLKKIKTSNPVMLLDEIDKMSSDFRGDPAS
LON_RICTY       KFSLGGVRDEAEIRGHRKTYLGSMPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPAS
LON_RICBR       KFALGGVRDEAEIRGHRKTYLGSMPGKILTQLKKVKTSNPVMLLDEIDKMGSDFRGDPAS
LON_ORITI       KFALGGVRDEAEIRGHRKTYIGAMPGKIISLIKRENSNNLVILLDEIDKISRDSRGDPAF
LON1_MYXXA      RLSLGGVRDEAEIRGHRRTYIGAMPGKLIQSLKKAGSNNPVFLLDEIDKMSTDFRGDPSA
LON3_SORC5      RLSLGGVRDEAEIRGHRRTYIGALPGKLIQSLKKVGTNNPVFLLDEVDKMSTDFRGDPAA
LON1_SYNFM      RLSLGGVRDEAEIRGHRRTYIGAMPGKIIQSLKKVKSNNPVFCLDEVDKMSMDFRGDPSA
LON2_DESPS      RLSLGGLRDEAEIRGHRRTYVGAMAGKVLRAMQKVGVANPVFCLDEIDKMSTDFRGDPAA
LON_DESVH       RLSLGGVRDEAEIRGHRRTYVGALPGKIIQSLKRVKHNNPLFCLDEIDKMSTDFRGDPSS
LON_SOLUE       RMSLGGVRDEAEVRGHRRTYIGALPGQIIQMMKKAGTRNPVFMLDEVDKMSMDFRGDPSA
LON1_BACSU      RISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVFLLDEIDKMSSDFRGDPSS
LON_BACAH       RVSLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAKSVNPVFLLDEIDKMSNDFRGDPSA
LON_BRECH       RISLGGVRDEAEIRGHRRTYVGALPGRIIQGMKQAGTINPVFLLDEIDKLASDFRGDPAS
LON_DESRM       RISLGGVRDEAEIRGHRRTYVGAMPGRVIQGMRTAGSKNPVFLLDEIDKMASDFRGDPSS
LON_HELMI       RLSLGGVRDEAEIRGHRRTYVGAMPGRLIQGLRTAGSKNPVFLLDEIDKMSMDFRGDPAS
LON_SYNWW       RMSLGGIRDEAEIRGHRRTYVGSMPGRILQGMKTAGSKNPVFLLDEIDKMTMDFRGDPAS
LON_HALOH       RLSLGGVRDEAEIRGHRRTYIGSRPGRIINAMREAGSKNPVFLLDEVDKMSSDFRGDPAA
LON_CALS8       RISLGGLRDEAEIRGHRKTYVGAMPGRIIYALRQAKTKNPLILLDEIDKMSQDFRGDPAS
LON_CLOD6       RISLGGVRDEAEIRGHRRTYVGSIPGRIINGVKEAQTKNPVFLFDEIDKMAADYKGDPAS
LON_CLOAB       RISLGGVNDEAEIRGHRRTYVGAIPGRIIYGMKQAKSNNPLMLLDEIDKMSSSYKGESAD
LON_FINM2       SMRLGGVRDEAEIRGHRKTYIGAMPGRIITQLQKAKKLNPVFLLDEIDKLASDFRGDPAS
LON_ELUMP       RMSLGGVRDESEIRGHRRTYIGSMPGRIIQGISKAKSNNPVFLLDEIDKMGSDWRGDPAA
LON_UNCTG       RISMGGVKDEAEIRGHRRTYIGSMPGKIIQSIKKAGSNNPVFILDEIDKIGSDWRGDPSS
LON_FERNB       RMSLGGLRDEAEIRGHRRTYVGAMPGRIMQLIRKLGVKNPVILLDEIDKMGISFQGDPAS
LON_PSELT       HMSLGGLRDEAEIKGHRRTYVGAMPGRILQLIRTAQSKNPVLLLDEIDKMAVSFQGDPAA
LON_COPPD       RISLGGIRDEAEIRGHRRTYVGAMPGRIIQGIRSAGTKNPVFVLDEIDKLSSDFLGDPSA
LON1_THET2      RISLGGVRDEAEIRGHRRTYIGALPGKIIQGMKQVGVVNPVFLLDEIDKLSSDWRGDPAA
LON_AQUAE       RIALGGIRDEAEIRGHRRTYVGAMPGRIIQAIKQAGTKNPVIMLDEIDKLAISFQGDPAA
LON_SULSY       RISLGGVRDEAEIRGHRRTYVGAMPGKIIQAIKQARTKNPVIMLDEVDKIGLDFRGDPTA
LON_GEOLS       RISLGGVRDEAEIRGHRRTYLGALPGRIIQGMKQAGTRNPVFMLDELDKLGYDYKGDPSA
LON_GEOMG       RISLGGVRDEAEIRGHRRTYVGALPGRIIQGLKQAGSNNPVFMLDELDKLGADFRGDPSS
LON2_BDEBA      RIALGGVKDEAEIRGHRRTYVGAMPGKIIQALRQAKTSNPVIVLDEIDKLGSDFRGDPSA
LON_DESAL       RLSLGGIRDEAEIRGHRRTYIGALPGRIIQGLKHCKSNNPVFMMDEIDKIGADFRGDPSS
LON_LAWIP       RISLGGMHDEAEIRGHRRTYIGAMPGRLIQAMKQAGTKNPVILLDEIDKLGNDFRGDPSS
LON_CHLAD       RTSLGGVRDEAEIRGHRRTYIGAMPGRIIQAMKNAKSKSPVYILDEVDKIGLDFRGDPTS
LON2_HERA2      RLSLGGVHDEAEIRGHRRTYIGAMPGRIIQTMKDAGTINPVFMLDEIDKLGNDFRGDPAA
LON_KORVE       RISLGGVHDEAEIRGHRRTYIGALPGQIMQGIRRAETNDPVFMLDEIDKVGRDFRGDPSA
LON1_HERA2      RLSLGGVHDEAEIRGHRRTYIGAMPGSLIQAIRRSGVNNPVVLLDEIDKLSSDHRGDPTS
LON_DESOH       RISLGGVRDEAEIRGHRRTYVGALPGRIIQEIRKAGTNNPVFMLDEIDKVGADFKGDPSS
LON_SYNAS       RISLGGVHDEAEIRGHRRTYVGALPGRIIQGIRRAESSNPVFVLDEIDKVGSDFRGDPSS
LON2_SYNFM      RISLGGVRDEAEIRGHRRTYVGALPGRIVQGLRRVGSNNPVFMLDEIDKIGMDFRGDPSS
LON_DICT6       RISLGGIRDEAEIRGHRRTYVGALPGRIIQGIRKAESNNPVFMLDEIDKLGSDFRGDPAA
LON_ROSCS       RVALGGVRDEAEIRGHRRTYIGALPGRIIQGINRAGSNNPVFMLDEVDKLSVGFQGDPAA
LON_GEOBB       RISLGGMRDEAEIRGHRRTYIGALPGRIIQEINRAGSNNPVFMLDEVDKIGADFRGDPAS
LON2_PELCD      RISLGGMKDEAEIRGHRRTYIGAMPGRIIQEICRAGANNPVFMLDEVDKIGQDFRGDPAA
LON_ANADE       RLSLGGVRDEAEIRGHRRTYVGALPGRIIQSMKKAATVNPVMMLDEIDKLGADFRGDPSA
LON2_MYXXA      RLSLGGVRDEAEIRGHRRTYVGALPGRFIQSMKKAGTKNPVMMLDEIDKLGADFRGDPSA
LON2_SORC5      RIALGGVRDEAEIRGHRRTYVGALPGRILQALKKAGTKNPVLVLDEVDKMGVDLRGDPAA
LON4_SORC5      RISLGGVHDEAELRGHRRTYVGALPGRIVHALKKAKVKNPIVLLDEVDKLGAGWRGSPEA
LON_METSB       RVSLGGVHDEAEIRGHRRTYVGALPGNIIQAIRKAGARNCVMMLDEIDKMGASAHGDPGS
LON_PHEZH       RVSLGGVHDESEIRGHRRTYVGALPGNIIQAIRKAGRRDCVMMLDEIDKMSAGIHGDPSA
LON_PARPJ       RVSLGGVHDEAEIRGHRRTYIGAMPGNIIQAIRKAGARNCVMLLDELDKLGQGVHGDPAA
LON_MYCSM       RVALGGVRDEAEIRGHRRTYVGALPGRIVRAIGEAGSMNPVVLLDEIDKVGSDYRGDPAA
LON_SALAI       RVSLGGVRDEAEIRGHRRTYVGALPGRIVRALREAGSMNPVVLLDEVDKLAVGYSGDPAA
LON_CHLAA       RMSLGGVRDEAELRGFRRTYIGSQPGRIIQELRRAGTADPVILLDEIDKLGIDYRGDPAA
LON_DEIRA       RIALGGARDESDIRGHRRTYIGAMPGRIIQGIRTAGTKNPVILLDEVDKLGSSYQGDPSS
LON2_THET2      RVSLGGVRDESDIRGHRRTYIGAMPGRIIQGLRQAGTKNPVFLLDEVDKLGISYQGDPAA
LON1_SORC5      RVSLGGARDEADIRGHRRTYVGAMPGRILQGIKRIGSKNPVIVLDEVDKLGASYQGDPGA
LON_NITOC       RMSLGGLHDESELRGHRRTYIGAMPGRIIRAIRRTGYQNPLLMLDEIDKLGRDFRGDPAA
LON_FUSNN       RVSLGGVRDEAEIRGHRRTYVGSMPGKIMKAMKEAGTNNPVMLLDEIDKMSNDFKGDPAS
LON_MYCA5       KISLGGVKDESEIRGHRRTYVGALPGKIISGIKKAGVSNPVILLDEIDKMSSDFRGDPLS
LON_MYCMO       KISLGGVKDEAEIRGHRRTYVGALPGKIIQAIKKAGVSNPVILLDEIDKMSSDYKGDPTS
LON_MYCH2       KISLGGIRDEAEIRGHRRTYVGALPGKIIQALKKVGVSNPLILLDEIDKMGADFKGDPSA
LON_MYCGE       KISLGGVHDESEIRGHRKTYLGSMPGRILKGMTRAKVINPLFLLDEIDKMTSSNQGYPSG
LON_MYCPN       KVSLGGVHDESEIRGHRKTYLGSMPGRILKGMVRAKVINPLFLLDEIDKMTSSNQGYPSG
LON_MYCPE       KVSLGGMRDEAELKGHRKTYIGAMPGRIIKAMSKAGVVNPVFLLDEIDKLGSDHKGDPAS
LON_UREP2       KVSLGGVRDESEIRGHRKTYVGAMPGRIIKGMKKAGVINPLFLLDEIDKMTSDQRGDPAA
LON_MYCMS       KVSLGGVKDESEIRGHRKTYVGSMPGRIIQALKRAKVKNPLFLLDEIDKMASDNRGDPAS
LON_AYWBP       RQSLGGLKEESEIRGHRRTYIGAMPGRILAGIRDAKTVNPVFLLDEIDKLVTNYNFDPAS
                   :**  :  :::*.*:**:*:  * .   :        .  :**:**:  .    .  

LON_CAMC1       VLLEILDPEQNNKFRDYYLNFNIDLSKIIFIATANDVSMIPAALRDRMEFIELSSYTPQE
LON_CAMJE       VLLEILDPEQNSKFRDYYLNFNIDLSKVIFIATANDISNIPAPLRDRMEFIELSSYTPSE
LON_HELPY       ALLEILDPEQNTAFRDHYANFSIDLSQVIFIATANNIDRIPAPLRDRMEFISVSSYTPNE
LON_HELPJ       ALLEILDPEQNIAFRDHYANFSIDLSQVIFIATANNIDRIPAPLRDRMEFISVSSYTPSE
LON1_BORBU      VLLEVLDPEQNVRFRDHYLDLPFDISNVFFILTANSVETIPRPLLNRMEIIEISGYIDNE
LON_BORDL       VLLEVLDPEQNVNFRDHYLDLPFDISNVFFILTANSLETIPTPLLNRMEVIQLSGYVDDE
LON_LEPIC       ALLEVLDPEQNKNFRDHYLDLPFDISNVFFIATANTLDSISRILLDRMEIINLSGYITDE
LON_TREPA       ALLEVLDPEQNTTFRDHYLDLPFDLSHIVFVLTANSTDPIPRPLLDRAEIIRLSGYIDTE
LON_CHLMU       ALLEVLDPEQNKDFLDHYLDVRVDLSNVLFILTANVLDSIPDPLLDRMEVLRLSGYILEE
LON_CHLTR       ALLEVLDPEQNKDFLDHYLDVRVDLSNVLFILTANVLDSIPDPLLDRMEVLRLSGYILEE
LON_CHLPN       ALLEVLDPEQNKDFLDHYLDVRVDLSNVLFILTANVLDTIPDPLLDRMEILRLSGYILEE
LON_PARUW       ALLEVLDPEQNAEFLDHYLDVRCNLSEVLFIVTANVLDTIPEPLKDRMDILRLSGYIMQE
LON1_DESPS      ALLEVLDPEQNSDFLDHYLDVRFDLSKVLFICTANLLDTIPPALLDRMERIELPGYILAE
LON1_PELCD      ALLEVLDPEQNSSFRDHYLDVPFDLSNVLFVATANQLDTIPAPLLDRMEIIRLAGYILEE
LON_MAGMM       ALLEVLDPEQNSEFLDHYMDVRFDLSKVLFICTANQLDTIPRPLLDRMEVIRLSGYITSE
LON2_HYDCU      ALLEVLDPEQNSEFMDHYMDVRFDLSKTLFVCTANTLDSIPGPLLDRMEVIRLSGYITEE
LON_CLOB8       ALLEVLDPEQNDTFTDHYLDVPYDLSNVFFIATANSLDTIPRPLLDRMEVIQISSYTMNE
LON_METBF       ALLEVLDPEQNSTFSDHYLEIPYDLSDVLFIATANSMANIPWPLLDRMETIEISGYTKNE
LON_METST       ALLEVLDPEQNDSFSDNYLEVPYDLSDVFFIGTANSLQDIPGPLRDRLEIIELDSYTNTE
LON1_BDEBA      AMLEVLDPEQNNTFQDHYLDTPFDLSKVFFIATANSLEGIPLPLLDRMEVIDLSGYTVDE
LON_CYTH3       ALLEVLDPEQNSSFMDNFLEVEYDLSKVLFIATSNALDTIQPALRDRMEIIEINGYTLEE
LON_FLAJ1       ALLEVLDPEQNNAFYDNFLEMGYDLSKVMFIATSNNMAAIQPALRDRMEVIKMSGYTIEE
LON_PARD8       ALLEVLDPEQNNAFHDNYLDIDYDLSKVMFIATANNLNTISQPLLDRMELIEVSGYIMEE
LON_PORG3       ALLEVLDPEQNNAFHDNYLDIDFDLSHVLFIATANSLSSISRPLLDRMELIDVSGYIIEE
LON_AMOA5       ALLEVLDPEQNQAFVDTFLEVPYDLSKVLFIATANQLDTIPPALRDRLEIIEINGYTIEE
LON_CHLT3       ALLEVLDPAQNNAFSDHYLEIPYDLSKVMFIATANTLDPIPVPLRDRMEIINLSGYTEYE
LON_ACIB3       ALLEVLDPSQNSKFNDHYLDLDLDLSEVMFICTANSMN-IPEALLDRMEVIRLPGYTEDE
LON_DICNV       ALLEVLDPAQNHTFNDHYLETDIDLSNVLFIATANTLN-ISEPLLDRMEVIRLPGYTTQE
LON_BRUAB       AMLEVLDPEQNATFMDHYLEVEYDLSNVMFVTTANTMN-IPVPLLDRMEIIRIAGYTEDE
LON_BRUA2       AMLEVLDPEQNATFMDHYLEVEYDLSNVMFVTTANTMN-IPVPLLDRMEIIRIAGYTEDE
LON_BRUME       AMLEVLDPKQNATFMDHYLEVEYDLSNVMFVTTANTMN-IPGPLLDRMEIIRIAGYTEDE
LON_BRUSU       AMLEVLDPEQNATFMDHYLEVEYDLSNVMFVTTANTMN-IPGPLLDRMEIIRIAGYTEDE
LON_RHIME       ALLEVLDPEQNSTFMDHYLEVEYDLSNVMFITTANTLN-IPPPLMDRMEVIRIAGYTEDE
LON_AZOC5       ALLEVLDPEQNPTFNDHYLEVDYDLSNVMFVTTANTLN-IPPALLDRMEVIRIAGYTEDE
LON_AZOBR       ALLEVLDPEQNGTFNDHYLEVDYDLSDVMFVCTANTMR-MPQPLLDRMEIIRVAGYTEDE
LON_CAUVC       ALLEVLDPSQNSTFGDHYLEVDYDLSQVMFVTTANSLN-MPQPLLDRMEIIRIPGYTEDE
LON_CAUVN       ALLEVLDPSQNSTFGDHYLEVDYDLSQVMFVTTANSLN-MPQPLLDRMEIIRIPGYTEDE
LON_BUCAI       ALLEVLDSEQNMNFNDHYLEVDYDLSDVMFVATSNSMN-IPAPLLDRMEIIRLSGYTEDE
LON_BUCAP       ALLEVLDPEQNINFNDHYLEVDYDLSDVMFVATSNSMN-IPAPLLDRMEIIRLSGYTENE
LON_BUCBP       ALLEVLDPEQNVAFNDHYLEVDYDLSNVMFIATSNSTN-IPAPLLDRMEIIRISGYTEFE
LON_ECOLI       ALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMN-IPAPLLDRMEVIRLSGYTEDE
LON_ECOL6       ALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMN-IPAPLLDRMEVIRLSGYTEDE
LON_SHIDS       ALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMN-IPAPLLDRMEVIRLSGYTEDE
LON_ERWAM       ALLEVLDPEQNIAFNDHYLEVDYDLSDVMFVATSNSMN-IPAPLLDRMEVIRLSGYTEDE
LON_VIBPA       ALLEVLDPEQNNSFNDHYLEVDYDLSDVMFVATSNSMN-IPGPLLDRMEVIRLSGYTEDE
LON_HAEIN       ALLEVLDPEQNTTFNDHYLEVDYDLSDVMFVATSNSMN-IPGPLLDRMEVIRLSGYTEDE
LON_XANOR       ALLEVLDPEQNNSFNDHYLEVDLDLSEVMFVATSNSLN-IPGPLLDRMEVIRIPGYTEDE
LON1_HYDCU      ALLEVLDPEQNKAFNDHYLEVDYDLSDVMFVATSNSMD-IPEALLDRMEIIDLAGYTENE
LON_FRAP2       ALLEVLDPEQNSTFNDHYLEIDYDLSKVMFVATANSLD-IDPALRDRLEIIHLSGYTEIE
LON_NEOSM       ALLEVLDPEQNAHFVDHYLEVEYDLSDVMFVATANSLN-MIPALLDRLEIIRLEAYSEEE
LON_WOLPP       ALLEVLDTEHNKHFTDHYLEVEFDLSSVMFVATANSLN-LPHPLRDRMEIIQLSGYTEDE
LON_RICCN       ALLEVLDPEQNSHFVDHYLEVEYDLSNVIFIATANSHD-LPRALSDRMEKIYISGYVEET
LON_RICFE       ALLEVLDPEQNSHFVDHYLEVEYDLSNVIFIATANSHD-LPRALSDRMEKIYISGYVEEE
LON_RICPR       ALLEVLDPEQNSHFVDHYLEVEYDLSNVVFIATANSHD-LPRALSDRMEKIYISGYVEEE
LON_RICTY       ALLEVLDPEQNSHFVDHYLEVEYDLSNVVFIATANSHD-LPRALSDRMEKIYISGYVEEE
LON_RICBR       ALLEVLDPEQNSHFVDHYLEVEYDLSNVIFIATANSYN-LPRALIDRMEIIDISGYMEEE
