CLUSTAL format seed alignment for MF_01974

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MAP1_HELPY        ------------------------------------------------------------
MAP1_HELPJ        ------------------------------------------------------------
MAP1_ALKHC        ------------------------------------------------------------
MAP11_BACSU       ------------------------------------------------------------
MAP13_SYNY3       ------------------------------------------------------------
MAP1_CLOAB        ------------------------------------------------------------
MAP1_CLOPE        ------------------------------------------------------------
MAP11_MYCTU       ------------------------------------------------------------
MAP1_BORBU        ------------------------------------------------------------
MAP1_TREPA        ------------------------------------------------------------
MAP1_ECO57        ------------------------------------------------------------
MAP1_ECOL6        ------------------------------------------------------------
MAP1_SHIFL        ------------------------------------------------------------
MAP1_ECOLI        ------------------------------------------------------------
MAP1_SALTI        ------------------------------------------------------------
MAP1_SALTY        ------------------------------------------------------------
MAP1_HAEIN        ------------------------------------------------------------
MAP1_BUCAI        ------------------------------------------------------------
MAP1_BUCAP        ------------------------------------------------------------
MAP1_BUCBP        ------------------------------------------------------------
MAP1_RICPR        ------------------------------------------------------------
MAP11_SYNY3       ------------------------------------------------------------
MAP12_SYNY3       ------------------------------------------------------------
MAP1_YEAST        MSTATTTVTTSDQASHPTKIYCSGLQCGRETSSQMKCPVCLKQGIVS---IFCDTSCYEN
MAP1_SCHPO        ------------MATEIAKHICCGIDCNNE-ADRLQCPKCLNDGVKS---YFCGQECFRN
MAP11_HUMAN       -------------MAAVETRVCETDGCSSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP1_PONAB        -------------MAAVETRVCETDGCSSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP11_MOUSE       -------------MAAVETRVCETDGCSSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP1_BOVIN        -------------MAAVETRVCETDGCSSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP1_CHICK        -------------MAAVETRVCETAGCSSE--AKLQCPTCLKLGIQG--SYFCSQECFKG
MAP1_XENLA        -------------MAAVESRVCETEGCSSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP1_XENTR        -------------MAAVESRVCETEGCSSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP11_DANRE       -------------MAAVETRECETEGCHSE--AKLQCPTCIKLGIQG--SYFCSQECFKG
MAP11_DICDI       ----------------MEGILCASPGCGKP--AKLQCPTCVNLKLETP-SHFCSQECFKT
MAP1A_ARATH       -------MASESDASSIATLSCA--RCEKP--AHLQCPKCIDLKLPREQASFCTQECFKA
MAP1_MYCBO        ----------------------------------MPSRTALSPGVLS-------------
MAP12_MYCTU       ----------------------------------MPSRTALSPGVLS-------------
MAP12_HUMAN       ----------------MAAPSGVHLLVR--RGSHRIFSSPLNHIYLHKQSSSQQRRNF--
MAP12_MOUSE       ----------------MAAPIGVPLLVR--GGCQRILSSPLNHIYLHKRSGSQQRRHF--
MAP12_DANRE       ----------------MAAPCAAQCLYR--TGGLRLLQRISRLPHCHKDASLAHQCQFHR
MAP1B_ARATH       -------MASSVFLSSFSSSSSLQLCSSFHGEYLAPSRCFLGAPVTSSSLSLSGKKNSYS
MAP1C_ARATH       ------------MLQKISQ--SISLCN---GDQFKPLIYLAGAPTNFISSPLSGKKKSSS
MAP1D_ARATH       ----------MAGVKSLQPRLISSFLGNNSIRSTQPLIHLFRFDLGRRHVSMQLSRTFSG
MAP12_DICDI       ---MNKILKNIINKSSINNVFKTSFNGGISSSSSSSSSYLNNNNNIIKSYNVQQKQQQRY
MAP1_CHLMU        --------------------------------MKRNDPCWCG------------------
MAP1_CHLTR        --------------------------------MKRNDPCWCG------------------
MAP1_CHLPN        --------------------------------MKRNDPCWCG------------------
MAP1_STAAC        ------------------------------------------------------------
MAP1_STAAR        ------------------------------------------------------------
MAP1_STAAS        ------------------------------------------------------------
MAP1_STAA1        ------------------------------------------------------------
MAP1_STAAM        ------------------------------------------------------------
MAP1_STAAW        ------------------------------------------------------------
MAP1_STAAN        ------------------------------------------------------------
MAP1_STAES        ------------------------------------------------------------
MAP1_STAEQ        ------------------------------------------------------------
MAP12_BACSU       ------------------------------------------------------------
Q9CHV6_LACLA      ------------------------------------------------------------
Q8DPV1_STRR6      ------------------------------------------------------------
MAP1_AQUAE        ------------------------------------------------------------
MAP1_MYCCT        ------------------------------------------------------------
MAP1_MYCGE        ------------------------------------------------------------
MAP1_MYCPN        ------------------------------------------------------------