LON_ORITI       ALLEVLDPEQNSRFQDNYLEVEYDLSKVLFIATANSFN-FPIPLRDRMEIIQIPGYVEGE
LON1_MYXXA      ALLEVLDPEQNHTFNDHYLDLDYDLSKVMFICTANTMHNIPGPLQDRMEVIRIAGYTEPE
LON3_SORC5      ALLEVLDPEQNHTFNDHYLDLDYDLSDVMFITTANTLSGIPVPLQDRMEVIQLSGYTEFE
LON1_SYNFM      ALLEVLDPEQNFSFNDHYLDLDYDLSEVFFITTANNLHSIPPPLRDRMEIIQIAGYTEFD
LON2_DESPS      ALLEVLDPEQNSSFNDHYLDLDYDLSQVFFITTANSLEGIPIPLQDRMEIIQLSGYTEED
LON_DESVH       ALLEVLDPEQNSTFNDHYLDMDYDLSQVFFITTANSLHSIPLPLQDRMEIIRLPGYLETE
LON_SOLUE       ALLEVLDPEQNFMFVDHYLDVEYDLSQVFFVATANVMHTIPAALQDRMEVIRLSGYTELE
LON1_BACSU      AMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPGPLRDRMEIINIAGYTEIE
LON_BACAH       ALLEVLDPEQNHNFSDHYIEEPYDLSKVMFVATANTLSSIPGPLLDRMEIISIAGYTELE
LON_BRECH       ALLEVLDPNQNDKFSDHYIEETYDLTNVMFITTANSLDTIPRPLLDRMEVISISGYTELE
LON_DESRM       ALLEVLDPEQNSTFSDHYIETPFDLSNVMFITTANNMYSIPRPLLDRMEVIQISGYTEEE
LON_HELMI       ALLEVLDPEQNSTFSDHFIEVPFDLSKVLFITTANGMHNIPRPLLDRMEVIYIPGYTEEE
LON_SYNWW       ALLEVLDPEQNYIFSDHYLEIPFDLSKVMFITTANSVFNIPRPLLDRMEIIEITGYTEED
LON_HALOH       ALLEVLDPEQNNEFTDHYLELPFDLSKVLFVTTANVAYPIPAPLLDRMEVIELPGYTEDE
LON_CALS8       ALLEVLDSEQNYAFRDHYVEIPFDLSEVMFIATANTLETIPRPLLDRLEVIEITGYTEEE
LON_CLOD6       AMLEVLDPEQNKDFVDHYLEIPFDLSKILFVTTANSLGNIPRPLLDRMEVIEVSGYIEEE
LON_CLOAB       ALLEVLDTSENNKFRDNYLELDFDLSDVMFVTTANTLETIPRPLMDRMEIIEVSGYTYEE
LON_FINM2       ALLEVLDPEQNSEFTDNYIEIPVDLSDVLFITTANSQEQIPDALLDRMEVIRVTSYTDSE
LON_ELUMP       ALLELLDPEQNKDFSDHYLDVPFDVSKVMFITTANSLSSIPVTLRDRLEIIDFSGYTEYE
LON_UNCTG       ALLEVLDPEQNYTFNDHYLDVDFDLSNVMFITTANTLNNIPVTLFDRLELIRFSSYTDVE
LON_FERNB       ALLEVLDPEQNKEFVDHYIELPYDLSEVLFVTTANVLYTIPPALRDRMEVIEISSYTDVE
LON_PSELT       ALLEVLDPEQNKEFVDHYLEIPFDLSNVLFITTANVTHTIPPALLDRMEIIELEGYTDYE
LON_COPPD       ALLEALDPEQNYAFQDHYLEVPFDLSEVFFITTANNLYTIPPALLDRMEVIRVPGYTEEE
LON1_THET2      ALLEVLDPEQNHTFTDHYLDVPYDLSKVFFITTANTLSTIPRPLLDRMEVIEIPGYTLHE
LON_AQUAE       ALLEVLDPEQNKKFTDLYIGIPFDLSEVIFICTGNRADTIPTPLLDRMELIMLSGYSEEE
LON_SULSY       ALLEVLDPEQNKEFIDHYLGVPFDLSEVMFICTANRLDTIPRPLLDRMEVIRLSGYSEEE
LON_GEOLS       ALLEVLDPQQNNAFSDHYVNLPYDLSNVLFVATANHSDPIPSALFDRMEVINIPGYTEEE
LON_GEOMG       ALLEVLDPEQNHMFSDHYINLPFNLSNVMFIATANQIDTVPGPLRDRMEVIQLSGYTEEE
LON2_BDEBA      AMLEVLDPEQNATFRDNYLNVDFDLSNVLFIATANVLENIPPALRDRMEILNIPGYTEND
LON_DESAL       ALLEALDPEQNFAFSDHYLNVPFDLSSVMFITTANMTDTIPSALLDRMEVINLAGYTENE
LON_LAWIP       ALLEALDPEQNHNFSDHYLNVPFDLSKVLFLCTANHLEHIPAALKDRLEIISLPGYTQQE
LON_CHLAD       ALLEVLDPEQNNAFSDHYLEIPFDLSKVIFIATANQLDPIPLPLRDRMEIIEIGGYTEDE
LON2_HERA2      ALLEVLDPEQNNTFADHYLDLPYDLSKIMFITTANMLDPIDEPLLDRMEIVELPGYIEEE
LON_KORVE       ALLEALDPEQNNSFRDNYLDVPFDLSKVLFITTANQLDPIPEPLRDRMEIIDLQGYSEEE
LON1_HERA2      AMLEVLDPAQNTNFRDHYLDVAWDLSPVMFIATANTLQTIPAPLRDRLEIIQLGSYTMRE
LON_DESOH       ALLEVLDPEQNFSFADHYLDVSFDLSRVMFVATANVIDTIPPALRDRMEVIGLRGYTLEE
LON_SYNAS       ALLEVLDPEQNFAFMDHYLGVAFDLSHVTFITTANILDTIPPALRDRLEVIELPGYTQDE
LON2_SYNFM      ALLEVLDPEQNFSFSDHYLGVPFDLSRVMFIATGNLLDTVPAALKDRMEVIEIPGYTAEE
LON_DICT6       ALLEVLDPEQNNAFVDNYLGVPFDLSKVMFIATANVLYTIPPALLDRMEVIELPGYTEYQ
LON_ROSCS       ALLEVLDPEQNVAFVDRYLDVPFDLSRALFICTANRSDTIPPALLDRMELLELAGYTEME
LON_GEOBB       ALLEVLDPEQNFSFTDHYLDVPFDLTNVMFITTANQLDPIPAPLKDRMEVITLSGYTDEE
LON2_PELCD      ALLEVLDPEQNYSFTDHYLDVPFDLSHVMFITTANVMDTVPPPLRDRMEVLRLPGYSDEE
LON_ANADE       ALLEVLDPEQNHAFSDHYLDLSYDLSKVMFIGTANLLDPIPGPLKDRMEILELPGYTFEE
LON2_MYXXA      ALLEVLDPEQNNTFSDHYLDVPFDLSKVMFVATANQLDPIPGPLRDRMEIIELTGYTFEE
LON2_SORC5      ALLEVLDPEQNSTFQDHYLDLPFDLSQVMFLATANNWDGIPGPLVDRMEVIEVPGYTRTD
LON4_SORC5      ALLEVLDPEQNRTFVDHYLELPFDLSEVVFLCTVNDLGALSAPLRDRLEVIELSGYTPDE
LON_METSB       AMLEVLDPEQNSTFRDNYLAVPFDLSRVVFIATANMLDTVPGPLRDRMEIIALTGYTDRE
LON_PHEZH       ALLEVLDPEQNVAFRDNYLAVPFDLSRVVFIATANMLDTIPGPLRDRMEVIQLSGYTAGE
LON_PARPJ       AMLEVLDPEQNASFRDNYLGVPFDLSAIVFVATANQIEGIAGPLRDRMEILDLPGYTEAE
LON_MYCSM       ALLEVLDPAQNHTFRDHYLDLDLDLSDVVFLVTANVIENIPSALLDRMELVEIDGYTADD
LON_SALAI       ALLEVLDPAQNHTFRDHYLEVDLDLSDVLFLATANVVEAIPSPLLDRMELVTLDGYTEDE
LON_CHLAA       ALLEVLDPEQNHTFTDHYLNLPFDLSRVLFLATANTWDTVPPALRDRMEVIELSGYIEDE
LON_DEIRA       ALLEVLDPSQNQHFTDHYLGVPFDLSEVMFIATANYPEQIPAALMDRMEVIEFNSYIEQE
LON2_THET2      ALLEVLDPAQNKEFVDHYLGVPFDLSEVMFICTANFPQNIPAPLYDRMEPIEFTSYTEQE
LON1_SORC5      ALLEVLDPAQNDGFVDHYLGLPFDLSEVLFICTANFRETIPPPLFDRMEPALFAGYTEQE
LON_NITOC       ALLEILDPAQNAEFHDNYLDLPFDLSKIFFVTTANTLDTIPRPLLDRMEILRLPGYSDEE
LON_FUSNN       AMLEVLDPEQNKNFEDHYIDMPFDLSKVFFVATANDLRNVSAPLRDRMDILQLSSYTEFE
LON_MYCA5       ALLEVLDPEQNTNFQDHYLDLEYDLSKVLFIATANSFDSIPAPLYDRVEFLELSTYTLIE
LON_MYCMO       AMLEVLDPEQNVNFQDHYIELEYDLSKVLFIATANYYQNISAPLLDRVEIIELSSYTSLE
LON_MYCH2       AMLEVLDPEQNRFFQDHYLELEYDLSQVLFVATANEIYDIPEPLLDRVEIIELSSYTFIE
LON_MYCGE       ALLEVLDPELNNKFSDNYVEEDYDLSKVMFIATANYIEDIPEALLDRMEIIELTSYTEQE
LON_MYCPN       ALLEVLDPELNNKFSDNYVEEDYDLSKVMFVATANYIEDIPEALLDRMEVIELTSYTEQE
LON_MYCPE       AMLDILDPEQNNRFSDNYIEEDYDLSNVLFIATANYEENIPEPLHDRLEIIRLSSYTENE
LON_UREP2       AMLEVLDPEQNKNFSDNYIEEEYDLSKVMFMATANYYQQIPYALIDRLEVIELSSYTAIE
LON_MYCMS       AMLEVLDPEQNKEFSDHYIEEPYDLSTVMFIATANYIENIPEALYDRMEIINLSSYTEIE
LON_AYWBP       ALLEVLDPQQNINFMDHFLSEPFDLSQVLFIATANYLDNVPEALKDRMEIIEVSSYTEKD
                .:*: **.  *  * * :     :::   *: * *    .   * :* :   .  *    

LON_CAMC1       KFEIAKKYLLPQELKKHGLKPSD-VSISKEALELIISDYTRESGVRNLRRRIADILRKVA
LON_CAMJE       KFHIMKKYLIPDELKKHGLKSNE-LSIDDETIELIISDYTRESGVRNLRRKVAELCRKSA
LON_HELPY       KEEIAKNYLIPQELEKHALKPSE-VEISHECLKLIIEKYTREAGVRDLRRQIATIMRKVA
LON_HELPJ       KEEIAKNYLIPQELEKHALKPSE-VDISHECLKLIIEKYTREAGVRDLRRQIATIMRKAA
LON1_BORBU      KIEIARKYLIPKVLSENGVDKDS-LKFQSSSLVQIAQEYARDNGVRNFEKYLNKIVRKVA
LON_BORDL       KIEIARKYLIPKVLKENGVDKDS-LKFQSSSLVQIAREYARDNGLRNFEKYLKQIVRKIA
LON_LEPIC       KVQIFQKYLWKKVLYKNGVTPYG-IEFDKKAIVALIDSYSRESGVRGLEKVTDKLVRKIA
LON_TREPA       KVEIAKRHLVPKTLEKNGLKRAC-VSYRKEVLLHLVHSYARESGVRGLEKSLDKLHRKLA
LON_CHLMU       KLQIATKYLVPRARKEMGLSAQN-VSFQPEALKHMINNYAREAGVRTLNENIKKVLRKVA
LON_CHLTR       KLQIATKYLVPRARKEMGLSAQN-VTFQPEALKHMINNYAREAGVRTLNENIKKVLRKVA
LON_CHLPN       KLQIAKKYLVPKARKEIGLTASE-VNFQPEALKYMINNYAREAGVRTLNGNIKKVLRKVA
LON_PARUW       KLEIAKKYLIPRNRKEMGLKALE-VSFTQEALRSIINGYARESGVRNLENLLKKILRKLA
LON1_DESPS      KIAIARKHLIPRQMKHHGLRPSQ-IIISNPVLTAIVEGYAREAGVRGLETCIRKILRKTI
LON1_PELCD      KLEIARRYLIPKALENHGLKKGQ-VTIRKDALRAIIDGYAREAGVRNLENRIKKIMRHAA
LON_MAGMM       KVRIARNHLLPKQLEKNGLDKSQ-LRVSNGALREIIEGYAREAGVRRLEQKIGAIARKVA
LON2_HYDCU      KIQIAKHHLWPSLLEDAGLNKKQ-IQITPATIRHVIEGYAREAGVRNLKKQLAKLIRKLA
LON_CLOB8       KFHIGKNHLISAVLEEHGLNDTQ-LVIEDAALERIISEYTLEAGVRGLKKQIATIARIAS
LON_METBF       KLAIAKDHLVPCILEDHGLDAEK-LKIEDEALKVIIDKYTREAGVRGLKKQLAKTARFVS
LON_METST       KHHIADEHLIKEVLLEHGLTEDD-LKITYDAIDCLIEKYTRESGVRGLKREIAAIARYVT
LON1_BDEBA      KRQIARSHLWPKQLKEHGLEENQ-LQITDQALTKLLTHYTREAGVRDLQRKIASICKHMS
LON_CYTH3       KIQIAKKYLIPKQKEEHGLKAKD-ISFTDAAIVKIIEDYTRESGVRNLERKIGAVVRNIA
LON_FLAJ1       KVEIAKRHLFPKQLEAHGLTSKD-LTIGKKQLEKIVEGYTRESGVRNLETKIAQVIRNAA
LON_PARD8       KVEIAAKHLVPKQMDVHGLKKGS-VKFPKKTLQVIVEAYTRESGVRELDKKIAKIMRKLA
LON_PORG3       KVEIAARHLIPKQLVEHGFRKND-IKFSKKTIEKLIDDYTRESGVRTLEKQIAAVIRKIT
LON_AMOA5       KLQIAKKYLFPKQRKENGLKATD-LSIHDTAIVKVIESYTRESGVRELDRKLASLVRKVG
LON_CHLT3       KLHIAERYLIPRQLEEHGIRPED-VSFDALTTKKIINAYTREAGVRNLERQIANVCRVIA
LON_ACIB3       KVNIAERYLVPKAIKNNGLRPKE-LTIHEEAIRDIVQRYTREAGVRNLEREVSKIARKVV
LON_DICNV       KIQIAKRYIVPRQRKENVLKASE-FKIKNGVLNDVIEDYTREAGVRNLEREIGKLARKSV
LON_BRUAB       KLEIAKRHLLPKAIKDHALQPKE-FSVTEDALRNVIRHYTREAGVRSLEREVMTLARKAV
LON_BRUA2       KLEIAKRHLLPKAIKDHALQPKE-FSVTEDALRNVIRHYTREAGVRSLEREVMTLARKAV
LON_BRUME       KLEIAKRHLLPKAIKDHALQPKE-FSVTEDALRNVIRHYTREAGVRSLEREVMTLARKAV
LON_BRUSU       KLEIAKRHLLPKAIKDHALQPKE-FSVTEDALRNVIRHYTREAGVRSLEREVMTLARKAV
LON_RHIME       KREIAKRHLLPKAIRDHALQPNE-FSVTDGALMAVIQNYTREAGVRNFERELMKLARKAV
LON_AZOC5       KAEISRKHLIPNALQKHGLSAKE-WSIDDAALLQVIRRYTREAGVRNLEREISTLARKAV
LON_AZOBR       KVEISKRHLIEKQVEANGLKKGE-FAISDDALRDLIRYYTREAGVRSLEREIANLCRKAV
LON_CAUVC       KLEIAKRHILPKLAKDHGLKPAE-FIVPDKAIRDLIRYYTREAGVRSLERELGALARKTV
LON_CAUVN       KLEIAKRHILPKLAKDHGLKPAE-FIVPDKAIRDLIRYYTREAGVRSLERELGALARKTV
LON_BUCAI       KLNIAKRYLYPKQIERNGLEENE-IKITDSAIISIIHYYTREAGVRSLEREISKICRKAV
LON_BUCAP       KLNIAKCYLYPKQMERNALKRNE-LIITDCAIISIIQYYTREAGVRSLEREISKICRKVV
LON_BUCBP       KLNIAKSYLKPKQIKRNALKSNE-LTIEDSVVTNIIRYYTREAGVRNLERELSKICRKCV
LON_ECOLI       KLNIAKRHLLPKQIERNALKKGE-LTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAV
LON_ECOL6       KLNIAKRHLLPKQIERNALKKGE-LTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAV
LON_SHIDS       KLNIAKRHLLPKQIERNALKKGE-LTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAV
LON_ERWAM       KLNIAKKHLLSKQIERNALKEHE-LIVDDSAIVGIIRYYTRERGVRSLERELSKLCRKAV
LON_VIBPA       KLNIAKRHLVEKQVQRNGLKPNE-IVIEDSAIIGIIRYYTREAGVRGLEREISKICRKAV
LON_HAEIN       KLNIAMRHLLAKQIERNGLKKGE-LTVEESAILDIIRYYTREAGVRGLEREISKICRKAV
LON_XANOR       KLNIAMRYLVPKQIKANGLKPEE-IEIGGDAIQDIVRYYTRESGVRNLEREVAKICRKVV
LON1_HYDCU      KLNIATQHLLPREIKEHGLKQGE-LEVPSDTILKIIQTYTREAGVRLLDQSLAKICRKSL
LON_FRAP2       KQAIAKQYLVPKALENNGLTKNE-INFTPKATLDIIRYYTREAGVRNLQQKIDGVCRKAV
LON_NEOSM       KLQIAEHYLIGKLQREHGLKKSE-WSISKEALKLLIRRYTRESGVRNLKRELANLMRKAV
LON_WOLPP       KISIATHHLIPKLKKEHGLHQKE-WEITNEALYELIRLYTRESGVRSMERELAKLMRKAV
LON_RICCN       KLQIARNYLVPKQFKMHKIKKDE-ITISETAILDLIRYYTKESGVRALEREIGALTRKAL
LON_RICFE       KLQIAKNYLVPKQFKMHKIKKDE-ITISETAILDLIRYYTKESGVRALEREIGALTRKAL
LON_RICPR       KLQIAKNYLVPKQFKMHKIKEDE-ITISEAAILDLIRYYTKESGVRALEREICALTRKAL
LON_RICTY       KLQIAKNYLVPKQFKVHKIKKDE-ITISEDAILDLIRYYTKESGVRALEREICALTRKAL
LON_RICBR       KIQIAKNYLVPKQLKMHKIKKDE-ITISDDAILDLIRYYTKESGVRSLEREIGALTRKAL
LON_ORITI       KLEIAKHHLIPKQIKNNGLKNTE-ISFSDEAILELIRYYTREAGVRGLERKIGGICRKVL
LON1_MYXXA      KLSIARRYLIPKEQEANGLSDLK-VDISDPALRTIIHRYTRESGVRSLEREIGGVFRKIA
LON3_SORC5      KLNIAVKYLVPRQRKECGLEDVS-LDFTEGALRTIIHHYTKESGVRSLEREIASVCRKVA
LON1_SYNFM      KLNIGRNFLVAKQCKANGLSLDN-IAFSDDMLLYIIRHYTKEAGVRNLEREIASICRKVA
LON2_DESPS      KQVIAEKYLLPKQLKANGFQKDD-IFLSPGAMLTVVRHYTREAGVRGLERVLASLCRKVA
LON_DESVH       KRRIAHDFLLPKQVEAHGLAASN-LRISDNAVLEIIRSYTREAGVRNLEREIASVCRKAA
LON_SOLUE       KMEIAKRFLVKKQIEATGLDSKQ-IDFQDDGINSLIQYYTREAGVRNLEREIGNVCRKVA
LON1_BACSU      KLEIVKDHLLPKQIKEHGLKKSN-LQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAA
LON_BACAH       KVHIAREHLLPKQLQEHGLRKGN-LQVRDEALLEIIRYYTREAGVRTLERQIAKVCRKAA
LON_BRECH       KLNILRGYLLPKQMEDHGLGKDK-LQMNEDAMLKLVRLYTREAGVRNLNREAANVCRKAA
LON_DESRM       KLQIAKRHLMPKQIKDHGLTEEM-IQISENTILKVIREYTRESGVRNLERKIASICRKTA
LON_HELMI       KTRIALDHLVPKQLKEHGLKKEQ-VQISENTVRRLIREYTREAGVRNLEREIASLCRKSA
LON_SYNWW       KVHIATDYLVPKQIKEHGLKESN-ITFSEGTLRRIIREYTREAGVRNLERQIASICRKVA
LON_HALOH       KVEIALRHLIPRILNEHGLTEDE-IHFSSNSIYRIIREYTREAGVRNLERKLAAITRKVS
LON_CALS8       KVEIAKRYLFPKQIEQNGLKKSQ-IRYDEAVIRDIISFYTRESGVRNLEREIARLCRRVA
LON_CLOD6       KLNIAKKYLLPKQIKEHALKENF-IKIDDETLRSIINHYTREAGVRTLERTIGKICRKVA
LON_CLOAB       KFHIAKEHLIPKQLEEHNMPEDKKITFMDSSIYYIIENYTRESGVRSLERKIAAIIRKII
LON_FINM2       KFEIANRYLLPRQLKENGMDKSQ-FHITRDAIYTIINNYTRESGVRELERNIGKVIRKAV
LON_ELUMP       KEAIAQNHLIPRQMKEHGLKEGS-LEIGLPAVKLIMRDYVREAGVRNFEREISTICRKAA
LON_UNCTG       KRHIAEDFIVPKQLKEHGLKPEE-FIFDDGALDIVIKNYTHEAGVRNLTREIANLCRKVV
LON_FERNB       KFYIAKNYIIPKIESEFVEKADEIFSFKDTAIKKIINEYTLEPGVRELEREIRSVVRKAT
LON_PSELT       KSIIARQYIIPKLMGENALN-EATFKITQGAIKKIIHTYTREAGVRQLTRMLQRLMRKSA
LON_COPPD       KLHIAKDFILPKLYEQSGLN-PEEVSFSDQAIIRIIREYTREAGVRNLERNLLSILRKLA
LON1_THET2      KRAIARYFRWPFQVKEAGLEGRL--EITDRAIERIVQEYTREAGVRNLDRELSKVARKAA
LON_AQUAE       KLFIAKKHLIPKLIPLHGFSPEE-IEFTDEAILEIIRGYTREAGVRNLQRQISAVLRKIA
LON_SULSY       KLHIAKKYLIPKQLKENGLDEKT-VEFSDKAITFLIRGYTREAGVRNLERQIGSIIRKIA
LON_GEOLS       KLEIAIRYLVPRQMKDNGLKAKH-IVFEEEALKEIIAKYTREAGLRNLEREIGNVCRKVA
LON_GEOMG       KLEIAKRYLIPRQMKENGISEKE-IVISDEAVRTIIAKYTREAGLRNLEREIGSVCRKVA
LON2_BDEBA      KLLITKKHLIKRQIEANGITEEN-IKFTDEGIKYLIAGYTREAGLRNLEREVGSVCRKVA
LON_DESAL       KVLIAQQYLVPRQVKENGLKPED-ITISGNALLKMATEYTSESGLRNLEREIGTLCRKVS
LON_LAWIP       KLAIARKYILPKQLKENGLKENE-LIISDTCLEKIIREYTREAGLRNMEREIGSLCRKVA
LON_CHLAD       KLEIARGFLIPKQREFHGLTEDQ-IEFTEGAILKLIREYTREAGVRGLEREIASLCRKVA
LON2_HERA2      KVQIARKFLIPKQIEANGLKQHP-ITISDEALRQIIRTYTWEAGVRNLEREIGGICRKIA
LON_KORVE       KVHIAFRYLIPRQEEENGITKDM-IEFSEEAVRRIIRHYTREAGVRNLERNIGTVCRKLA
LON1_HERA2      KYEIASRYLVPEQREQHSLAPNE-VEIDHEALLVAIEEYTREAGVRNLEQQIGTLMRKAA
LON_DESOH       KVKIARQYLIPRQRKENGLAAKH-ISFSQSAIRHIISDYTREAGLRNAEREIASVCRGVA
LON_SYNAS       KLRIAERYLIPRQREANGLTPEQ-IKFTRGAARLIISGYTREAGVRNLEREIAAVCRGVA
LON2_SYNFM      KLEIARKFLVERETANHGLTSDH-IRIGEDAILEIIRSYTREAGVRSLQRNLASVCRNTA
LON_DICT6       KMGIAKGFLIPRQLKEHGLEKEQ-IEFSDDAIRKIIREYTREAGVRNLEREIASIIRKVA
LON_ROSCS       KLEICRRYLIQRQRNEQGLAERA-PTITEAALRRLIREYTHEAGVRDLERRIGAIYRKMA
LON_GEOBB       KLNIAKSYLVAREVEENGLASMA-PQFTDEAIYRVTHDYTREAGVRNLQRNIASICRKIA
LON2_PELCD      KLQIAFKYLIPKQVSENGLDKHP-LQFEEQAVLKIIKNYTREAGVRSIDRQIASVCRKVA
LON_ANADE       KVHIAQNHLIPKQLREHGLSADA-IAISEKALIKIIMAYTREAGVRNLERRIADVCRAIA
LON2_MYXXA      KQSIARIHLVPKQLKEHGLSPDH-IDITDEALLTLTTAYTREAGVRNLERRIADICRAVA
LON2_SORC5      KLGIAREFLVPKQLSAHGLTDER-LEFTEPGIEAVVDHYTREAGVRGLERQIAAVCRATA
LON4_SORC5      KIAIARSHLVPKQLKEHAIDPGS-LSITDEALAAIVRDYTREAGVRQLGREIKKLCRAVA
LON_METSB       KLEIARRYLVRRQLEANGLKPDQ-VEIDDDALIEIIRGYTREAGVRNLEREIGRVLRHVA
LON_PHEZH       KRQIAERYLVRRQLEANGLTAEQ-VQIEPAALETLIARYTREAGVRSLEREIGRLLRHVA
LON_PARPJ       KFQIAQRFLVPRQLEACGLTAAQ-CELPDETLRAIIRDYTREAGVRSLERQIGAVFRYVA
LON_MYCSM       KLAIAQGFLLPRQRERGGLTSDE-VTVTEAALRKIAADYTREPGVRQFERLLAKAMRKAA
LON_SALAI       KVAIARDHLLPRQRERAGLTADE-VTISDGVLARIAGEYTREAGVRQLERSLAKIFRKVA
LON_CHLAA       KVQIAQIHLVPRQLRANGLRPEE-AVVTEDAIRCIINEYTREAGVRNLERSIGAVLRKVA
LON_DEIRA       KLEIAKRYLLPRQLLQNGLKPNQ-ISFSDAALEKLISHYTREAGVRNLEREIGTVARKVA
LON2_THET2      KLEIAKRYLLPRQLKENGLEPEQ-VVVTEAALTRLITHYTREAGVRQLEREIGALLRKAA
LON1_SORC5      KHEIARKYLLPRQRKECGLREEQ-LRVTGTAIGGIISGYTREAGVRQLERTLGALARKAA
LON_NITOC       KQHIARRYLIGRQIREAGLSEIQ-LSIPDETLSYLIRRYTREAGVRELERMLGRIARKVA
LON_FUSNN       KLHIAQKFLLKQAQKENGLANID-IKIPDKVMFKLIDEYTREAGVRNLKREIITICRKLA
LON_MYCA5       KTRIARTHLLSKILSLNALTEKQ-YQITDEVLAYIIKNYTRESGVRNLQRLLDSIARKIV
LON_MYCMO       KIRIARDYLIKKVLEQNSLEESQ-FKISDESLDFLIKHYTLEAGVRNLQRALDKLARKIV
LON_MYCH2       KIQIAKSHLIPAVLKENALDPKY-FPIQDQTIDFLIRHYTREAGVRGLKRVIDKIVRKII
LON_MYCGE       KIEIAKNHLIKRCLEDADLNSEE-LKFTDEAISYIIKFYTREAGVRQLERLIQQVVRKYI
LON_MYCPN       KLQITKSHLVKRCLDDAEIKTDD-LKFTDEGISYIIKFYTREAGVRQLERLIQQIVRKYI
LON_MYCPE       KLSIAKNYLVKKILVESALKKDE-LKFTDDGLSYIIKRYTREAGVREVERAIRQIARKFV
LON_UREP2       KREIAKSHLLKRIFMDAKLNENE-LIFTDDALDFIINHYTKEAGVRELDRQLGHIVRKYI
LON_MYCMS       KMHIAKDYLTKKILEEDQLTEDE-LRFTDEAYDEIIKYYTREAGVRQLERHLATIARKFI
LON_AYWBP       KINIASKYLLKKQLKNHGITDTN-LVIDNDTILYLIRHYTKEAGVRELDRILAELARKTV
                *  *   .                              *  : *:*          :   

LON_CAMC1       KNILTKKNEGK--------------------------------ISVTAKNLKEFLEKKVY
LON_CAMJE       KKLLLE-NIKK--------------------------------VIINTKNLNEFLDKKVF
LON_HELPY       LKYLEDNPHQKGRTKKGKNEKSEDQKSEDQKSENQKSENKDFCVSITPNNLKEYLERMVF
LON_HELPJ       LKYLEDNPHKKGRTKKSEDK---DKKGGNEENE-KRGESKDFCVSITPDNLKEYLERMVF
LON1_BORBU      RKLIE--NT------------------------------EVKSYQISNDNLEEYVG--VP
LON_BORDL       RKLVE--DQ------------------------------SVKAYQISKENLEEYIG--IP
LON_LEPIC       IKIVR-KES------------------------------FPK--IIQEKDLETFLG--VP
LON_TREPA       TEIVLGKRS------------------------------FDDKCLMDEALIGTFLG--KP
LON_CHLMU       LKIVQNQE---KNPSKK------------------------SRFTITPKNLQDYLG--KP
LON_CHLTR       LKIVQNQE---KNLSKK------------------------SRFTITPKNLQDYLG--KP
LON_CHLPN       LKIVQNQE---KPKSKK------------------------ITFKISSKNLQTYLG--KP
LON_PARUW       VNIVREQEEHDKEQAKKKKSSR----------SKKPIAFVPTKHSITPSNLKDFLG--KP
LON1_DESPS      TSHLAGGL---------------------------------EKVRIRKRDLRGLLG--RR
LON1_PELCD      MEFSQGRT---------------------------------DKITVSKKDVAAILG--KP
LON_MAGMM       VKVLEEAE---------------------------------LPISVGQNDLDSYLG--KP
LON2_HYDCU      IKFVNGDM---------------------------------EQTTLHVNDLEEMLG--QP
LON_CLOB8       EKIVSNKV--------------------------------ELPFKVKEDDLEDLLG--RK
LON_METBF       EKIVSGKA--------------------------------DLPYVVRADMLKEILG--KE
LON_METST       EKIVVDNV--------------------------------ERPYVVDENMLYDILG--HE
LON1_BDEBA      LKIIKSE---------------------------------GLPLLVEEQDLEDIFG--AE
LON_CYTH3       VAIAME---------------------------------TAYTKKIQPAQVREILG--SE
LON_FLAJ1       KAVAME---------------------------------EEYNKKVTDEDIVKVLG--VP
LON_PARD8       RKVASD---------------------------------EPIPTSIKPEDLYEYLG--AV
LON_PORG3       KEAAMN---------------------------------VVHTTKVEPSDLVTFLG--AP
LON_AMOA5       KAMVLE---------------------------------EPYPKKIHKEDVISLLG--IE
LON_CHLT3       KDIVIRRESDQ---------------------------PDETPITVVTADLKKYLG--ME
LON_ACIB3       KEAVSK-------------------------------KSKNLQLDVTSANLPEYLG--PH
LON_DICNV       RRLQEG-------------------------------KQK--SILITPNNLKDFLG--VA
LON_BRUAB       TEILKT-------------------------------KKK--SVKITDKNLSDYLG--VE
LON_BRUA2       TEILKT-------------------------------KKK--SVKITDKNLSDYLG--VE
LON_BRUME       TEILKT-------------------------------KKK--SVKITDKNLSDYLG--VE
LON_BRUSU       TEILKT-------------------------------KKK--SVKITDKNLSDYLG--VE
LON_RHIME       TEILKG-------------------------------KTK--KVEVTAENIHDYLG--VP
LON_AZOC5       KELVIS-------------------------------KKK--SVKVTAKNLETFLG--VP
LON_AZOBR       KEILMK-------------------------------GSAGAKVSVTRRNLDKYAG--VR
LON_CAUVC       RDLARE-------------------------------KVA--SITIDDERLAKYAG--VK
LON_CAUVN       RDLARE-------------------------------KVA--SITIDDERLAKYAG--VK
LON_BUCAI       KNLILD--------------------------------KSLKHIEINSKNLKKFLG--IK
LON_BUCAP       KLLILN--------------------------------KSLKKIEINSKNLKKFLG--IK
LON_BUCBP       KNLILN--------------------------------KSLKKIKITTDNLHDYLG--IK
LON_ECOLI       KQLLLD--------------------------------KSLKHIEINGDNLHDYLG--VQ
LON_ECOL6       KQLLLD--------------------------------KSLKHIEINGDNLHDYLG--VQ
LON_SHIDS       KQLLLD--------------------------------KSLKHIEINGDNLHDYLG--VQ
LON_ERWAM       KTLLMD--------------------------------KSVKHIEINADNLKDYLG--VQ
LON_VIBPA       KNILLD--------------------------------KDIKSVTVTMDNLKEYLG--VQ
LON_HAEIN       KNLLVN--------------------------------PKLKSITVNSDNLHDYLG--VK
LON_XANOR       KEIALAGPQPAAKKAVA------------------KKGKPKALVTVNAKNLDKYLG--VR
LON1_HYDCU      KEIVTN--------------------------------EAKAPITVTPDTLDKYLG--VA
LON_FRAP2       KNLLKD--------------------------------PEHGKVSITQNNLEDYLG--VH
LON_NEOSM       KKLGVQ--------------------------------SGLKSIEVSVKNLKKYAG--VE
LON_WOLPP       KAILTD--------------------------------KN-KKISVETGNLQDYLG--VR
LON_RICCN       KQILAD--------------------------------KSVKHIAIDSNHLEEFLG--AK
LON_RICFE       KQILAD--------------------------------KTVKHIAIDSSNLEEFLE--AK
LON_RICPR       KQILAN--------------------------------KTVKHISIDSNNLEEFLG--AK
LON_RICTY       KQILAD--------------------------------NTVKNISIDSNNLEEFLG--AK
LON_RICBR       KQILAD--------------------------------KKVKHISVDSNNLEEFLG--AR
LON_ORITI       KKILSS--------------------------------KDIKSESVSKENIKDYLG--SR
LON1_MYXXA      RDVLKNGK---------------------------------RDIDVDRKMAMKFLG--TP
LON3_SORC5      RRVVSDGKE--------------------------------KPIEVVAKSIPKYLG--VP
LON1_SYNFM      KEVVRRGPE--------------------------------TRIELTEDLVQEYLG--IP
LON2_DESPS      RDRLQKGKKS-------------------------------KKYRIGEKSVPTYLG--TP
LON_DESVH       MQVVEAGDKE-------------------------------KTLTVSRQNLGNFLG--VK
LON_SOLUE       RQVVNAESGKD--------------------------KKAPAKAVINGDKVPELLG--PW