MAP1_MYCGA        ------------------------------------------------------------
                                                                              

MAP1_HELPY        ------------------------------------------------------------
MAP1_HELPJ        ------------------------------------------------------------
MAP1_ALKHC        ------------------------------------------------------------
MAP11_BACSU       ------------------------------------------------------------
MAP13_SYNY3       ---------------------------------------------------MPRIFPWKL
MAP1_CLOAB        ------------------------------------------------------------
MAP1_CLOPE        ------------------------------------------------------------
MAP11_MYCTU       ------------------------------------------------------------
MAP1_BORBU        ------------------------------------------------------------
MAP1_TREPA        ------------------------------------------------------------
MAP1_ECO57        ------------------------------------------------------------
MAP1_ECOL6        ------------------------------------------------------------
MAP1_SHIFL        ------------------------------------------------------------
MAP1_ECOLI        ------------------------------------------------------------
MAP1_SALTI        ------------------------------------------------------------
MAP1_SALTY        ------------------------------------------------------------
MAP1_HAEIN        ------------------------------------------------------------
MAP1_BUCAI        ------------------------------------------------------------
MAP1_BUCAP        ------------------------------------------------------------
MAP1_BUCBP        ------------------------------------------------------------
MAP1_RICPR        ------------------------------------------------------------
MAP11_SYNY3       ------------------------------------------------------------
MAP12_SYNY3       ------------------------------------------------------------
MAP1_YEAST        NYKAHKALH---NAKDGLEGAY------------------------------DPFPKFKY
MAP1_SCHPO        SWNIHKHLHRPPNVEKREDGTY------------------------------NPFPKFHF
MAP11_HUMAN       SWATHKLLHKKAKDEKAKREVS--------------------SWTVEGDINTDPWAGYRY
MAP1_PONAB        SWATHKLLHKKAKDEKAKREVS--------------------SWTVEGDINTDPWAGYRY
MAP11_MOUSE       SWATHKLLHKKAKDEKAKREVC--------------------SWTVEGDVNTDPWAGYRY
MAP1_BOVIN        SWATHKLLHKKAKDEKAKREVS--------------------SWTVEGDINTDPWAGYRY
MAP1_CHICK        SWATHKLLHKKAKDEKAKREVS--------------------SWTLEGDINTNPWSGYRY
MAP1_XENLA        SWATHKLLHKKAKDDKIKPEVS--------------------PWTMDGEVNTDPWPGYRY
MAP1_XENTR        SWASHKLLHKKAKDDKIKPETS--------------------PWTMDGDINTDPWPGYRY
MAP11_DANRE       SWATHKLLHKKAKEDKTNDEEK--------------------N-CVEKEVNTDPWPGYRY
MAP11_DICDI       FWPLHKMYHQKGQPENL----------------------------------PSQFRNYKF
MAP1A_ARATH       AWSSHKSVHVKAQLSSIGDQNSDLI------------SQGWLYCVKKGQARTPKLPHFDW
MAP1_MYCBO        ------------------------------------------------------------
MAP12_MYCTU       ------------------------------------------------------------
MAP12_HUMAN       -----------------------------------------------FFRRQ-----RDI
MAP12_MOUSE       -----------------------------------------------FFWRQ-----RDI
MAP12_DANRE       ----------------------------------------------SFFWRK-----PKT
MAP1B_ARATH       PRQFHVSA---------------------------KKVSGLEEAIRIRKMRELETKSKVR
MAP1C_ARATH       --------------------------------------------LRIKRIQQLQSTLEDR
MAP1D_ARATH       -------------------------------------------LTDLLFNRRNEDEVIDG
MAP12_DICDI       YSSFEDDLSPKKLKEKILENETEEIRDFVRSQRLTKKTASPLEGMNRKERRKMTTKLYRN
MAP1_CHLMU        ------------------------------------------------------------
MAP1_CHLTR        ------------------------------------------------------------
MAP1_CHLPN        ------------------------------------------------------------
MAP1_STAAC        ------------------------------------------------------------
MAP1_STAAR        ------------------------------------------------------------
MAP1_STAAS        ------------------------------------------------------------
MAP1_STAA1        ------------------------------------------------------------
MAP1_STAAM        ------------------------------------------------------------
MAP1_STAAW        ------------------------------------------------------------
MAP1_STAAN        ------------------------------------------------------------
MAP1_STAES        ------------------------------------------------------------
MAP1_STAEQ        ------------------------------------------------------------
MAP12_BACSU       ------------------------------------------------------------
Q9CHV6_LACLA      ------------------------------------------------------------
Q8DPV1_STRR6      ------------------------------------------------------------
MAP1_AQUAE        ------------------------------------------------------------
MAP1_MYCCT        ------------------------------------------------------------
MAP1_MYCGE        ------------------------------------------------------------
MAP1_MYCPN        ------------------------------------------------------------
MAP1_MYCGA        ------------------------------------------------------------
                                                                              

MAP1_HELPY        ------------------------------------------MAISIKSPKEIKALRKAG
MAP1_HELPJ        ------------------------------------------MAISIKSPKEIKALRKAG
MAP1_ALKHC        -------------------------------------------MIICKTERELEIMREAG
MAP11_BACSU       -------------------------------------------MIICKTPRELGIMREAG
MAP13_SYNY3       WRKSRPAWPRFLGTHPMNLLSQLFAPPSPVPSPTPKAKKRSRRGVQIKTPAEIAIMRQAG
MAP1_CLOAB        -------------------------------------------MIIIKNDTEIEYMRQAG
MAP1_CLOPE        -------------------------------------------MIILKNENEIDLMRKAG
MAP11_MYCTU       --------------------------------MRPLARLRGRRVVPQRSAGELDAMAAAG
MAP1_BORBU        -----------------------------------------MTKLRLKSKDEIKKIKASA
MAP1_TREPA        -------------------------------------------MIRIKTPEQIDGIRASC
MAP1_ECO57        ------------------------------------------MAISIKTPEDIEKMRVAG
MAP1_ECOL6        ------------------------------------------MAISIKTPEDIEKMRVAG
MAP1_SHIFL        ------------------------------------------MAISIKTPEDIEKMRVAG
MAP1_ECOLI        ------------------------------------------MAISIKTPEDIEKMRVAG
MAP1_SALTI        ------------------------------------------MAISIKTSEDIEKMRVAG
MAP1_SALTY        ------------------------------------------MAISIKTSEDIEKMRVAG
MAP1_HAEIN        ------------------------------------------MAIPIRTEKEIVKLREAC
MAP1_BUCAI        -----------------------------------------MSCI-IKTESEIKKMRISG
MAP1_BUCAP        -----------------------------------------MNCI-IKTESEIKKMKVSG
MAP1_BUCBP        -----------------------------------------MTCIFIKNINEINKMRLVG
MAP1_RICPR        ------------------------------------------MTIKIHTEKDFIKMRAAG
MAP11_SYNY3       ----------------------------------------MGDTITLLSRREIEKMRQAG
MAP12_SYNY3       -----------------------MNHQNLLSITRNLVHPPISSGLVLLSARELDKMRRVG
MAP1_YEAST        SGKVKASYPLTPRRYVPEDIPKPDWAANGLPVSEQRNDR--LNNIPIYKKDQIKKIRKAC
MAP1_SCHPO        AGSLKPVYPLSPIRKVPPHIKRPDYAKTGVSRSEQIEGR--SFKLKRLTPKEQEGMRKVC
MAP11_HUMAN       TGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVC
MAP1_PONAB        TGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVC
MAP11_MOUSE       TGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVC
MAP1_BOVIN        TGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVC
MAP1_CHICK        TGKLRPHYPLTPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKILSPEDIEGMRVVC
MAP1_XENLA        TGKLRPHYPLTPMRPVPSYIQRPDYADHPLGMSESEQTLKGTSQIKTLSPEDIEGMRVVC
MAP1_XENTR        TGKLRPHYPLTPMRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKILSTEDIEGMRVVC
MAP11_DANRE       TGKLRPYYPLTPMRLVPSNIQRPDYADHPLGMSESEQTMKGTSQIKILNAEEIEGMRVVC
MAP11_DICDI       TGPLRPTN-ITPMRKAPEGIELPDYAIGSIPISERVADRKNMANI-IHTPEEIEIMRQLG
MAP1A_ARATH       TGPL-KQYPISTKRVVPAEIEKPDWAIDGTPKVEPNSDLQHVVEI--KTPEQIQRMRETC
MAP1_MYCBO        -----------PTRPVPNWIARPEYVGKPAAQEGS--------EPWVQTPEVIEKMRVAG
MAP12_MYCTU       -----------PTRPVPNWIARPEYVGKPAAQEGS--------EPWVQTPEVIEKMRVAG
MAP12_HUMAN       SHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPD-------WGDSIEVKNEDQIQGLHQAC
MAP12_MOUSE       SHSVVSPAAVSPAHPVPKRIKKPDYVTTGIVPD-------WGDSIEVKDEDQIQGLREAC
MAP12_DANRE       SHSVVRPAIVRPAYPVPKHIQRPDYVSSSKVPE-------WPDYIEIKDEEQIQGLRRAC
MAP1B_ARATH       RNPPLRRGRVSPRLLVPDHIPRPPYVESGVLPD-------ISSEFQIPGPEGIAKMRAAC
MAP1C_ARATH       INPPLVCGTVSPRLSVPDHILKPLYVESSKVPE-------ISSELQIPDSIGIVKMKKAC
MAP1D_ARATH       KRKRLRPGNVSPRRPVPGHITKPPYVDSLQAPG-------ISSGLEVHDKKGIECMRASG
MAP12_DICDI       PDNLIRGGIVSPQPLIPAHIKKPKYVLGEPVIDFE-----IDDPIEIHTAESIEHMRVVG
MAP1_CHLMU        SQKKWKHCHYPTKPERPSDNLRQLYASR--------------YDIIIKTPDQIEKIRKAC
MAP1_CHLTR        SNKKWKHCHYPTKPERPLDNLRQLYASR--------------YDIIIKTPEQIEKIRKAC
MAP1_CHLPN        SGRKWKQCHYPQPPKMSPEALKQHYASQ--------------YNILLKTPEQKAKIYNAC
MAP1_STAAC        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAAR        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAAS        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAA1        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAAM        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAAW        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAAN        --------------------------------------------MIVKTEEELQALKEIG
MAP1_STAES        --------------------------------------------MIVKTDEELQALKEIG
MAP1_STAEQ        --------------------------------------------MIVKTDEELQALKEIG
MAP12_BACSU       --------------------------------------------MIVTNDQELEGLKKIG
Q9CHV6_LACLA      -------------------------------------------MITLKSQREIEQMERSS
Q8DPV1_STRR6      -------------------------------------------MITLKSAREIEAMDKAG
MAP1_AQUAE        ------------------------------------------MAIELYSQREIEKIRKAS
MAP1_MYCCT        -------------------------------------------MITIKNQEQIQKMKIAG
MAP1_MYCGE        -------------------------------------------MIYLKSANEVAGIKKAC
MAP1_MYCPN        -------------------------------------------MVYLKSAREVEQIRQAC
MAP1_MYCGA        -------------------------------------------MIYIKNPNEIQKIKNAA
                                                                         :    