LON1_BACSU      KAIVAEER---------------------------------KRITVTEKNLQDFIG--KR
LON_BACAH       KIIVTAER---------------------------------KRIVVTEKNVVDLLG--KH
LON_BRECH       KIIVGGEK---------------------------------KRVVVTAKTLEALLG--KP
LON_DESRM       KKIVAGQA---------------------------------EKVKVTTQNLEQFLG--IP
LON_HELMI       RAIVKNPE---------------------------------RRLSISAGNLPSYLG--IP
LON_SYNWW       RQVVEDKD---------------------------------TFVHVASNSLNRFLG--AG
LON_HALOH       KEIVEGRG---------------------------------RQARVTTQSIEKYLG--VP
LON_CALS8       KEILEENK---------------------------------KMVRITTRNLEKYLG--VR
LON_CLOD6       KKYVEDPTL--------------------------------EEVVINKSDLETYLG--KD
LON_CLOAB       TEIVEKDK---------------------------------SSISVNSRTVKKYLG--ED
LON_FINM2       VKIVKDDV---------------------------------KKVVVNNKNLEKFLG--SK
LON_ELUMP       K-MYVENCG--------------------------------KTVTVTKDNLHDFLG--VP
LON_UNCTG       KGLEFNKEL--------------------------------KSITIKPENLNKYLG--IA
LON_FERNB       L-DAIKTG---------------------------------KKIVISPEKVTEYLG--PS
LON_PSELT       L-KIEQGA---------------------------------KSVVIKSKDLEHFLG--PQ
LON_COPPD       VEKLEKGF---------------------------------SRVRITVKNVEDYLG--VP
LON1_THET2      KDYLEKPWE--------------------------------GVRVVDAEDLEAYLG--VP
LON_AQUAE       VKKLQ---------------------------------GEKGPFNITPELVRKLLG--VP
LON_SULSY       KKIIET--------------------------------GKKRKYKITPSLIKKFLG--AP
LON_GEOLS       RKIAE---------------------------------GHKRQIRVTPAAVATFLG--AA
LON_GEOMG       RKVAE---------------------------------GDGRRFRITPATVAKYLG--PA
LON2_BDEBA      KMVVM---------------------------------EETNFVEVNATTVPELLG--PP
LON_DESAL       RKIAE---------------------------------GKKGPYQITASSLVKYLG--LE
LON_LAWIP       RKKAE---------------------------------GKKPPFRITTNQIEKFLG--IP
LON_CHLAD       RQVAEQTE---------------------------ANGELPPKFVIDEAAVVKYLG--PE
LON2_HERA2      RRVAEKKR---------------------------YPRRITPTMLTD------FLG--QP
LON_KORVE       RRIAEGK---------------------------------TEKLAVTPQTITEMLGGEKV
LON1_HERA2      RQVALGS---------------------------------ATPIVLDPAKTREYLG--KR
LON_DESOH       AKIAEGK---------------------------------KVSGAIKPEDLYEYLG--PV
LON_SYNAS       SQIAEGE---------------------------------ISSALISARDIHRYLG--PV
LON2_SYNFM      KAIAEGA---------------------------------SGPIHIDASGIPEILG--PV
LON_DICT6       KGIAEGSI--------------------------------TEKVIVKVEDVPKYLG--PE
LON_ROSCS       TRAAEGQ---------------------------------PLPDQVDAPDLDDLLG--PP
LON_GEOBB       KEVAQGK---------------------------------KARPIVNPETVSELLG--AP
LON2_PELCD      KAVAQGK---------------------------------DAPEVIRSDQVEKMLG--PR
LON_ANADE       VEVASGKIGA------------------------------SAKRSIEEADVLEILG--PE
LON2_MYXXA      VEVAGGK---------------------------------TEKQTINADRVKEILG--PE
LON2_SORC5      VKVAEGN---------------------------------DVREVATPEHVEQVLG--PH
LON4_SORC5      LEIARAADGK------------------------------APRVVVEASDLGTYLG--KV
LON_METSB       VRIADGS---------------------------------ASHVHVSRAELTELLG--QQ
LON_PHEZH       VRFAEGH---------------------------------TEPVRIGPTNLEPILG--PP
LON_PARPJ       LRVAEDP---------------------------------STHERIEPDRLSSILG--HR
LON_MYCSM       TKLA---DHPQ-----------------------------AAPITIDEPDLVEYLG--RP
LON_SALAI       VTAT---TDP-------------------------------APVHVDTGNLHRYLG--RP
LON_CHLAA       RRLSEGEIDPA-----------------------------NTPFVVDAAFVRAALG--RP
LON_DEIRA       RNIAT---GKT-----------------------------KRAKV-TDKELEKYLG--QP
LON2_THET2      RRILE---EGK-----------------------------KRVRI-TEKDLEAYLG--PP
LON1_SORC5      RRIAA---GEI-----------------------------ERAVVGADDDVKELLG--RA
LON_NITOC       TQVATGQT---------------------------------QPVTVTPQDLVELLG--PE
LON_FUSNN       REVVEKDT---------------------------------KKFNLKPTDLEKYLG--KA
LON_MYCA5       VRILDKKVDK--------------------------------EFVIDKAIVREFLG--PE
LON_MYCMO       VKSLENKLEK--------------------------------DFVITSEEIVNLLG--VI
LON_MYCH2       VKLLEKTLDQ--------------------------------NFVIDIEFVRELLG--IE
LON_MYCGE       VAMQKDGIKQ---------------------------------ETIDVNAVKKYLK--KE
LON_MYCPN       VNLQKTGEQQ---------------------------------VVVDVDLVKKYLK--KE
LON_MYCPE       VRQQKEKLTS---------------------------------QTIGVEEVKYYLK--KE
LON_UREP2       VETYKNKNNQS-----------------------------PLNLKVDEAMIIKYLG--KI
LON_MYCMS       VKLLNGEITN---------------------------------LVVTREVVVQYLG--KH
LON_AYWBP       KECLIKKKEQ---------------------------------VIITTKNVTKYLG--KE
                                                                            

LON_CAMC1       EIEPA---DKKDQIGLVNGLAWTSVGGDVLRIEAIRIQ--GKGS-MQITGQLGDVMKESA
LON_CAMJE       EIEKN---NGENQVGQVNGLAWTSVGGDVLKVEAVKIK--GKGE-LTLTGSLGDVMKESA
LON_HELPY       EIDPI---DEENKIGIVNGLAWTPVGGDVLKIEVLKIR--GKGE-LKLTGSLGDVMKESA
LON_HELPJ       EIDPI---DEENKIGIVNGLAWTPVGGDVLKIEAVKIR--GKGE-LKLTGSLGDVMKESA
LON1_BORBU      VFRKE-SMPNAMYSGMVMGLAWTNYGGSTLMIETVKTE--SKVGGIKLTGRLGDVMKESA
LON_BORDL       VFRKEKFLDKAMSPGMVMGLAWTNYGGSTLIIETVKTE--SKSPGIKLTGRLGDVMKESA
LON_LEPIC       KFTDE-RMVRASVPGTALGLAWTSVGGATLLIEALFVK--GK-GGILLTGMLGKTMEESS
LON_TREPA       VFRDD-MLKDANKVGTAVGLAWTGMGGDTLLVEAITIP--GK-ASFKLTGQMGAVMKESA
LON_CHLMU       IFSSD-RFYEKTPVGVATGLAWTSLGGATLYIESVQVPSSSGKADMHLTGQAGDVMKESS
LON_CHLTR       VFSSD-RFYEKTPVGVATGLAWTSLGGATLYIESVQVPSSSGKADMHLTGQAGDVMKESS
LON_CHLPN       IFSSD-RFYESTPVGVATGLAWTSLGGATLYIESVQV--SSLKTDMHLTGQAGEVMKESS
LON_PARUW       VFTSD-RFYERTPVGVCMGLAWTAMGGATLYIESIKV--AGEKTVMKLTGQAGDVMKESA
LON1_DESPS      LFAEE-QVYSTPRVGVITGLAYTNMGGTTLYIESLAVP--TGDSGFKQTGQLGKVMIESS
LON1_PELCD      IFTEE-EVFEDVP-GVVTGLAWTSMGGATLQIEATAMP--SRNKGFKQTGQLGKVMVESS
LON_MAGMM       DFREE-K--PLTGVGIVTGLAWTALGGATLDIESAQTS--TEGNTLLLTGQLGDVMKESA
LON2_HYDCU      RFTPE-K--TNQQMGTVTGLAWTSMGGATLTIEASRVH--TLNRGFKLSGQLGDVMQESA
LON_CLOB8       VSSHD-KAQDDNVPGVVTGLAWTSVGGEILFIEATGML--GSGQ-IVLTGQLGDVMKESA
LON_METBF       IIRQE-EARKENVPGVVTGLAWTPVGGDILFIEGTFMP--GSGK-LTLTGQLGDVMKESA
LON_METST       KSHYD-KVPDSNPPGVVTGLAWTPIGGDILFIEAVLLP--GEEK-LKLTGQLGDVMKESA
LON1_BDEBA      RFSAD-MIGSLLPPGVVTGLAWTPVGGDILFIESAQMP--GKGN-LLLTGQLGEVMQESA
LON_CYTH3       DFEKD-TYQQDDLAGIVTGLAWTPYGGEILTIESIISK--GKG-KLTLSGQLGDVMKESA
LON_FLAJ1       RLERD-KYENNDVAGVVTGLAWTSVGGDILFIESLISE--GKG-ALTITGNLGNVMKESA
LON_PARD8       EYSRD-KYQGNDYAGVVTGLAWTAVGGEILFVESSLSK--GKGSKLTLTGNLGDVMKESA
LON_PORG3       RYTRD-RYQGNGDAGVVIGLAWTSVGGEILFIETSLHR--GREPKLTLTGNLGDVMKESA
LON_AMOA5       LFDQE-MYQQTHLPGVAIGLAWTPVGGDILFIEAILSA--GKG-KLTLSGQLGDVMKESA
LON_CHLT3       QFYPD-VSEPVMLSGVAVGLAWTPVGGDILFIESTVMK--GTG-RLILTGQLGDVMKESA
LON_ACIB3       KFDFG-MAEDEAQVGRVNGLAWTSVGGELLTIEVAAVK--GKGK-FITTGSLGDVMKESI
LON_DICNV       KYHRN-DEDLQAKIGSVTGLAWTSVGGELLQIEGVAFS--GKGR-LTHTGQLGDVMQESI
LON_BRUAB       KFRFG-QIDGEDQVGVVTGLAWTEVGGELLTIEGVMMP--GKGR-MTVTGNLRDVMKESI
LON_BRUA2       KFRFG-QIDGEDQVGVVTGLAWTEVGGELLTIEGVMMP--GKGR-MTVTGNLRDVMKESI
LON_BRUME       KFRFG-QIDGEDQVGVVTGLAWTEVGGELLTIEGVMMP--GKGR-MTVTGNLRDVMKESI
LON_BRUSU       KFRFG-QIDGEDQVGVVTGLAWTEVGGELLTIEGVMMP--GKGR-MTVTGNLRDVMKESI
LON_RHIME       RFRHG-EAERDDQVGVVTGLAWTEVGGELLTIEGVMMP--GKGR-MTVTGNLRDVMKESI
LON_AZOC5       RFRYG-EIEREDQVGVVTGLAWTEVGGELLTIEGVMMP--GKGR-MTVTGNLKEVMKESI
LON_AZOBR       RFHFG-EAELEDLVGVTTGLAWTEVGGELLSIEAVSLP--GKGR-VTTTGKLGDVMKESV
LON_CAUVC       KYRYG-ETDEVDQVGIVTGLAWTEFGGDILTIEAVKMP--GKGR-MQITGNLKDVMKESI
LON_CAUVN       KYRYG-ETDEVDQVGIVTGLAWTEFGGDILTIEAVKMP--GKGR-MQITGNLKDVMKESI
LON_BUCAI       RFDYG-KIHGTNQIGQVIGLAWTEVGGELLTIETTCVS--GKGK-LTYTGSLGEVMQESI
LON_BUCAP       RFDYG-KTNNLNQIGQVVGLAWTEVGGELLTIETACVS--GKGK-LTYTGSLGEVMQESI
LON_BUCBP       KYDFG-KTNYKNQIGQVIGLAWTEVGGELLTIEAACIS--GKGK-LIYTGSLGEVMQESI
LON_ECOLI       RFDYG-RADNENRVGQVTGLAWTEVGGDLLTIETACVP--GKGK-LTYTGSLGEVMQESI
LON_ECOL6       RFDYG-RADNENRVGQVTGLAWTEVGGDLLTIETACVP--GKGK-LTYTGSLGEVMQESI
LON_SHIDS       RFDYG-RADNENRVGQVTGLAWTEVGGDLLTIETACVP--GKGK-LTYTGSLGEVMQESI
LON_ERWAM       RYDYG-RADSENRVGQVTGLAWTEVGGDLLTIETACVP--GKGK-LTYTGSLGEVMQESI
LON_VIBPA       RFDYG-KADESNRIGQVTGLAWTEVGGDLLTIETQSMP--GKGK-LTQTGSLGDVMQESI
LON_HAEIN       RFEFG-KADTQNRIGEVTGLAWTEVGGDLLTIETASVV--GKGK-LSFTGSLGDVMKESI
LON_XANOR       RFDFG-RAEEENEIGLVTGLAWTEVGGELLQVESTLVP--GKGN-LILTGQLGNVMKESA
LON1_HYDCU      KYRFG-LADETNQIGQVAGLAWTRVGGDLLRIEATAMP--GKGK-NTSTGQLGSVMQEST
LON_FRAP2       QFDYG-IKNAKPKVGQVTGLAWTSVGGELLTIEALAMP--GKGK-VKYTGSLGDVMKESI
LON_NEOSM       KYTFG-TAEPENLVGMTTGLAYTQTGGDLIMIEAVLLP--GKGE-IRSTGKLGEVMQESV
LON_WOLPP       KYTFG-IAENESLVGIVTGLAYTETGGDILMIESVLIP--GKGE-IKYTGKLGEVMQESI
LON_RICCN       KYNFG-LAEKEDQIGSTTGLAYTEVGGELLTIEALAFP--GKGE-IKTTGKLGDVMKESA
LON_RICFE       KYNFG-LAEKEDQIGSTTGLAYTEVGGELLTIEALAFP--GKGE-IKTTGKLGDVMKESA
LON_RICPR       KYNFG-LAEKEDQIGSTTGLAYTEVGGELLTIEALAFS--GKGE-IKTTGKLGDVMKESA
LON_RICTY       KYNFG-LVEKEDQIGSTTGLAYTEVGGELLTIEALAFS--GKGE-IKTTGKLGDVMKESA
LON_RICBR       KYNFG-LAEKNDQIGSTTGLAYTEVGGELLTIEALSFP--GKGE-IKTTGKLGDVMKESA
LON_ORITI       KYKYG-LAEDDNQVGITIGLAYTETGGDLIWVEAVMIP--GKGK-VKATGKLGDVMKESS
LON1_MYXXA      RYRYG-MAEAEDQVGIVTGLAWTELGGEILTTEATIMP--GKGK-LIITGKLGEVMQESA
LON3_SORC5      KYRLG-RREERDEVGLVNGLAVTNVGGDLLPAEATVVP--GKGK-LVITGLLEKGMEESG
LON1_SYNFM      KFRYG-VAEEKDEIGLAVGLAWTEFGGDILGIETVVMP--GKGK-VQITGKLGDVMQESA
LON2_DESPS      KYRYG-LAEERDEVGLATGLAWTQVGGVLLQIEVILMP--GKGK-LTLTGQLGDVMQESA
LON_DESVH       KYRHG-EREDTSQVGVCTGLAWTEMGGELLVVETALMP--GSGR-VEITGKLGDVMTESA
LON_SOLUE       KFRDL-VVEKKNEIGAATGLAWTEVGGQLLTVECTLME--GKGK-LTITGKLGEVMQESA
LON1_BACSU      IFRYG-QAETEDQVGVVTGLAYTTVGGDTLSIEVSLSP--GKGK-LILTGKLGDVMRESA
LON_BACAH       IFRYG-QAEKTDQVGMATGLAYTAAGGDTLAIEVSVAP--GKGK-LILTGKLGDVMKESA
LON_BRECH       RYRYG-LAEKKDQVGSVTGLAWTQAGGDTLNVEVSILA--GKGK-LTLTGQLGDVMKESA
LON_DESRM       RYRYG-VAEQNDEVGTVTGMAWTEVGGDTLVIEVTTYK--GTGR-MTLTGKLGDVMKESA