MAP1_HELPY        ELTAQALALLEREVRPGVSLLELDKMAEDFIK-SSHARPAFKGLYG------FPNSVCMS
MAP1_HELPJ        ELTAQALALLEREVRPGVSLLELDKMAEDFIK-SSHARPAFKGLYG------FPNSVCMS
MAP1_ALKHC        RIVALTHQEIKLHIQPGITTKKLDEIAETFIR-SHGATPSFKGYNGFTG------SICAS
MAP11_BACSU       RIVALTHEELKKHIKPGISTKELDQIAERFIK-KQGAIPSFKGYNGFRG------SICVS
MAP13_SYNY3       AIAAQVLKEIAATVQPGMTTGDLDQLAEERIR-SLGATPSFKGYHGFPA------SICAC
MAP1_CLOAB        KIVGETLNMLEKAAKPGVTTADLDRLAEDFIK-KYNAIPSFKGYGGFPA------SICTS
MAP1_CLOPE        KILGETLNLLKEKVRPGITTTELDRIAEEFIT-KHGATPSFKGLYGFPA------SLCIS
MAP11_MYCTU       AVVAAALRAIRAAAAPGTSSLSLDEIAESVIR-ESGATPSFLGYHGYPA------SICAS
MAP1_BORBU        SLLALTLLEVERNIVPGISTKELDLIAYDFII-KNRAKPAFKGYRGFKG------TICAS
MAP1_TREPA        KALARLFDVLIPLVKPGVQTQELDAFCQRFIR-SVGGVPAWFS-EGFPA------AACIS
MAP1_ECO57        RLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHG------YPKSVCIS
MAP1_ECOL6        RLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHG------YPKSVCIS
MAP1_SHIFL        RLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHG------YPKSVCIS
MAP1_ECOLI        RLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHG------YPKSVCIS
MAP1_SALTI        RLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHG------YPKSVCIS
MAP1_SALTY        RLAAEVLEMIEPYIKPGVTTGELDRICNDYIVNEQHAISACLGYHG------YPKSVCIS
MAP1_HAEIN        KLASDVLVMIEPYVKAGVTTGELDRICHEYMVNEQKVIPACLNYHG------FPKATCIS
MAP1_BUCAI        KLAAEVLEMIKEHLQPKISTEDINQICHDYIVYKKKAISACLGYHG------FPKSICIS
MAP1_BUCAP        KIAAEVLEMIENYIKPNISTEEINNICHNFII-KKKAVSACLGYHG------FPKSICIS
MAP1_BUCBP        KLVADVLDMIKEYIVPGITTEELNNICHNYITYKQHAKPACLGYQG------FPKSICTS
MAP1_RICPR        KLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPAPLNYKG------FPKSICTS
MAP11_SYNY3       QLAAALLDHLAPMVQPGITTLELNDEAEKWTK-AHGAISAPLGYNG------FPKSICTS
MAP12_SYNY3       QLAANLLNHLESMVQPGVSTQALNDEATRWME-DHGAISATLGYAPPGYP-PFTGAICTS
MAP1_YEAST        MLGREVLDIAAAHVRPGITTDELDEIVHNETI-KRGAYPSPLNYYN------FPKSLCTS
MAP1_SCHPO        RLGREVLDAAAAAVRPGTTTDELDSIVHNACI-ERDCFPSTLNYYA------FPKSVCTS
MAP11_HUMAN       RLAREVLDVAAGMIKPGVTTEEIDHAVHLACI-ARNCYPSPLNYYN------FPKSCCTS
MAP1_PONAB        RLAREVLDIAAGMIKPGVTTEEIDHAVHLACI-ARNCYPSPLNYYN------FPKSCCTS
MAP11_MOUSE       RLAREVLDIAAGMIKAGVTTEEIDHAVHLACI-ARNCYPSPLNYYN------FPKSCCTS
MAP1_BOVIN        RLAREVLDIAAGLIKPGVTTEEIDHAVHLACI-ARNCYPSPLNYYN------FPKSCCTS
MAP1_CHICK        RLAREVLDVAAMMVKAGVTTEEIDHAVHLACI-ARNCYPSPLNYYN------FPKSCCTS
MAP1_XENLA        RLAREVLGVAAMMVKSGITTEEIDHAVHLACI-SRNCYPSPLNYYN------FPKSCCTS
MAP1_XENTR        RLAREVLGVAAMMVKSGITTEEIDHAVHLACI-SRNCYPSPLNYYN------FPKSCCTS
MAP11_DANRE       KLAREVLDIAAMMVKPGVTTEEIDHAVHLACT-ARNCYPSPLNYYN------FPKSCCTS
MAP11_DICDI       KMSREVLDIAGNAAKVGMTTEELDIIVHNAVI-ERGAYPSPLNYYK------FPKSCCTS
MAP1A_ARATH       KIAREVLDAAARVIHPGVTTDEIDRVVHEATI-AAGGYPSPLNYYF------FPKSCCTS
MAP1_MYCBO        RIAAGALAEAGKAVAPGVTTDELDRIAHEYLV-DNGAYPSTLGYKG------FPKSCCTS
MAP12_MYCTU       RIAAGALAEAGKAVAPGVTTDELDRIAHEYLV-DNGAYPSTLGYKG------FPKSCCTS
MAP12_HUMAN       QLARHVLLLAGKSLKVDMTTEEIDALVHREII-SHNAYPSPLGYGG------FPKSVCTS
MAP12_MOUSE       RLARHVLLLAGKSLKVDMTTEEIDALVHWEII-RHDAYPSPLGYGR------FPKSVCTS
MAP12_DANRE       QLARHILLLTGNSLKVGMTTDEIDFIVHQEAI-RHNGYPSPLHYGG------FPKSVCTS
MAP1B_ARATH       ELAARVLNYAGTLVKPSVTTNEIDKAVHDMII-EAGAYPSPLGYGG------FPKSVCTS
MAP1C_ARATH       ELAARVLDYAGTLVRPFVTTDEIDKAVHQMVI-EFGAYPSPLGYGG------FPKSVCTS
MAP1D_ARATH       ILAARVRDYAGTLVKPGVTTDEIDEAVHNMII-ENGAYPSPLGYGG------FPKSVCTS
MAP12_DICDI       KMAKEVLEYAGTLVRPGITTDEIDKLVHQNII-DRGAYPSPLGYKG------FPKSICTS
MAP1_CHLMU        QVTARILDALCKAAKEGVTTNELDQLSCNLHK-QYNAIPAPLNYGQP----PFPKTICTS
MAP1_CHLTR        QVTAHILDALCEAAKEGVTTNELDLLSRELHK-RHNAIPAPLNYGHP----PFPKTICTS
MAP1_CHLPN        QITARILDELCKASQKGVTTNELDELSQELHK-KYDAIAAPFHYGSP----PFPKTICTS
MAP1_STAAC        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAAR        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAAS        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAA1        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAAM        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAAW        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAAN        YICAKVRNTMQAATKPGITTKELDNIAKELFE-EYGAISAPIHDEN------FPGQTCIS
MAP1_STAES        YICAKVRDTMKEATKPGVTTRELDHIAKDLFE-EHGAISAPIHDEN------FPGQTCIS
MAP1_STAEQ        YICAKVRDTMKEATKPGVTTRELDHIAKDLFE-EHGAISAPIHDEN------FPGQTCIS
MAP12_BACSU       RIVALAREEMKRKAEPGMSTKDLDLIGKAVLD-EHGAVSAPEKEYD------FPGVTCIS
Q9CHV6_LACLA      KILADIHIGLRELIKPGIDMWEIEEYVRKVCK-EKNVLPLQIGVDE-GNYNPFPYATCCC
Q8DPV1_STRR6      DFLASIHIGLRDLIKPGVDMWEVEEYVRRRCK-EENFLPLQIGVD--GAMMDYPYATCCS
MAP1_AQUAE        QIVAEVLHIVAENVKPGVSTWDLEMIARKETE-KRGAKPAFLGYKPPFSDVRYPAALCIS
MAP1_MYCCT        QVLAKGLNLLKSMIKPGVNCLDLDKAFEEFIK-QNGCESNFKNYQG------FPKTICIS
MAP1_MYCGE        AIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIE-QKQAKCAFHGYLG------FPGFNCLS
MAP1_MYCPN        KIFQEAKAYFTIERLLGKSLTAIDQALKQFIE-SKGATCAFHKYQN------FPGFNCLS
MAP1_MYCGA        QIYKKIVKQFNFDYIKNKSLKEIDQMLRDFVS-QHHANSCYHGYLG------FKGYHCLS
                                        ::                                 * .

MAP1_HELPY        LNEVVIHGIPTD-YVLQEGDIIGLDL---------------------------GVEVDGY
MAP1_HELPJ        LNEVVIHGIPTD-YVLQEGDIIGLDL---------------------------GVEVDGY
MAP1_ALKHC        VNEELVHGIPGNR-VLKEGDIISVDI---------------------------GAKYNGY
MAP11_BACSU       VNEELVHGIPGSR-VLKDGDIISIDI---------------------------GAKLNGY
MAP13_SYNY3       VNNEVVHGIPRRRKKIRSGDLLKVDT---------------------------GAYFQGY
MAP1_CLOAB        INEEVIHGIPSKHRVLHEGDIISVDC---------------------------GAILNGY
MAP1_CLOPE        VNNQVIHGFPGSYE-LKDGDIVSIDC---------------------------GVCLNGF
MAP11_MYCTU       INDRVVHGIPSTAEVLAPGDLVSIDC---------------------------GAVLDGW
MAP1_BORBU        VNEEVIHGIPGKR-KLADGDIVSIDC---------------------------GVILDGF
MAP1_TREPA        INEEVIHGLPSAR-VIQDGDLVSLDV---------------------------GINLNGY
MAP1_ECO57        INEVVCHGIPDDAKLLKDGDIVNIDV---------------------------TVIKDGF
MAP1_ECOL6        INEVVCHGIPDDAKLLKDGDIVNIDV---------------------------TVIKDGF
MAP1_SHIFL        INEVVCHGIPDDAKLLKDGDIVNIDV---------------------------TVIKDGF
MAP1_ECOLI        INEVVCHGIPDDAKLLKDGDIVNIDV---------------------------TVIKDGF
MAP1_SALTI        INEVVCHGIPDDAKHLKDGDIVNIDV---------------------------TVIKDEF
MAP1_SALTY        INEVVCHGIPDDAKHLKDGDIVNIDV---------------------------TVIKDEF
MAP1_HAEIN        INEVVCHGIPSDDKVLKNGDIVNIDV---------------------------TVIKDGY
MAP1_BUCAI        INDVVCHGIPSKNQVFKEGDIVNIDI---------------------------AIIKDGY
MAP1_BUCAP        VNDVVCHGIPNKNQILKSGDIVNIDV---------------------------TIIKKNY
MAP1_BUCBP        INDIVCHGIPNKNSILKNGDIINIDV---------------------------AILKDKY
MAP1_RICPR        INHVVCHGIPND-KPLKNGDIVNIDV---------------------------TVILDGW
MAP11_SYNY3       INEVICHGIPHRKRVLQAGDIINVDV---------------------------TPIVDGY
MAP12_SYNY3       INEVVCHGIPNPKQILKDGDIINIDV---------------------------TLRLAGY
MAP1_YEAST        VNEVICHGVPDK-TVLKEGDIVNLDV---------------------------SLYYQGY
MAP1_SCHPO        VNEIICHGIPDQ-RPLEDGDIVNIDV---------------------------SLYHNGF
MAP11_HUMAN       VNEVICHGIPDR-RPLQEGDIVNVDI---------------------------TLYRNGY
MAP1_PONAB        VNEVICHGIPDR-RPLQEGDIVNVDI---------------------------TLYRNGY
MAP11_MOUSE       VNEVICHGIPDR-RPLQEGDIVNVDI---------------------------TLYRNGY
MAP1_BOVIN        VNEVICHGIPDR-RPLQEGDIVNVDI---------------------------TLYRNGY
MAP1_CHICK        VNEVICHGIPDR-RPLQEGDIVNVDI---------------------------TVYRNGY
MAP1_XENLA        VNEVICHGIPDR-RPLQDGDIVNVDI---------------------------TVYRDGY
MAP1_XENTR        VNEVICHGIPDR-RPLQDGDIVNVDI---------------------------TVYRDGY
MAP11_DANRE       VNEVICHGIPDR-RHLQEGDILNIDI---------------------------TVYHNGY
MAP11_DICDI       LNEVICHGIPDE-RPLRDGDILNVDV---------------------------TLYWKGF
MAP1A_ARATH       VNEVICHGIPDA-RKLEDGDIVNVDV---------------------------TVCYKGC
MAP1_MYCBO        LNEVICHGIPDS-TVITDGDIVNIDV---------------------------TAYIGGV
MAP12_MYCTU       LNEVICHGIPDS-TVITDGDIVNIDV---------------------------TAYIGGV
MAP12_HUMAN       VNNVLCHGIPDS-RPLQDGDIINIDV---------------------------TVYYNGY
MAP12_MOUSE       VNNVLCHGIPDS-RPLQDGDIINIDV---------------------------TVYYNGY
MAP12_DANRE       VNNVVCHGIPDS-RPLQDGDIINIDV---------------------------TVYLEGY
MAP1B_ARATH       VNECMCHGIPDS-RQLQSGDIINIDV---------------------------TVYLDGY
MAP1C_ARATH       VNECMFHGIPDS-RPLQNGDIINIDV---------------------------AVYLDGY
MAP1D_ARATH       VNECICHGIPDS-RPLEDGDIINIDV---------------------------TVYLNGY