LON_HELMI       RFRYG-LAEAESQVGVATGLAWTETGGDTLAIEVAHMP--GKGN-LALTGKLGDVMKESA
LON_SYNWW       RYRYG-VAESENQVGVATGLAWTESGGDILSIEVALLK--GKGN-LTLTGKLGEVMKESA
LON_HALOH       KFKYE-KAQKKDRVGVATGMAYTQTGGDILDIEVAVVP--GKGK-LTLTGSLGDVMKESA
LON_CALS8       KYRRD-ELIEEDRIGIVTGLAWTPFGGETLSVEALVMP--GSGK-LELTGQLGDVMKESA
LON_CLOD6       MFKYQ-LAEVNPQIGLVNGLAWTEVGGVTLEVEVNVLK--GKGE-IVLTGKLGDVMKESA
LON_CLOAB       VFSAD-KIDKEDKIGVVTGMAWTAYGGDTLPVEAVIMP--GNGK-LQLTGQLGDVMKESA
LON_FINM2       LVLDD-EIPREDTVGVVNGLAWTQVGGVILTIEANVMD--GSGK-TQLTGKLGDVMKESA
LON_ELUMP       RYTNF-TTE-ENGVGISTGLAWTSVGGETLSIEASEISD-GKGR-IMLTGKLGDVMKESV
LON_UNCTG       YYERE-RIA-ENDVGVATGLAWTEVGGETLTIEVNKMG--GKNS-LVLTGKLGDVMKESA
LON_FERNB       KIKDE-DKLEKPMIGVTTGLAWTPNGGTTLYIESTLIP--GNGG-LIITGQLGDVMKESV
LON_PSELT       PVQND-IMLSKPEIGAVHGLAWTEYGGVVMVVESLLMP--GKGD-LILTGRLGEVMRESA
LON_COPPD       KFRYG-KALEKPEIGVVAGLAWTEFGGETMLIECQVVK--GKGQ-LILTGSLGQTLKESA
LON1_THET2      KYRPD-RAEKEPQVGAAQGLAWTPYGGTLLTIEAVAVP--GTGK-VNLTGNLGEVMKESA
LON_AQUAE       RYRPE-RE-KKPLVGVATGLAWTEVGGEIMFIEATKMK--GKGS-LVLTGSLGDIMKESA
LON_SULSY       IYSTE-KE-EKDEVGVVTGLAWTEVGGEILKIEVTKMD--GKGN-LVLTGSLGDVMKESA
LON_GEOLS       KFLRD-DEMDKNEVGVVNGLAWTSVGGEVLHIEATTMA--GKGG-MALTGQLGDVMKESV
LON_GEOMG       RFIRE-GEMEKNEVGIVTGLAWTPVGGEVLFVEATIMK--GKGG-LTLTGHLGDVMKESV
LON2_BDEBA      RFQRD-DKIADSQVGVVQGLAWTQAGGEVLTIEALKMK--GKGH-LALTGQLGDVMKESA
LON_DESAL       KFLPE-MDQEEPQIGLATGLAWTHWGGEALYIETTLMR--GKGE-LVLTGQLGEVMQESA
LON_LAWIP       RFIDD-DTEKTLPPGVALGLAWTPAGGEILYIEVSTVK--GKGN-LLLTGQLGDVMKESA
LON_CHLAD       RYTYG-IAEEQDEVGVATGVAWTSAGGDILSIEVLPFK--GKGQ-LQLTGQLGEVMKESA
LON2_HERA2      PFDYS-RANDRDEIGVATGMVWSSNGGDVVAIETAIVD--GKGT-TTLTGQLGDVMQESA
LON_KORVE       RVDTE-IAERTKRAGVVVGLAWTPAGGDILFVEATTMK--GKGG-FTMTGQLGDVMRESM
LON1_HERA2      RYFSE-IHERTDRPGIVTGLVWTPVGGDIIFIEATKMT--GRGN-FALSGQLGDVMKESA
LON_DESOH       RFTSE-TGENALTPGVVMGLAWTPVGGEILFIEATSMK--GKRG-LTLTGQLGDVMKESA
LON_SYNAS       RMISD-ARERISKPGIAMGLAWTPTGGDLLFVEATAMK--GRKG-LTLTGQLGEVMKESA
LON2_SYNFM      QFLPE-TATRSWGCGIATGLAWTPSGGQLIFIETLRTH--GNGK-LLLTGQLGEVMKESA
LON_DICT6       KYTYG-MKGEKDEVGVATGLAWTEAGGDILFVEALVVE--GKGN-LILTGKLGEVMQESA
LON_ROSCS       RFRSE-TLLGEDEVGVVTGLAWTPTGGDVLFVEASVVP--GNGQ-LTLTGQLGDVMKESA
LON_GEOBB       KFFDE-VASEKDRVGVATGLAWTESGGDIIFVEATKMK--GKED-LILTGSLGEVMKESV
LON2_PELCD      KYFSD-VAAEEDRVGVVTGLAWTESGGDIIFVEVSTMA--GRKD-LTLTGSLGNVMQESA
LON_ANADE       KFYNE-TAERTEIAGVATGLAWTAAGGDILFIEATKMP--GKGA-LTLTGQLGDVMKESA
LON2_MYXXA      MFYSE-VAERTEVPGVATGLAWTAAGGDLLFIEATKMA--GKGG-MTLTGQLGDVMKESA
LON2_SORC5      KHRPE-IAERTLQPGVATGLAWTPAGGEILFIEATKMP--GKGN-VVLTGNMRNVMQESA
LON4_SORC5      RFFSD-VAERTSVAGVATGLAWTPVGGDILFIETSRMP--GKGR-VEITGQLGDVMKESA
LON_METSB       RFEDE-VAMRLSVPGVATGLAWTPVGGDILFIEATRAP--GHGK-LTLTGQLGEVMRESV
LON_PHEZH       RVENE-VAMRTSVPGVATGLAWTPVGGEILFIEATRTP--GDGR-LILTGQLGEVMRESA
LON_PARPJ       RFESE-VAMRTSLPGVVTGLAWTPVGGDLLFIEASSTP--GGGR-LVLTGQLGDVMKESV
LON_MYCSM       RFLPE-SAERTAVPGVATGLAVTGLGGDVLYIEANSTE--GEPG-LQLTGQLGDVMKESA
LON_SALAI       KFSPE-SAERTAVPGVATGLAVTGAGGDVLFVEATSMA--GEPG-LTLTGQLGDVMKESA
LON_CHLAA       RFTNE-TRERIDQPGVAIGLVWTPVGGDIIFVEASAVE--GKKE-LTITGQLGEVMRESA
LON_DEIRA       RHTPE-TENMEDMVGVSTGMFYTPVGGDILFVETSIMT--GKGGGLLLTGQLGDVMKESA
LON2_THET2      RFLPE-TEAREPQVGVATGMYYTPVGGDIMFVEVSVMP--GKGN-LILTGQLGDVMKESA
LON1_SORC5      RMRLE-RRLQYDQPGVATGMYYTQMGGDIMHVEASVMP--GKGD-FVLTGQLGDVMKESG
LON_NITOC       RFFAE-EMRQQLAPGVAAGLAWTEAGGDVLYVEAALLP---EGKGMTLTGQLGSIMQESA
LON_FUSNN       KFRPEKSRKATGKIGVVNGLAWTAVGGVTLDVQGVDTP--GKGE-VTLTGTLGNVMKESA
LON_MYCA5       LYNEK-GDETQPKAGVVNALAYTAYGGTSMTIEVTTFPT-TAKGALNLTGQLKDVMRESA
LON_MYCMO       KYTDD-FKENYERIGAVNGLAYTQYGGSTLSIEVTTFPN-S-KGGIKLTGQLKEVMQESA
LON_MYCH2       KYDPD-NVDSSPQIGTVTGLGYSPLGGSTLQIEVSTIPG-R--GDIKLTGSLKDVMQESA
LON_MYCGE       IFDHT-MRDEVSLPGIVNGMAYTPTGGDLLPIEVTHVA--GKG-ELILTGNLKQTMRESA
LON_MYCPN       IFDYT-VRDEDALPGIVNGMAYTPTGGDLLPIEVTHVA--GKG-DLILTGNLKQTMRESA
LON_MYCPE       IYDYT-KKDKEYMPGVVNGMAYTTAGGDLLPIEATFAP--GKG-KIEITGNLKETMKESV
LON_UREP2       KFDFN-KKEETTIPGIVNGMAYTAAGGDLLPIEVNHSTN-GKGGNVTITGNLEKTMNESV
LON_MYCMS       IFEHT-SKEEESQVGVVTGLAYTQFGGDILPIEVSTYN--GKG-NLTLTGKLGEVMKESA
LON_AYWBP       KYLNL-LDEQKEKIGSTNGLAYTYFGGDLLPVEVTYYK--GKG-QLVLTGKLGEVLKESA
                              *   .:  :  **  :  :               :*     : ** 

LON_CAMC1       QIAFSVVKVLIDNKKLKVPMPIVPKFDDDKHKLEASDVYRRYDLHLHVPEGAVPKDGPSA
LON_CAMJE       RIAFSMIKVLIDEGKIKIPKKIIIDPK--------VNVYDSYNIHIHVPDGATPKDGPSA
LON_HELPY       IIAFSVVKVLLDNETLKVPKIPSETDAEGKKKKKVLKVYNAYDLHLHVPEGATPKDGPSA
LON_HELPJ       IIAFSVVKVLLDNETLKVPKIPSETDAENKKKKKVLKVYNAYDLHLHVPEGATPKDGPSA
LON1_BORBU      NIAYTYVNSIKGDLSI------------------SKSFFEKNIIHLHIPEGATPKDGPSA
LON_BORDL       NIAFTYVNSISNELKV------------------HKSFFEKYMIHLHIPEGATPKDGPSA
LON_LEPIC       NIALSYIKNLLYKEEL----------------------FNNRMIHLHVPDGATPKDGPSA
LON_TREPA       SIALSWLRRYSAQQRIA-----------------SPNWFEKRAIHLHIPEGATPKDGPSA
LON_CHLMU       QIAWTYLHSALERYAP------------------GRPFFEKSQVHIHIPEGATPKDGPSA
LON_CHLTR       QIAWTYLHSALERYAP------------------GQPFFEKSQVHIHIPEGATPKDGPSA
LON_CHLPN       QIAWTYLHSALHRYAP------------------GYTFFPKSQVHIHIPEGATPKDGPSA
LON_PARUW       EIAWSYVHSSIHKYAP------------------GYTFFEKSQVHIHIPEGATPKDGPSA
LON1_DESPS      EIAYSYIRFLLGDDSA------------------AVKFFNKNFIHLHVPAGATPKDGPSA
LON1_PELCD      DIAYSYVMAHLEEYGA------------------DPEFFDKHFVHLHVPAGATPKDGPSA
LON_MAGMM       RIAFSFLQSNVEKLGG------------------KSERL-KGNIHLHVPEGATPKDGPSA
LON2_HYDCU      SIAYSYIASNLDKYKA------------------DPEFFDKAFVHLHVPDGATPKDGPSA
LON_CLOB8       QISLSLLKSRLP--IN------------------AIN-FRERDIHIHVPSGSVPKDGPSA
LON_METBF       KISLSLVRSRLANTAN------------------SFD-FTSSDIHIHVPSGATPKDGPSA
LON_METST       QIAQSLIKSRLATVLK------------------DSD-IEKRDIHIHVPAGSIPKDGPSA
LON1_BDEBA      KIALTLLKSRLPLLDP------------------LLD-FAKKDIHVHVPAGAIPKDGPSA
LON_CYTH3       SAALSLLRANVDAIGI------------------DHRVFDHFDLHVHVPAGATPKDGPSA
LON_FLAJ1       TIALEYIKANAKKLGL------------------AIELFQKYNIHLHVPEGATPKDGPSA
LON_PARD8       MLALEYIHAHAAQFNI------------------NEELFENWNVHVHVPEGAIPKDGPSA
LON_PORG3       VIALDYIRAHSDELGI------------------SQEIFNNWQVHVHVPEGAIPKDGPSA
LON_AMOA5       MTAFTYLKANTNLLGI------------------PDKVFESYDLHIHLPAGAVPKDGPSA
LON_CHLT3       QAALSYLKSCADYFKI------------------PDEAFRYWDVHVHVPQGAIPKDGPSA
LON_ACIB3       TTAMTVVRTRADELGI------------------EASRFEETDVHVHLPEGATPKDGPSA
LON_DICNV       RTALSVVRSYLDDLD-------------------DNFRFDEYDIHLHLPEGATPKDGPSA
LON_BRUAB       SAAASYVRSRAIDFGI------------------EPPLFDKRDIHVHVPEGATPKDGPSA
LON_BRUA2       SAAASYVRSRAIDFGI------------------EPPLFDKRDIHVHVPEGATPKDGPSA
LON_BRUME       SAAASYVRSRAIDFGI------------------EPPLFDKRDIHVHVPEGATPKDGPSA
LON_BRUSU       SAAASYVRSRAIDFGI------------------EPPLFDKRDIHVHVPEGATPKDGPSA
LON_RHIME       SAAASYVRSRAIDFGI------------------EPPLFDKRDIHVHVPEGATPKDGPSA
LON_AZOC5       SAAASYVRSRSVDFGI------------------EPPLFERRDIHVHVPEGATPKDGPSA
LON_AZOBR       QAAESYVKSRATAFGI------------------KPTLFEKRDIHVHVPEGATPKDGPSA
LON_CAUVC       AAANSYVRSRALQFGI------------------KPPVFEKTDVHIHVPDGATPKDGPSA
LON_CAUVN       AAANSYVRSRALQFGI------------------KPPVFEKTDVHIHVPDGATPKDGPSA
LON_BUCAI       QAALTVVRSQADRLGI------------------KKDFHEKHDIHVHVPEGATPKDGPSA
LON_BUCAP       QAALTVVRSQAKKLGI------------------KKDFHEKHDIHVHVPEGATPKDGPSA
LON_BUCBP       QAALTVVRSQANKLGI------------------KKNFYEKNDIHVHVPEGATPKDGPSA
LON_ECOLI       QAALTVVRARAEKLGI------------------NPDFYEKRDIHVHVPEGATPKDGPSA
LON_ECOL6       QAALTVVRARAEKLGI------------------NPDFYEKRDIHVHVPEGATPKDGPSA
LON_SHIDS       QAALTVVRARAEKLGI------------------NPDFYEKRDIHVHVPEGATPKDGPSA
LON_ERWAM       QAALTVVRARAEKLGI------------------NGDFYEKRDIHVHVPEGATPKDGPSA
LON_VIBPA       QAAMTVVRSRADKLGI------------------NSDFYEKKDIHVHVPEGATPKDGPSA
LON_HAEIN       QAAMTVVRARADKLGI------------------NAEFHEKRDIHIHVPDGATPKDGPSA
LON_XANOR       SAALSVVRSRAERLGI------------------DVDFLQKQDVHVHVPDGATPKDGPSA
LON1_HYDCU      QAAMSVIRSRSKELGL------------------PDDFYEKQDVHLHFPEGAIKKDGPSA
LON_FRAP2       DAAFSVVRSISKDYKL------------------EDDFYEKKDIHIHVPEGATPKDGPSA
LON_NEOSM       QAAYSFVCSNCNKFGF------------------TSKFFKSKDVHLHVPEGATSKDGPSA
LON_WOLPP       KAAYSYVRSNCLFFGI------------------KPEKFQNNDIHLHVPEGAVPKDGPSA
LON_RICCN       MAAYSCFRSRATNFGL------------------KYDNYKDFDIHIHVPAGAIPKDGPSA
LON_RICFE       MAAYSCFRSRATNFGL------------------KYDNYKDFDIHIHVPAGAIPKDGPSA
LON_RICPR       MAAYSCFRSRATNFGL------------------KYDNYKDFDIHIHVPAGAIPKDGPSA
LON_RICTY       MAAYSCFRSRAPNFGL------------------KYDNYKDFDIHIHVPAGAIPKDGPSA
LON_RICBR       MAAYSCFRSRAADFGL------------------KYEDYKDFDVHIHVPAGAIPKDGPSA
LON_ORITI       QTAFSYFCSRAQKYNV------------------KYEQYHKYDIHIHFPEGAIPKDGPSA
LON1_MYXXA      QAAMSYVRSRAERFGI------------------DRKVFENYDIHVHLPEGAIPKDGPSA
LON3_SORC5      HAAMSYVRSRLDRLGL------------------EADVYQKVDVHIHFPDFVR-KDGPSA
LON1_SYNFM      QAALSYVRSRAKRLGI------------------DPDFYQNFDIHVHVPEGAIPKDGPSA
LON2_DESPS      QAAYSYIRSRAKELKL------------------EPDFYEKVDIHVHVPEGAIPKDGPSA
LON_DESVH       KAALSYLRSRSDLFGL------------------RPDFHKEIDIHVHVPEGATPKDGPSA
LON_SOLUE       QAAMSYIRSRAMSLGI------------------PRDFYRNLDLHIHIPEGAIPKDGPSA
LON1_BACSU      QAAFSYVRSKTEELGI------------------EPDFHEKYDIHIHVPEGAVPKDGPSA
LON_BACAH       QAAFSYIRSRAEELQI------------------DPDFHEKNDIHIHVPEGAVPKDGPSA
LON_BRECH       QAAFSYIRSRASEWGI------------------DPEFHEKNDIHIHVPEGAIPKDGPSA
LON_DESRM       QAGYSFIRSRAQELGI------------------DQEMFEKWDLHIHIPEGAIPKDGPSA
LON_HELMI       QASLTYVRSRARELGI------------------ADNFHQNTDIHIHVPEGAIPKDGPSA
LON_SYNWW       QAALTYVRSKADELGI------------------NDEIRDKYDVHIHIPEGAIPKDGPSA
LON_HALOH       RAALSYIRSKQEELGL------------------SDNFHEEYDLHVHVPKGATPKDGPSA
LON_CALS8       KAAVSIIRARAKELGI------------------DENFYKEYDIHIHVPEGAIPKDGPSA