MAP12_DICDI       INEVLCHGIPDD-RPLEFGDIVKIDV---------------------------TLYYNGY
MAP1_CHLMU        LNEVICHGIPND-TPLQNGDIMNIDV---------------------------SCIVDGF
MAP1_CHLTR        LNEVICHGIPND-IPLQNGDIMNIDV---------------------------SCIVDGF
MAP1_CHLPN        LNEVICHGIPND-IPLKDGDIMNIDV---------------------------SCIVDGY
MAP1_STAAC        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAAR        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAAS        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAA1        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAAM        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAAW        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAAN        VNEEVAHGIPSK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAES        VNEEVAHGIPGK-RVIREGDLVNIDV---------------------------SALKNGY
MAP1_STAEQ        VNEEVAHGIPGK-RVIHEGDLVNIDV---------------------------SALKNGY
MAP12_BACSU       VNDEVAHGIPSTSKILKAGDLVNIDI---------------------------SAEFGGF
Q9CHV6_LACLA      LNDEVAHAFPRH-QILKDGDLIKVDMVLG-LVEDGSVDVSKLNFDDAESMVKYQEEFRGG
Q8DPV1_STRR6      LNDEVAHAFPRH-YILKDGDLLKVDMVLGGPIAKSDLNVSKLNFNNVEQMKKYTQSYSGG
MAP1_AQUAE        INDEVVHGLPKKEKVIKEGDVVSID---------------------------FGAIYDGY
MAP1_MYCCT        INDQLIHGIPRD-RVLLDGDVVSIDA---------------------------GCMYEKW
MAP1_MYCGE        LNQTVIHGVADQ-TVFKDSDKLTLDI---------------------------GIDYHGY
MAP1_MYCPN        LNETVIHGIADN-RVFGVKDKLTLDI---------------------------GINLNGY
MAP1_MYCGA        LNQTIIHGLAND-EIFTSKDKLTIDI---------------------------GIELDNY
                  :*. : *...     :   * : :*                                   

MAP1_HELPY        YGDSALTLPIGAIS---PQDEKLLACSKESLMHAINSIR-VGMHFKELSQILESTIT---
MAP1_HELPJ        YGDSALTLPIGAIS---PQDEKLLACSKESLMHAISSIR-VGMHFKELSQILEGAIT---
MAP1_ALKHC        HGDSAWTYAVGNIS---DEDQDLLDVTETSLYKGLEQAK-AGARLSDISHAIQSYAEPR-
MAP11_BACSU       HGDSAWTYPVGNIS---DDDKKLLEVTEESLYKGLQEAK-PGERLSNISHAIQTYVENE-
MAP13_SYNY3       HGDSCITIAVGKVS---PQAQRLMEVAEGALYAGIEQVK-PGNYLMDIAGAIEDYVKPT-
MAP1_CLOAB        QGDAARTFAIGEIS---EEAAKLIKVTKESFFKGVEKAV-IGNRLTDISHSIQEYVESF-
MAP1_CLOPE        HSDAARTFGVGNIS---EEAEKLIRITEESFFKGIEKAY-VDNRLTDISNEIQQYVEAN-
MAP11_MYCTU       HGDAAITFGVGALS---DADEALSEATRESLQAGIAAMV-VGNRLTDVAHAIETGTRAAE
MAP1_BORBU        YSDMAKTFKVGNVD---SSIDKLLEVTNASLYKGIAEMK-VGNRILNISKAIEDYIKPF-
MAP1_TREPA        ISDACRTVPVGGVA---HERLELLRVTTECLRAGIKACR-AGARVRAVSRAVYAVAARH-
MAP1_ECO57        HGDTSKMFIVGKPT---IMGERLCRITQESLYLALRMVK-PGINLREIGAAIQKFVE---
MAP1_ECOL6        HGDTSKMFIVGKPT---IMGERLCRITQESLYLALRMVK-PGINLREIGAAIQKFVE---
MAP1_SHIFL        HGDTSKMFIVGKPT---IMGERLCRITQESLYLALRMVK-PGINLREIGAAIQKFVE---
MAP1_ECOLI        HGDTSKMFIVGKPT---IMGERLCRITQESLYLALRMVK-PGINLREIGAAIQKFVE---
MAP1_SALTI        HGDTSKMFIVGKPT---ILGERLCRVTQESLYLGIKMVK-PGIRLRTIGAAIQKYAE---
MAP1_SALTY        HGDTSKMFIVGKPT---ILGERLCRVTQESLYLGIKMVK-PGIRLRTIGAAIQKYAE---
MAP1_HAEIN        FGDNSKMYIVGGETN--IRSKKLVEAAQEALYVGIRTVK-PDIRLNEIGKAVQKYTE---
MAP1_BUCAI        HGDTSKMFYIGKTS---ILSKRLCQVARESLYLSLKLVK-PGIPLYKIGEIIQNYVE---
MAP1_BUCAP        HADTSKMFLVGQTN---ILSQRLCKIAQESLYKSLNILK-PGIPLYKIGEVIQNYVE---
MAP1_BUCBP        YSDASKMFFVGKPT---ELGKKLCYVAKKSLYLALYTIR-PGINLQKLGKVIQNYVK---
MAP1_RICPR        YGDTSRMYYVGDVA---IKPKRLIQVTYDAMMKGIEVVR-PGAKLGDIGYAIQSYAE---