LON_CLOD6       KTGISYIRSIVDKFDI------------------DPEFYKTNDIHIHIPEGAVPKDGPSA
LON_CLOAB       QAGYSYVRANSVKYGI------------------DKEFYKNKDIHVHVPEGAVPKDGPSA
LON_FINM2       MAAISYIRSNQEALGI------------------KGEFYKEKDIHIHVPEGAVPKDGPSA
LON_ELUMP       HAALTYARSKGYGKGI------------------D---FNKTDFHIHFPEGAVPKDGPSA
LON_UNCTG       QAALTYVRSSSQKLKI------------------DENMFSNTDFHVHVPEGAVPKDGPSA
LON_FERNB       RIALSLARKIVGDEY--------------------AEKFTKNDIHVHVPEGAVPKDGPSA
LON_PSELT       RIALSVARSFCGQDC--------------------KEKFQQSDIHINLPEGAVPKDGPSA
LON_COPPD       MAALTYVRSRAKQLGI------------------DEEFYKKYDIHVHAPEGAIPKDGPSA
LON1_THET2      HAALTYLRAHREEWGL------------------PEGFHKDYDLHIHVPEGATPKDGPSA
LON_AQUAE       QAALSYIRSKAEDYGI------------------DPDIFSQVDVHVHVPEGAVPKDGPSA
LON_SULSY       RIAFSYVKSKAKELGI------------------DPEEFGKYDLHIHVPAGAIPKDGPSA
LON_GEOLS       QAALAYIRSHGSEFHI------------------NPDWFQENEIHVHVPAGAVPKDGPSA
LON_GEOMG       QAALSYIRSKAKEFHL------------------AEDFLSGYDIHVHVPAGAIPKDGPSA
LON2_BDEBA      HAAMSYARAHQEELGI------------------PEDFFEKYDVHVHLPAGAIPKDGPSA
LON_DESAL       RAALSYARTNEDELEI------------------DPDLFDNFDIHIHVPAGAIPKDGPSA
LON_LAWIP       QAALSYARSKASSLNI------------------SPDFAKSMDIHIHIPAGATPKDGPSA
LON_CHLAD       QTAVSYVRSRAADFGI------------------DPNTFEETNIHIHIPEGAVPKDDPSA
LON2_HERA2      QAALSYARASSRRLGI------------------DGKRFEKIDIHIHVPEGGVPKDGPSA
LON_KORVE       QAALSWVKSNAGKLGI------------------DEEFFEKHDIHIHVPAGAIPKDGPSA
LON1_HERA2      RAALSWVRAEGEAYGI------------------DPNFAQHYDLHVHVPAGAQPKDGPSA
LON_DESOH       TAALSFIRAHARDYDI------------------DEDFFDKYDFHIHVPSGAIPKDGPSA
LON_SYNAS       SAALSFIRSNAVKIGI------------------PVDFFEETDIHIHVPAGAIPKDGPSA
LON2_SYNFM      TAALTFVRAHAADLEI------------------EGEEFDRSDIHVHVPAGATPKDGPSA
LON_DICT6       KTALSYVRSKLKDLNV------------------SYELLEKADIHVHVPSGAIPKDGPSA
LON_ROSCS       RAALTYARSRARALNI------------------PTDFAQICDIHIHVPAGAVPKDGPSA
LON_GEOBB       RAALSFVKANCAELGI------------------DKKMFDETTLHIHVPAGSIPKDGPSA
LON2_PELCD      KTALSYVRAHHADFGI------------------DAQVFENLDIHLHVPSGAIPKDGPSA
LON_ANADE       QAALSYLRSKSDSLGI------------------PVNFLEKTDLHIHFPAGAIPKDGPSA
LON2_MYXXA      TAALSYLRSKAEQLGI------------------SPNFLEKTDLHLHFPAGSIPKDGPSA
LON2_SORC5      STAVSFVRSKADRLHL------------------DPEWLKEIDLHVHIPQHGTPKDGPSA
LON4_SORC5      KAALTYVRSHAIELGV------------------DTAKLEAEDLHIHVPAGGVPKDGPSA
LON_METSB       QAALSLIKSRAAELGV------------------DPESFDKTDIHVHVPAGATPKDGPSA
LON_PHEZH       QTALSLVKSRAEALGV------------------TPSLFKESDIHIHVPAGATPKDGPSA
LON_PARPJ       QAALTLVKSRCESLHI------------------DCSNFDKRDIHVHVPAGAVPKDGPSA
LON_MYCSM       QIAMSYVRAHAKQLGV------------------DPEAL-NRRIHIHVPAGAVPKDGPSA
LON_SALAI       QIALSYLRSNGRRLGL------------------DPNALAGRRIHLHVPAGAVPKDGPSA
LON_CHLAA       EAALTYVRSRARSLGI------------------EPDFFETHAIHIHVPAGAVPKDGPSA
LON_DEIRA       RAALTYAKSNAERFHI------------------DREKLDNSEIHVHVPAGAIPKEGPSA
LON2_THET2      RAALSYAKKNALRFGI------------------PLEKFDKSDIHIHVPAGAIPKEGPSA
LON1_SORC5      RAALSYARAHAAELGV------------------PSDRLQRRDVHIHVPAGAVPKDGPSA
LON_NITOC       KAAQSYLWSRAEELNI------------------DQKTIRESGVHIHVPAGAIPKDGPSA
LON_FUSNN       SVAMTYVKANLKKYPPK-----------------DKDFFKDRTIHLHFPEGATPKDGPSA
LON_MYCA5       TISLAYVRSNAEKFGIK------------------DFDFENTSIHIHVPEGAIQKDGPSA
LON_MYCMO       QIALAFVRSNAKKYEI-------------------DFNFEANQIHIHVPEGAVPKDGPSA
LON_MYCH2       RIALSYVQSKAKDFGI-------------------NFDFENTLIHIHVPEGAIPKDGPSA
LON_MYCGE       NVALGYVKANAERFNINP----------------SL--FKKIDINIHVPGGGIPKDGPSA
LON_MYCPN       SVALGYVKANAQSFNINP----------------NL--FKKVDINIHVPGGGIPKDGPSA
LON_MYCPE       NVALGYVKTNAVKFGIDP----------------KI--FGEIDLHVHVPSGGIPKDGPSA
LON_UREP2       SVALGFVKANADKYGIDT----------------KKVSFKEIDIHVHVPSGGIPKDGPSA
LON_MYCMS       TIALTYVKANHEKFGISK----------------DK--FDDIDIHIHVPEGAVPKDGPSA
LON_AYWBP       YTALSFIKANCQNLGIDA----------------NI--FAENDFHIHLPEAAIPKDGPSA
                  .                                        .::: *     *:.***

LON_CAMC1       GITMATAIASILTDTKVKHDIAMTGEITLTGRVLPIGGLKEKLIAAHKAGIKTALIPRKN
LON_CAMJE       GITISTAIASIFSDKKVKADVAMTGEIDLKGKVLPIGGLKEKLIAAYKADIKTALIPRKN
LON_HELPY       GIAMASVMASILCDRATRSEVAMTGELTLSGEVLPIGGLKEKLIAAFKAGIKTALIPVKN
LON_HELPJ       GIAMASVMASILCDRAIRSEVAMTGELTLSGEVLPIGGLKEKLIAAFKAGIKTALIPVKN
LON1_BORBU      GITIASAFISLALNKVVRPHLAMTGELSLTGNVMMIGGLKEKIIAAKRSGVEHIIVPKAN
LON_BORDL       GITIASAFISLALNKTVRPNLAMTGELSLTGNVMAIGGLKAKIIAAKRNGVEHIIIPKAN
LON_LEPIC       GITMASAILSLALNTKVKSGFGMTGELTLTGEVLAIGGLREKIVAAKRVGIHKIIYPKDN
LON_TREPA       GITMTTTLFSLLTQQKVKPRLAMTGELSLTGQVLPIGGLKEKTIAARRGGIKEIIMPKAN
LON_CHLMU       GITMVTSLLSLLLDVPVLNNLGMTGELTLTGRVLGIGGIREKLIAARRSKLNVLIFPEDN
LON_CHLTR       GITMVTSLLSLLLDVPVLNNLGMTGELTLTGRVLGIGGIREKLIAARRSKLNILIFPEDN
LON_CHLPN       GITMVTSLLSLLLETPVVNNLGMTGEITLTGRVLGVGGIREKLIAARRSRLNILIFPEDN
LON_PARUW       GITMVTSLLSLILDTPVLDNLGMTGELTLTGRVLPIGGVKEKLVAARRSGLKVLIFPKDN
LON1_DESPS      GITMACSLYSMATGKTIVPGVAMTGELTLTGLVMPIGGVKEKMIAARRAHVKQVILPKEN
LON1_PELCD      GVTMATALLSMITGKPVIKKLGMTGELTLTGKVLPIGGVKEKIIAVKRIGLTTVILPEAN
LON_MAGMM       GITIATALLSLARTQPLPRRLAMTGEITLTGSVLAVGGVREKVIAARRVGIRELIIPEAC
LON2_HYDCU      GVTMATALLSLARNEAIKKPLAMTGELSLTGQVLPVGGIREKVIAARRVGIKELILPDEN
LON_CLOB8       GIALFTALASLVTGIKVDSKLAMTGEITLRGAVLPIGGLKEKLLGAQRAGITKVLIPKDN
LON_METBF       GVTLFTALTSLIIGKAVDPKLAMTGEITLSGAVLPVGGIKEKVLAAHRAGIKKIILPKEN
LON_METST       GVTLLTTIASLVTNTPVDSTLAMTGEISLRGKVLPVGGIKEKVIAAHRSGIKTVLLPEEN
LON1_BDEBA      GITMLTSMASMLLNKPVDPKVAMTGEISLRGSVMPVGGIKEKVIAAHRAGVQEILLCKRN
LON_CYTH3       GIALYTSLASTFTQRKIKPALAMTGEITLRGKVLPVGGIKEKILAAKRAGIKEIILSKKN
LON_FLAJ1       GIAMLTSLVSLLTQKKVKKSLAMTGEITLRGKVLPVGGIKEKILAAKRAGIKEIILCHEN
LON_PARD8       GITMVTSLVSAFTQRKVKKNLAMTGEITLRGKVLPVGGIKEKILAAKRAGIKELILCKEN
LON_PORG3       GITMVTSLVSALTRRKVRAGIAMTGEITLRGKVLPVGGIKEKILAAKRSGITEIILCEEN
LON_AMOA5       GITLFAALASLYTQRKVKDKVAMTGEITLRGKVLPVGGIKEKILAAKRAGIKEVILSKEN
LON_CHLT3       GVTILTSLASIYTQRKVKPCIAMTGEITLRGRILPVGGIKEKVLAAKRAGITEILLPEKN
LON_ACIB3       GLALTTALVSAFTGIAIRPDIAMTGETSLGGRAMRIGGLKEKLLAAHRGGIKLVFIPQDN
LON_DICNV       GIAMATALLSALSKQAVRGDLAMTGEITLHGKVLAIGGLKEKLLAAQRGRLKMVLIPEDN
LON_BRUAB       GIAMVTAIVSVLTGIPVRKDIAMTGEVTLRGRVLPIGGLKEKLLATLRGGIKKVLIPEEN
LON_BRUA2       GIAMVTAIVSVLTGIPVRKDIAMTGEVTLRGRVLPIGGLKEKLLATLRGGIKKVLIPEEN
LON_BRUME       GIAMVTAIVSVLTGIPVRKDIAMTGEVTLRGRVLPIGGLKEKLLATLRGGIKKVLIPEEN
LON_BRUSU       GIAMVTAIVSVLTGIPVRKDIAMTGEVTLRGRVLPIGGLKEKLLAALRGGIKKVLIPEEN
LON_RHIME       GVAMATAIVSVMTGIPISKDVAMTGEITLRGRVLPIGGLKEKLLAALRGGIKKVLIPEEN
LON_AZOC5       GVAMATTIVSVLTGIPVRRDVAMTGEITLRGRVLPIGGLKEKLLAALRGGIKKVLIPEEN
LON_AZOBR       GVAMITSIVSVLTGIAVRKDVAMTGEITLRGRVLPIGGLKEKLLAALRGGLKHVLIPKDN
LON_CAUVC       GIAMALAMVSVLTGIPIRKDIAMTGEITLRGRVTAIGGLKEKLLAALRSGVKTVLIPQEN
LON_CAUVN       GIAMALAMVSVLTGIPIRKDIAMTGEITLRGRVTAIGGLKEKLLAALRSGVKTVLIPQEN
LON_BUCAI       GAAMCTAIVSSLTNNPVKSNVAMTGEITLHGKILPIGGLKEKLLAAHRGGIKTVLIPYEN
LON_BUCAP       GIAMCTAIVSSLTKNPVKSNIAMTGEITLQGRVLTIGGLKEKLLAAHRGGVKTVLIPYEN
LON_BUCBP       GIAMCTAIVSCLTGIPVKSDIAMTGEITLRGQILTIGGLKEKLLAAHRGGIKKVLIPYDN
LON_ECOLI       GIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFEN
LON_ECOL6       GIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFEN
LON_SHIDS       GIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFEN
LON_ERWAM       GIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPDEN
LON_VIBPA       GTAMCTALVSALTGNPVKAEVAMTGEITLRGEVLPIGGLKEKLLAAHRGGIKTVLIPKDN
LON_HAEIN       GIAMCTALISCLTGNPVRADVAMTGEISLRGKVLPIGGLKEKLLAAHRGGIKTVLIPKEN
LON_XANOR       GIAMVTSLVSVLTKVPIRADVAMTGEITLRGRVSAIGGLKEKLLAALRGGIRTVLIPGEN
LON1_HYDCU      GIAICTAIASVLTQIPVRSDVAMTGEITLRGEVLPIGGLKEKLLAAARGGIKTVLIPYEN
LON_FRAP2       GIAMTTALVSVYTNKPVRNDIAMTGEVTLRGDVLAIGGLKEKLLAALRGGIKEVLIPKQN
LON_NEOSM       GVAICTSIVSVMTGIPVRSNVAMTGEVSLRGKVMEIGGLKEKLLAAVRGGIKIVLIPASN
LON_WOLPP       GSAVCTSIVSLMTNIPVNKSVAMTGEVTLRGRVLAIGGLREKLLAALRGSIKTVIIPSEN
LON_RICCN       GCALFTTIVSLMTKIPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEEN
LON_RICFE       GCALFTTIVSLMTKIPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEEN
LON_RICPR       GCALFTTIVSLMTKIPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEEN
LON_RICTY       GCALFTTIVSLMTKIPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEEN
LON_RICBR       GCALFTTIVSLMTKIPVRRTVAMTGEVTLRGNVLPIGGLKEKLLAASRGGIKTVLIPEEN
LON_ORITI       GIAIFTTIVSLMTGIPVKLSVAMTGEITLRGRILPIGGLKEKLMAAKRGGIKTVIIPEGN
LON1_MYXXA      GVTICTALVSALTRVLIRRDVAMTGEITLRGRVLPIGGLKEKTLAAHRAGIKTVLIPKAN
LON3_SORC5      GVTMVTALVSSLMKVPVRRDLAMTGEITLRGRVMPIGGLKEKLLAAHRGGIATVILPKEN
LON1_SYNFM      GITMATSIVSALARIPVRSDLAMTGEITLRGRVLPIGGLKEKILAAHRALLKTVLIPKDN
LON2_DESPS      GITIATTLASALTGRPIRHELAMTGEITLRGRVLPIGGLTEKLLAAKRGNITKVLLPEEN
LON_DESVH       GITLATSMVSALLGIPVRNDVAMTGEITLRGRVLPIGGLREKLLAAHRGQIGKVLVPREN
LON_SOLUE       GITLATTICSALTKIPVRGDLAMTGEITLRGKVLPIGGLKEKLMAAHRHGILEAIMPKEN
LON1_BACSU      GITMATALVSALTGRAVSREVGMTGEITLRGRVLPIGGLKEKALGAHRAGLTTIIAPKDN
LON_BACAH       GITMATALISALTGIPVSKEVGMTGEITLRGRVLPIGGLKEKTLSAHRAGLTKIILPAEN
LON_BRECH       GITMATALVSALTGIPVKKEVGMTGEITLRGRVLPIGGLKEKCMSAHRAGLTTIILPKDN
LON_DESRM       GITMATAMASVLTGRKVRHDIAMTGEITLRGRVLPVGGIKEKVMAAHRAGIKLIILPNDN
LON_HELMI       GITIATALTSALSRRPVRREVAMTGEITLRGRVLPVGGIKEKMLAANRAGCTTVILPAEN
LON_SYNWW       GITLATALASAMSGLPVRSDVAMTGEITLRGRILPIGGVKEKILAAHRAGIAKVLLPVEN
LON_HALOH       GITIASAIASALTGQPVKGKYAMTGEVTLRGRVLPVGGIKTKIMAARRAGLKDIIMPEEN
LON_CALS8       GVTMATAMVSALSKKPVRHDVAMTGEITLSGRVLPIGGVKEKILAAKRVGIKNVILPYEN
LON_CLOD6       GITMALAVISALTKRPVPGNIAMTGEITLRGRVLAVGGVKEKLLAAHRAGITKVLIPKEC
LON_CLOAB       GVTMITAMVSALSDKKVKHNVAMTGEITLTGRVLAIGGLKEKTLAAYRAGVDTIIIPKQN
LON_FINM2       GVTMVTALVSALTGRKVKHDFAMTGEITLTGRVLAIGGVKEKVLAAHRYGINKVFLPKEN
LON_ELUMP       GTAVTTALISLLTKNPVKKNLAMTGEVTITGRVLPIGGVKEKFMAAYREGVKTILYPHTN
LON_UNCTG       GIALATALASVCMNKPIKKKIAMTGEVTLRGRVLSIGGLKEKVLAAYREGITMILFPESN
LON_FERNB       GVTITTALVSVVKNIPVRNDIAMTGEITLRGRVLPVGGIKEKVMAAYRKGIYHVILPKKN
LON_PSELT       GITMTVAMISSVLGKPVRNDTAMTGEITLRGKILAVGGVKEKILAAHRHGIKRILLPKTN
LON_COPPD       GITIATAMISALKKEPVPNDLAMTGEITITGKVLPIGGVKEKVLAAHRIGLDRVILPKDN
LON1_THET2      GITIATALASALTGRPVRMDIAMTGEITLRGRVLPIGGVKEKLLAAHQAGIHRVILPKEN
LON_AQUAE       GVAIATALLSLFTDIPVRMDVAMTGEITLRGRVLPVGGLKEKILAAKRAEIYEVILPAKN
LON_SULSY       GIAITTGIASVFTNRPVRSDVAMTGEITLRGKVLPVGGLKEKILAAKRAGIKTVILPKDN
LON_GEOLS       GCAMATALISVLTKVPVKKDVAMTGEISLRGKVLPIGGLKEKILAAVRAGMKMVIIPEQN
LON_GEOMG       GVTMATALVSALTRVPVRKDVAMTGEITLRGKVLPIGGLKEKMLAAIRAGIKTIVIPEQN
LON2_BDEBA      GITLTTALVSLMTGTPVRHDIAMTGEVTLQGRVLPVGGIREKCLAALNLGITNIIIPMAC
LON_DESAL       GIAMTTALVSALTERPVANDIAMTGEVTIRGRVLPIGGLREKSLGALRAGIKTIIIPEKN
LON_LAWIP       GVTLTTALISALTGKSVRGDLCMTGEITLRGRVLPVGGIKEKVLAGVARGLGHVIIPTKN
LON_CHLAD       GITLTTALISALTGTPVRRDVAMTGEVTLRGKVLPIGGLKEKTLAAHRAGIRTFILPKEN
LON2_HERA2      GITLACSVISALTHRPLRRDVAMTGEITLRGRVLPIGGLRDKILGAYRAGITTMLIPKKN
LON_KORVE       GVTMVTALVSLLTDKPLRPLTAMTGEITLSGNVLPIGGVKEKTLAAKRAGVKTIILPSEN
LON1_HERA2      GIAMATALVSLLTGRVLRDDVAMTGEITLRGKVLPIGGVREKVLAAHRAGIRTIILPQRN
LON_DESOH       GVTMLTALVSLLTGRKVKKGLAMTGEITLRGKVMPVGGIKEKVIAAHRAGIKEVILPRPN
LON_SYNAS       GVTMLAALASLLTNRTVKNDLAMTGEITLRGLVLPVGGIKEKVLAAHRAGIKTIILPKWN
LON2_SYNFM      GAPMVVALASLMTGREVRKDVAMTGEITLRGDILPVGGIKEKVLAARRAGVKEIMIPHAN
LON_DICT6       GVTIATAIASALTRRPVKKDIGMTGEITLRGKVLPVGGIREKVLAAHRAGLTAVIMPKEN
LON_ROSCS       GITMASALISALTDRRAYKHVAMTGEITLRGKVLPIGGVKEKVLAAQRAGVRTVLLPKAN
LON_GEOBB       GITMATAIVSLFSGRAARRDVAMTGEMSLTGRVLAIGGLKEKVLAARRAGVKKVLAPAKN
LON2_PELCD      GVTIATALISQLTRRPARRNVAMTGELTLTGRILPIGGVKEKVLAARRAGVTTVLLPERN
LON_ANADE       GVTILTALVSLLTGIRVRSDVAMTGEVTLRGLVLPVGGIKEKVLAAHRAGIKRIIIPARN
LON2_MYXXA      GVTILTALTSLLTGIRVRHDTAMTGEATLRGLVLPVGGIKEKVLAAHRAGIKRVILPERC
LON2_SORC5      GVTMFAAVASLLLGAPVRSDVAMTGEISLRGRVMPVGGVKEKLLAAHRAGIRHVLIPAKN
LON4_SORC5      GVTMFTALTSLLSARRVRSDTAMTGECTLRGRVLPVGGIKSKVLAAHRAGIKRVVLPQKN
LON_METSB       GVAMFIALVSILTGRLVRNDTAMTGEISLRGLVLPVGGIKEKVVAAARAGLTRVLLPARN
LON_PHEZH       GVAMTMALISLLTDRTVRSDTAMTGEISLRGLVLPVGGIKEKVVAAATAGVRRVLLPARN
LON_PARPJ       GVAMFIAIASLLMGRAVRSDCAVTGEISLRGIVLPVGGIKEKVLAALRGGIKTVLLPARN
LON_MYCSM       GVTMVTALVSMATGRKVRGDVGMTGEVTLNGRVLPIGGVKQKLLAAQRAGLSTVFIPQRN
LON_SALAI       GITMVTALASLVSGRPVRPEFGMTGEVTLSGRALPIGGVKQKLLAAHRAGLTEVIIPQRN
LON_CHLAA       GITMATALASAATGRLVRDDIAMTGEISLRGRVLPIGGIKEKALGAHRAGIRTVILPRRN
LON_DEIRA       GGAMATSLISALTGIPARHDVAMTGEMTLTGRYLPIGGLKEKVLGARRAGIKHIILPKAN
LON2_THET2      GVALVSALVSALTEVPVRHDIAMTGEITLTGRVLPIGGVKEKVLGARRAGIREVILPKLN
LON1_SORC5      GVTMAVALVSALSGRPVRSDIAMTGEITLRGTVLPIGGIKEKVLGAHRAGIFEILLPADN
LON_NITOC       GVTMASALTSAYAHQPVRSDTAMTGEITLSGLVLPVGGIKEKVLAAHRSGIQRIILPKEN
LON_FUSNN       GITITTAIVSVLTNKKVRQDIAMTGEITITGDVLAIGGVREKVIGAHRAGIKEVILPEDN
LON_MYCA5       GVTFTTAIISALSKKAVPNTIAMTGEITLRGKVLPIGGLKEKSLAASQIGIKTIFIPKDN
LON_MYCMO       GVTFTTAIISALKQIPVSHKVGMTGEITLRGKVLPIGGLKEKSLAAHKLGIKTVFIPNEN
LON_MYCH2       GITFATAIISALSQKPVSHNIAMTGEITLRGKVLAIGGLKEKTMGAYKNGIKIIFIPKAN
LON_MYCGE       GAALVTAIISSLTGKKVDPTVAMTGEITLRGKVLVIGGVKEKTISAYRGGVTTIFMPEKN
LON_MYCPN       GAALVTAIISSLTGKKVDPKIAMTGEITLRGKVMTIGGVKEKTISAYRGGVRTIFMPEKN
LON_MYCPE       GIALTTAILSALKNVKIPSNVAMTGEITLRGRVLIIGGVKEKTISAYRGGANDIFMPKED
LON_UREP2       GIAITTAIISSLSQRPVRTTLSMTGEIMLRGNVGIIGGVKEKVISAYRAGVREIILPIDD
LON_MYCMS       GITLTTALISALSKQPVSKDFGMTGEITLRGNVLPIGGLREKSISAARSGLKHILIPSKN
LON_AYWBP       GITIATSLVSAITQKYIKKGLGMTGEITLRGNILAIGGLKEKAIAANRSGLDTIFIPQEN
                * ..   . *            :***  : *    :**:  * :.         .     

LON_CAMC1       YDRDLVDIPAEV---KADMKIIAVDTIDDVLKNALVAKK---------------------
LON_CAMJE       YERDLKDIPSEV---RDNMEIIAVDTFSDVLEYTLV------------------------
LON_HELPY       YERDLDEIPAEV---RENLNIVAVKNIAEVLEKTLL------------------------
LON_HELPJ       YERDLDEIPTEV---RENLNIVAVKNIAEVLEKTLL------------------------
LON1_BORBU      RVD-LEEIPTNI---KSGINFYLVDNMREVIKLLF-------------------------
LON_BORDL       KVD-LDDIPINI---KNGINFHLVDSMKEVIKLLF-------------------------
LON_LEPIC       LQH-LQEIPDYV---KKGMYFFPVSRYEEVALLLFDEKVISKINPSFRENLKSIVNPTRK
LON_TREPA       VRD-LDEIPEHV---KKGMVFHLVESMEEVLSLAFP-----------------------K
LON_CHLMU       RRD-YDELPAYL---KKGLKVHFVTHYDDVFKIAFPGV----------------------
LON_CHLTR       RRD-YDELPAYL---KKGLKVHFVTHYDDVFKIAFPGV----------------------
LON_CHLPN       RRD-YEELPAYL---KTGLKIHFVSHYDDVLKVAFPKLK---------------------
LON_PARUW       LRD-YEELPEYI---RKGITVHFVDHYDQVFKISFPNKHQMKLC----------------
LON1_DESPS      EED-FDMLPDYI---KEDLSAKFVETFEDVLKICFK------------------------
LON1_PELCD      RKD-FEELPDHL---RENLSVHFAGDYRDVYQVAFG------------------------
LON_MAGMM       RKD-YDEVPEHI---REGFTVHFVKKYAEVAKLVFG------------------------
LON2_HYDCU      RKD-YDELPDYL---KEGMTLHFAKHFDDVAKLTFHIRSKSSALKKYLSKAVISTEEKTE
LON_CLOB8       VVD-LNEVPQEV---KEQLTIIAVETVEDVLRETLGISLPRIEH----------------
LON_METBF       ERD-LEDVPEDA---RNELQFVPVETIEEVLREALDIDLPRP------------------
LON_METST       MKD-LDDVPCEV---KDDMTFKPMKTVDEVLYEALGLKLPEN------------------
LON1_BDEBA      EKD-LREIPEDI---RKDLRFHFVEDVNEVLKITLGVNVPKWDQ----------------
LON_CYTH3       KKD-IEEIHPPD---IADLKFHFVETADEVLAIALLKQKIKK------------------
LON_FLAJ1       KSD-IDEIKEEY---LEGLTFHYVKEMSEVLAIALTDQNVKN------------------
LON_PARD8       EKD-INEIKPEY---LKGLVFHYVSDIQQVVDLALLREKVDN------------------
LON_PORG3       RKD-IEEINDIY---LKGLKFHYVSNINEVLKEALLEEKVID------------------
LON_AMOA5       KKD-IQEIKQKD---IQDLKFHYVEFVEEVIQLALQPSKVEA------------------
LON_CHLT3       EKD-VKEALETNGGAFSDVSFKYFHEMDDLIDYVLEPAENGA------------------
LON_ACIB3       VRD-LAEIPDNV---KEGLEIKAVKSIDEILPLALTSMPK--------------------
LON_DICNV       LKD-LDEIPEEV---KAALEIVPVSHIHEVFDHAFVADHA--------------------
LON_BRUAB       AKD-LAEIPDNV---KNNLEIVPVSRVGEVLKHALVRQPE--------------------
LON_BRUA2       AKD-LAEIPDNV---KNNLEIVPVSRVGEVLKHALVRQPE--------------------
LON_BRUME       AKD-LAEIPDNV---KNNLEIVPVSRVGEVLKHALVRQPE--------------------
LON_BRUSU       AKD-LAEIPDNV---KNNLEIVPVSRVGEVLKHTLVRQPE--------------------
LON_RHIME       AKD-LADIPDNV---KNSLEIIPVSRMGEVIAHALLRLPE--------------------
LON_AZOC5       AKD-LADIPDNV---KNALEIIPVSRMDEVLHHALLRHPE--------------------
LON_AZOBR       EKD-LAEIPDNV---KRGLEIIPVSTVDDVLKHALVREVE--------------------
LON_CAUVC       EKD-LADVPQTV---KDGLEIIPVSTVDEVLKHALTGPLT--------------------
LON_CAUVN       EKD-LADVPQTV---KDGLEIIPVSTVDEVLKHALTGPLT--------------------
LON_BUCAI       KRN-LEEIPKNI---IEGLNIHPIKKIEEVLKLSLEKIPYV-------------------
LON_BUCAP       KRN-LEEIPKNI---IEGLTIYPVKNIEEVLKIALENTPYV-------------------
LON_BUCBP       EKD-LQEIPKTI---LKGLFVHPVKHIKEVLNLSLENTPYFSSK----------------
LON_ECOLI       KRD-LEEIPDNV---IADLDIHPVKRIEEVLTLALQNEPS--------------------
LON_ECOL6       KRD-LEEIPDNV---IADLDIHPVKRIEEVLTLALQNEPS--------------------
LON_SHIDS       KRD-LKENPDNA---KADQDRHPVKNNEEEQTLSLQNYPSVFLFFFFFFFEAIEAFNRFT
LON_ERWAM       KRD-LEEIPENV---IADLDIHPVKRIEEVLALALQNAPY--------------------
LON_VIBPA       ERD-LEEIPENV---IADLQVIPVQWIDEVLKVALERDPT--------------------
LON_HAEIN       VKD-LEEIPENV---KQNLAIHAVETIDEVLGFALENPPE--------------------
LON_XANOR       RKD-LADIPANV---TRDLKIVPVKWIDEVLDLALERPLTPKKA----------------
LON1_HYDCU      VRD-LAEISDEV---KEGLDIHPVQWIDEVFKIALESFPNVEND---------------E
LON_FRAP2       VKN-LADVDKEI---LEKLEITPVNSIKEVLERVF-------------------------
LON_NEOSM       EKD-LENIPKSV---KNAVRIIPVSTVSEALTFTLAEQPT--------------------
LON_WOLPP       EKD-MQEIPANI---KEEINVIFAENIDEVIKVALMHPIT--------------------
LON_RICCN       VKD-LKDIPPNI---KESLEIISVSNIDQVLKHALVGTPI--------------------
LON_RICFE       VKD-LKDIPPNI---KESLEIISVSNIDQVLKHALVETPI--------------------
LON_RICPR       VKD-LKDIPPNI---KENLEIISVSNIDQVLKHALVEMPI--------------------
LON_RICTY       VKD-LKDIPPNI---KENLEIISVSNIDQVLKHALVEMPI--------------------
LON_RICBR       VKD-LKDIPPNI---KSSLEIIPVSNIDQVLEHALTKKT---------------------
LON_ORITI       TSD-LEDIPNSI---KNDLDIIPLSEADQVLDIALATTVT--------------------
LON1_MYXXA      KKD-LKDIPLKI---RKQLRIVPVEFVDDVLREALVLEKPEEFGRKP-------------
LON3_SORC5      RKD-LRDVPRRV---LKALRLVLVEHVDDVLREALILPDAYAIFGPPKGVL--------E
LON1_SYNFM      AKD-LKDIPAKI---LEEIQVELVEHMDDVLRKAMVVPEDRELFHEE-------------
LON2_DESPS      GRD-LKDVPAKI---KNALDIKLVSHMDQVLEQALLSKGKNK------------------
LON_DESVH       EKD-LKEVPGEI---LKGLEIVFVDHVDEVLPQALMAQAESIFGGRT-------------
LON_SOLUE       EKD-LPDIPDAI---KKTMKLHFVESMDEVLKIALEREIVALP-----------------
LON1_BACSU      EKD-IEDIPESV---REGLTFILASHLDEVLEHAL----VGEKK----------------
LON_BACAH       EKD-LDDIPESV---KENLTFVLASHLDEVLEHAL----VGVKQ----------------
LON_BRECH       EKD-IEDIPESV---REALTFYPVEHLDEVLRHALTKQPVGDKK----------------
LON_DESRM       KKD-LEDIPVNI---KKQLEFKLVDHIDQVLAIALLEKEVVDTTTVLEPEAAVMDNPHFS
LON_HELMI       KKD-LEEVPANV---KKKLRFVLVEHMDQVIREALLEPVPVQAPEPPETIPAAIETSVPV
LON_SYNWW       KKD-LAEIPAPV---KRKIKLVLVSHMDEVLEETLLKLEAIQPG---EDFPGVLLNPELV
LON_HALOH       KKD-FEEIPVKI---KKDIRVNFVNHMDQVLDLILGGDEDEN------------------
LON_CALS8       KKD-VDELEDYV---KKDMNFVFVKAIDEVFKIAIKE-----------------------
LON_CLOD6       EAD-LDEIPENV---KEKMEFVLVEHMDEVLEQALLKSGENNEN----------------
LON_CLOAB       EKD-INKVPKAI---RGKIKFILAEEVDTVLENALIGGINNDN-----------------
LON_FINM2       KRD-IQDIDPKI---RQKIKFYFTSNVKEILDEVLI------------------------
LON_ELUMP       EKD-VSEVPEVI---RKQLKLIPVKHMDEIVKIAFEKGEPKSSFKKSKTAPKKESAKKAA
LON_UNCTG       KKD-LVDIPEDV---IKKLQMIPVSHMDEVISLTIER------------LPENKNIKMDK
LON_FERNB       EVD-IEKVPEVV---RTKMKFTFVETIEEVLEVALNEDNS--------------------
LON_PSELT       EKD-LKRIPPQV---KDKMEFIFVEDIEKAVEKSCS------------------------