MAP11_SYNY3       HGDCSRTFFVGTPS---PVAEKLVKVTEECLRLGIEAVK-PGGKIGDIGAAIQSHAE---
MAP12_SYNY3       HGDTSRTFLVGSVS---ATARKLVEATQESMMRGIAEIK-PGARIGDIGAAIQAYAE---
MAP1_YEAST        HADLNETYYVGENI--SKEALNTTETSRECLKLAIKMCK-PGTTFQELGDHIEKHA----
MAP1_SCHPO        HGDLNETYYVGDKAKANPDLVCLVENTRIALDKAIAAVK-PGVLFQEFGNIIEKHTNSI-
MAP11_HUMAN       HGDLNETFFVGEVD---DGARKLVQTTYECLMQAIDAVK-PGVRYRELGNIIQKHAQ---
MAP1_PONAB        HGDLNETFFVGEVD---DGARKLVQTTYECLMQAIDAVK-PGVRYRELGNIIQKHAQ---
MAP11_MOUSE       HGDLNETFFVGDVD---EGARKLVQTTYECLMQAIDAVK-PGVRYRELGNIIQKHAQ---
MAP1_BOVIN        HGDLNETFFVGDVD---EGARKLVQTTYECLMQAIDAVK-PGVRYRELGNIIQKHAQ---
MAP1_CHICK        HGDLNETFYVGEVD---EGAKRLVQTTYECLMQAIDAVK-PGVRYRELGNIIQKHAQ---
MAP1_XENLA        HGDLNETFYVGDVD---EGAKRLVETTYECLMQAIDEVK-PGVRYRELGNIIQKHAQ---
MAP1_XENTR        HGDLNETFYVGDVD---EGAKRLVETTYECLMQAIDEVK-PGVRYRELGNIIQKHAQ---
MAP11_DANRE       HGDLNETFFVGEVD---EGAKRLVQTTYECLMQAIDSVK-PGIRYRELGNIIQKHAQ---
MAP11_DICDI       HSDLNETYLIGNVD---ERGKNLVKCAYDCLELAVAMCK-PGTLYRELGDAIQKHAN---
MAP1A_ARATH       HGDLNETYFVGNVD---EASRQLVKCTYECLEKAIAIVK-PGVRFREIGEIVNRHAT---
MAP1_MYCBO        HGDTNATFPAGDVA---DEHRLLVDRTREATMRAINTVK-PGRALSVIGRVIESYAN---
MAP12_MYCTU       HGDTNATFPAGDVA---DEHRLLVDRTREATMRAINTVK-PGRALSVIGRVIESYAN---
MAP12_HUMAN       HGDTSETFLVGNVD---ECGKKLVEVARRCRDEAIAACR-AGAPFSVIGNTISHITH---
MAP12_MOUSE       HGDTSETFLVGNVD---ESGKKLVEVARRCRDEAIAACR-AGAPFSVIGNTISRITH---
MAP12_DANRE       HGDTSETFLIGSVN---DQGRKLVDVARQCRDQAIAACG-PGQPLCVIGNIISNIAN---
MAP1B_ARATH       HGDTSRTFFCGEVD---EGFKRLVKVTEECLERGIAVCK-DGASFKKIGKRISEHAE---
MAP1C_ARATH       HGDTSKTFLCGDVN---GSLKQLVKVTEECLEKGISVCK-DGASFKQIGKIISEHAA---
MAP1D_ARATH       HGDTSATFFCGNVD---EKAKKLVEVTKESLDKAISICG-PGVEYKKIGKVIHDLAD---
MAP12_DICDI       HGDTCATFPVGEID---SSSKRLIEATEKALYAAIGEVK-DGALFNKIGKKIQLVAN---
MAP1_CHLMU        YGDCSRMVMIGEVP---EIKKKVCEASLEALNAAIAILE-PNLPLYEIGEVIENCAA---
MAP1_CHLTR        YGDCSRMVMIGEVS---EIKRKVCEASLEALNAAISILE-PNLPLYEIGEVIENCAA---
MAP1_CHLPN        YGDCSRMVMIGEVP---EIKKKICQAALECLNDSIAILK-PGIPLCEIGEAIEARAD---
MAP1_STAAC        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAAR        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAAS        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAA1        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAAM        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAAW        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAAN        YADTGISFVVGESDDP--MKQKVCDVATMAFENAIAKVK-PGTKLSNIGKAVHNTAR---
MAP1_STAES        YADTGISFVVGKSDQP--LKQKVCDVATMAFENAMKKVK-PGTKLSNIGKAVHATAR---
MAP1_STAEQ        YADTGISFVVGKSDQP--LKQKVCDVATMAFENAMKKVK-PGTKLSNIGKAVHATAR---
MAP12_BACSU       YSDTGISFVLGEGEE---RLHKLCQCAENAFQKGLQQAK-AGKRQNQIGRAVYHEAR---
Q9CHV6_LACLA      VADSCWAYAVGQVSD---EVKNLMDVTRECLYLGIEQAK-VGNRIGDIGAAIQEYAE---
Q8DPV1_STRR6      LADSCWAYAVGTPSE---EVKNLMDVTKEAMYKGIEQAV-VGNRIGDIGAAIQEYAE---
MAP1_AQUAE        AGDSAITVIAGKGSP---EAQKLLEATKEALYNAIEKAL-PGKKVGDITKAIHETAE---
MAP1_MYCCT        HADSAFTMVCGIAKN--KKNDILIRVTEEALELAIAELK-PGIRVGTIGSIIQNYVE---
MAP1_MYCGE        LCDAAFTLLGNKAD---PKAVKLLNDVEQAFSKVIEPELFVNNPIGNLSNAIQTYFE---
MAP1_MYCPN        ICDAAFTVLGPKAP---EPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFE---
MAP1_MYCGA        YCDSAFTILGPDVN---PRQKLLSEVTHNCIFELVKKIVPNQTTTNDLGIWTEEYAK---
                    *                          .    :            .            