LON_COPPD       KIN-MEEIGDEV---KKKLRFYFVDTMDQVVEIVFGKTS---------------------
LON1_THET2      AAE-LKEVPEEI---LKDLEIHFVEEVGEVLKLLLLPPPP--------------------
LON_AQUAE       KDEVMEELPEYV---REKMTLHFVDNLEEVFKIALVREPKPL------------------
LON_SULSY       KEEVMSDLPPYV---RKSMNLIFVDHIDEVFKIALREEKKEV------------------
LON_GEOLS       RKD-LEDIPKAM---QKKVKIVPVKEIDEVLKLALEKFPIPA------------------
LON_GEOMG       EKD-LEEIPKHI---LKKVTVVSAKVIDDVLAVALETFPPPP------------------
LON2_BDEBA      QKD-LADIPKVF---KDKINFILAENLDEVFAVAFDKSAK--------------------
LON_DESAL       KKE-LSEVPQQV---RRKLKYITVSHVNEVLEKALLPAEKKK------------------
LON_LAWIP       TKD-LEEIPQEL---KKKIKIHTVSHIDEVLPLAFSETIPVV------------------
LON_CHLAD       AKD-ISELPEKV---RRELNLIPVSSMDEVLRIALSRMPTPA------------------
LON2_HERA2      LRD-LEEVPNNV---RRQITVVAVEHMDEVLPIAFVSNPLER------------------
LON_KORVE       KMNMDEDLTPEQ---LQGIEVHYVKTIDEVLEIALPSNKAEE------------------
LON1_HERA2      LADLDE-IPADV---LAEVQFHGVEHVGQVIELALRAEASEA------------------
LON_DESOH       KKDLEE-IPAKV---KSAMKFHFAEKMGDVLELALNGNGATK------------------
LON_SYNAS       RKDLEE-IPSKV---RKEMNFVFVNDMREVLNIALSRK----------------------
LON2_SYNFM      MKDLAD-IPDHL---RRDMTIHELQTISDVLQLALLPS----------------------
LON_DICT6       KKDLEE-IPEEV---KKEITFYFVEHADEVLNLALLEVKES-------------------
LON_ROSCS       APDLRE-LPEET---RQQIDIVLVEHMDEVLPRVLHPKSESV------------------
LON_GEOBB       KKDLED-IPENV---KNELEFFFVEDIREVFVQALNPTSPAP------------------
LON2_PELCD      RENLKE-LDDHI---LAEMTVLLVDNLSEVVAHTLIPDTEHG------------------
LON_ANADE       EKD-LLDVPEQA---RKELEFVFAAHMDEVLQAALEENPVGRKPP------AAPEPEGEK
LON2_MYXXA      RKD-LIDVPDQA---RNELEFIFVTHMDDVLKAALETPPVG----------VAGTPGGEP
LON2_SORC5      RRD-LEDVPQDV---KDQIKITMVSSMEEILPLVLEP------------------PRRAP
LON4_SORC5      ARD-AEEIPKEV---RAELELIFVEDMSQVIAAALEEAPIE-------------AAGTGG
LON_METSB       RRD-YDEIPQDT---REKLEFVWLEKVDDAMAAAFEG-----------------------
LON_PHEZH       RAD-ERDIPEET---RQTLELIWLERIEDAIEAGLDP-----------------------
LON_PARPJ       APD-LEDIPVDA---RNQMRFVLLETVDDAVREIIED-----------------------
LON_MYCSM       QPD-LDDVPADV---LDALDVRPMTDVADIIAAALEPAHEAST-----------------
LON_SALAI       EPD-LDDLPAEV---REALTVHTLADVADVLALALRPADLDAD-----------------
LON_CHLAA       LID-LDDLPPAV---SAEMTFIPVDTLDEVLSIALLPPATTTD-----------------
LON_DEIRA       ERD-INDIPLHL---RSSMRFHPCETVDQVLDVALVGGLKALETPRTDSQVTPPADSGSK
LON2_THET2      EPD-LADIPKPL---RQNMTFHFVEHLDQVLDLALVGGLKALE------------ERGRR
LON1_SORC5      EAD-LDDLPAEV---RSSLEFYLVNTLDEALARCLRLRSIRLE-----------------
LON_NITOC       EKD-LREIPEHV---RQSIQFILARRIEEVLAEAIPDLNR--------------------
LON_FUSNN       RVD-TDEIPDEL---KSTMKIHFAKTYDDVSKLVFVK-----------------------
LON_MYCA5       EKN-LIDVPEEV---KKDIKFVPVEYYDEIFKYIFEAKNK--------------------
LON_MYCMO       NRN-LVEVADEV---KESIEFISVSDYDEIFENLFGKLSDNKKITSNSKIPKKDISKANP
LON_MYCH2       EKN-LVDIPQEV---KDVIQFIPVDTYQQIYDFIFK------------------------
LON_MYCGE       ERY-LDEVPKEI---VDKLNIIFVKEYSDIYNKLFS------------------------
LON_MYCPN       ERY-LDEVPKDI---VKDLEIILVKEYKDIYNKIFN------------------------
LON_MYCPE       ERY-LDDVPEEV---RSKIKITLVDTYDDVYNRLFK------------------------
LON_UREP2       ERY-LEDVPKYI---LDDIKIHLVKHYDEVYNIVFGEK----------------------
LON_MYCMS       VKD-IEDVPQEV---QDVLKITPVSKYEDVYEIIFKNNNQ--------------------
LON_AYWBP       LKD-IEDIPEEV---RNKLNIIPVSNISDVFSQVFVV-----------------------
                                                                            

LON_CAMC1       -----------------------------------
LON_CAMJE       -----------------------------------
LON_HELPY       -----------------------------------
LON_HELPJ       -----------------------------------
LON1_BORBU      -----------------------------------
LON_BORDL       -----------------------------------
LON_LEPIC       LSPKKKTTQKQKLSLSKQKGNNQKKK---------
LON_TREPA       GKRVRAGTAAQSASPETLTG---------------
LON_CHLMU       -----------------------------------
LON_CHLTR       -----------------------------------
LON_CHLPN       -----------------------------------
LON_PARUW       -----------------------------------
LON1_DESPS      -----------------------------------
LON1_PELCD      -----------------------------------
LON_MAGMM       -----------------------------------
LON2_HYDCU      QETTS------------------------------
LON_CLOB8       -IFNPNKFIEGTFKPAEE-----------------
LON_METBF       --VVPSSYPGSSYAPAHSV----------------
LON_METST       ---KPLNISIDEINKVTP-----------------
LON1_BDEBA      -VQLPPPSPLSSTDAGT------------------
LON_CYTH3       --PFNLEVPEEPKKKDK------------------
LON_FLAJ1       --AKTLK----------------------------
LON_PARD8       --PLF------------------------------
LON_PORG3       --TTDIYSFGKKTEEEKAEKVEKTEKKQRKK----
LON_AMOA5       --AKDWSITKKRKQQPGIGHVSTL-----------
LON_CHLT3       --PQFKVEDKDHTPETTGNESE-------------
LON_ACIB3       --PLPKTPIVKPVEGSKAARH--------------
LON_DICNV       --PFKARIEQKSLPTVSAVMHETPAGRC-------
LON_BRUAB       --PIEWTEQENPTAVPPVE--DEAGASLAH-----
LON_BRUA2       --PIEWTEQENPTAVPPVE--DEAGASLAH-----
LON_BRUME       --PIEWTEQENPTAVPPVE--DEAGASLAH-----
LON_BRUSU       --PIEWTEQENPTAVPPVE--DEAGASLAH-----
LON_RHIME       --PIEWDPASQPAALPSVDSQDEAGTSIAH-----
LON_AZOC5       --PISWTEQPVSGAVVPDE---DAAGVVAH-----
LON_AZOBR       --PIEWKEPEAVEPAVAKPQTDGGGEVLRH-----
LON_CAUVC       --PVEWNEAEEPITTSAKKDDGDSDAMLTH-----
LON_CAUVN       --PVEWNEAEEPITTSAKKDDGDSDAMLTH-----
LON_BUCAI       -----------------------------------
LON_BUCAP       -----------------------------------
LON_BUCBP       -----------------------------------
LON_ECOLI       --GMQVVTAK-------------------------
LON_ECOL6       --GMQVVTAK-------------------------
LON_SHIDS       AAGLKIACPAAILSLN-------------------
LON_ERWAM       --GMQVASVK-------------------------
LON_VIBPA       --GVEFEAKK-------------------------
LON_HAEIN       --GIEFVKVEAKPKAPRRKVTSKSERAVN------
LON_XANOR       --GKEKARKTAPRVAVRGKSRSTPGTRVKH-----
LON1_HYDCU      ISAISMKDAEMGKLVANKQSTKEIQKKSPKRH---
LON_FRAP2       -----------------------------------
LON_NEOSM       --PLAVDVWPDIPLSSTQQSEQRV-----------
LON_WOLPP       --SIDDN--NEISVSTSIENKDNTFPSSETLKH--
LON_RICCN       --NK-------------------------------
LON_RICFE       --NK-------------------------------
LON_RICPR       --NKGLSYDL-------------------------
LON_RICTY       --NKGLSYDL-------------------------
LON_RICBR       -----------------------------------
LON_ORITI       --NSPAETAC-------------------------
LON1_MYXXA      TTDGGKLGGTTELPASPAVAPA-------------
LON3_SORC5      YRDGELVTEAAPVKAPPAAAGEPTPAAPPGA----
LON1_SYNFM      --EAGAQQAVMFEQKPPAADEIRAH----------
LON2_DESPS      -----------------------------------
LON_DESVH       --QSTPLYAKLRKDAQDGGATMPTAQ---------
LON_SOLUE       -----IPGAELPVEAGKPAEETVAH----------
LON1_BACSU      -----------------------------------
LON_BACAH       -----------------------------------
LON_BRECH       -----------------------------------
LON_DESRM       AVDSQE--VQQQGGTQLPS----------------
LON_HELMI       YQGMLE--ETPPGLQT-------------------
LON_SYNWW       GENLNQDRVEPEANKDLC-----------------
LON_HALOH       -----------------------------------
LON_CALS8       -----------------------------------
LON_CLOD6       -----------------------------------
LON_CLOAB       -----------------------------------
LON_FINM2       -----------------------------------
LON_ELUMP       KSKKPAVKKPAVKKTKQVKKTAKKKK---------
LON_UNCTG       RNGENGI----------------------------
LON_FERNB       ---KESRKGRTRKGNSNTK----------------
LON_PSELT       -----------------------------------
LON_COPPD       -----------------------------------
LON1_THET2      ---PPAVQPDRPQPGVGA-----------------
LON_AQUAE       --KEA------------------------------
LON_SULSY       --ENQESES--------------------------
LON_GEOLS       --PKGKAKPATPKVVVRPSKEISA-----------
LON_GEOMG       --PASEGKPAATVKAP-PRRGIAAPRKGAMAGAKS
LON2_BDEBA      ----GQEKKPAAKKDPKKTKSLAA-----------
LON_DESAL       --APPKKKPPKKAAKPKAKKTQPKAKTTEAADK--
LON_LAWIP       --TKKKQTKQPTS----------------------
LON_CHLAD       --NNQNGSHTNNRGQPSPAPAGT------------
LON2_HERA2      --GSQHTSDGDQTSVVLPTITQPQLGSVEL-----
LON_KORVE       --KQDARTRAEVLNEVPAV----------------
LON1_HERA2      --PVSVPESAVMPNLFQSDVEVLVH----------
LON_DESOH       --KKKKTPAKSKKSTKPAAKKTAARKSRK------
LON_SYNAS       -----------------------------------
LON2_SYNFM      -------PRQGGSSPRS------------------
LON_DICT6       ----AEQRNPERIG---------------------
LON_ROSCS       --TLAEPAPPDGAGTVQAT----------------
LON_GEOBB       --TAATSARTPAGAPPPQ-----------------
LON2_PELCD      --PRLFDCPQHLAVDPPSGS---------------
LON_ANADE       KPGATPTPPAKKPDEIRV-----------------
LON2_MYXXA      GKEAPLPKPAESAPEVRA-----------------
LON2_SORC5      AQSASPEELEEQAGV--------------------
LON4_SORC5      VTGAAAGEPAAAA----------------------
LON_METSB       -MAATPAPN--------------------------
LON_PHEZH       -RRGDVRQTQVRAAS--------------------
LON_PARPJ       -ESVTSSRNVDI-----------------------
LON_MYCSM       -AAAA------------------------------
LON_SALAI       -SLDGEALATA------------------------
LON_CHLAA       -TLTVAQRSDVLTPAS-------------------
LON_DEIRA       GRKTGRRSPEARA----------------------
LON2_THET2      SR-SARRKKELVAHA--------------------
LON1_SORC5      ---APEEMPHARAS---------------------
LON_NITOC       -----------------------------------
LON_FUSNN       -----------------------------------
LON_MYCA5       -----------------------------------
LON_MYCMO       TH---------------------------------
LON_MYCH2       -----------------------------------
LON_MYCGE       -----------------------------------
LON_MYCPN       -----------------------------------
LON_MYCPE       -----------------------------------
LON_UREP2       -----------------------------------
LON_MYCMS       -----------------------------------
LON_AYWBP       -----------------------------------