MAP1_HELPY        ---ERGFVPLKGFCGHGIGKKPHEEP-EIPNYLEKGVKPNSGPKIKEGMVFCLEPMVCQK
MAP1_HELPJ        ---ERGFVPLKGFCGHGIGKKPHEEP-EIPNYLEKGVKANSGPKIKEGMVFCLEPMVCQK
MAP1_ALKHC        -----GYAIVREYVGHGVGQNLHEDP-QIPHYGPPG----KGPRLKPGMVLAIEPMVNAG
MAP11_BACSU       -----QFSVVREYVGHGVGQDLHEDP-QIPHYGPPN----KGPRLKPGMVLAIEPMVNAG
MAP13_SYNY3       -----GYTIVEEFTGHGVGQALHEDP-HVFNVRCRDL---PNVKLKPGMTLAIEPIVNAG
MAP1_CLOAB        -----GYGVVRDYVGHGIGKEMHEDP-EVPNYGRPG----RGPKLVHGMVLAIEPMVDVG
MAP1_CLOPE        -----GFSVVRDFVGHGIGRKVHEDP-EVPNFGRPG----RGPKLMAGMVLAIEPMVNMG
MAP11_MYCTU       LRYGRSFGIVAGYGGHGIGRQMHMDP-FLPNEGAPG----RGPLLAAGSVLAIEPMLTLG
MAP1_BORBU        -----GFGIVREYTGHGVGFELHEEP-SVPNYYAPFF---KNIRIQEGMVLAIEPMVNLR
MAP1_TREPA        -----RFGVVYEYCGHGVGLAVHEEP-NIPNVPGLEG---PNPRFLPGMVVAIEPMLTLG
MAP1_ECO57        ---AEGFSVVREYCGHGIGRGFHEEP-QVLHYD-SRE---TNVVLKPGMTFTIEPMVNAG
MAP1_ECOL6        ---AEGFSVVREYCGHGIGRGFHEEP-QVLHYD-SRE---TNVVLKPGMTFTIEPMVNAG
MAP1_SHIFL        ---AEGFSVVREYCGHGIGRGFHEEP-QVLHYD-SRE---TNVVLKPGMTFTIEPMVNAG
MAP1_ECOLI        ---AEGFSVVREYCGHGIGRGFHEEP-QVLHYD-SRE---TNVVLKPGMTFTIEPMVNAG
MAP1_SALTI        ---GEGFSVVREYCGHGIGRGFHEEP-QVLHYD-ADD---GGVVLQPGMTFTIEPMLNAG
MAP1_SALTY        ---GEGFSVVREYCGHGIGRGFHEEP-QVLHYD-ADD---GGVVLQPGMTFTIEPMLNAG
MAP1_HAEIN        ---SQTFSVVREYCGHGVGTEFHCEP-QVLHYY-ADD---GGVILKPGMVFTIEPMINAG
MAP1_BUCAI        ---SNNFSVVKEYCGHGIGRNFHEEP-HVLHYK-NKK---NNIILKKGMIFTIEPMINSG
MAP1_BUCAP        ---NNNFSVVKEYCGHGIGRAFHEEP-YVLHYK-NK----SHVILEKGMIFTIEPMINAG
MAP1_BUCBP        ---KQNFSIVKEYCGHGIGRSFHEPP-QILHHNYYKS---NTTILQSGMTFTVEPMINSG
MAP1_RICPR        ---KHNYSVVRDYTGHGIGRVFHDKP-SILNYG-RNG---TGLTLKEGMFFTVEPMINAG
MAP11_SYNY3       ---AQGFSVVRDFVGHGISKIFHTAP-QIPHYG-KAG---KGKRLRPGMVFTIEPMINEG
MAP12_SYNY3       ---ASGFSVVRDMVGHGIGRQMHTEL-QIPHYG-KRG---SGLKLRPGMVFTVEPMLNEG
MAP1_YEAST        --TENKCSVVRTYCGHGVGEFFHCSP-NIPHYAKNR----TPGVMKPGMVFTIEPMINEG
MAP1_SCHPO        --TEKQISVVRTYCGHGINQLFHCSP-SIPHYSHNK----APGIARPGMTFTIEPMLTLG
MAP11_HUMAN       ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNK----AVGVMKSGHVFTIEPMICEG
MAP1_PONAB        ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNK----AVGVMKSGHVFTIEPMICEG
MAP11_MOUSE       ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNK----AVGVMKSGHVFTIEPMICEG
MAP1_BOVIN        ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYSKNK----AVGVMKAGHVFTIEPMICEG
MAP1_CHICK        ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNK----AVGVMKPGHVFTIEPMICEG
MAP1_XENLA        ---ANGFSIVRSYCGHGIHKLFHTAP-NVPHYGKNK----AVGVMKPGHVFTIEPMICEG
MAP1_XENTR        ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNK----AVGVMKPGHVFTIEPMICEG
MAP11_DANRE       ---ANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNK----AVGVMKPGHVFTIEPMICEG
MAP11_DICDI       ---KQGFSVVKNFCGHGIGRLFHCNP-TVPHYSKNK----AVGAMKVGHVFTIEPMINEG
MAP1A_ARATH       ---MSGLSVVRSYCGHGIGDLFHCAP-NIPHYARNK----AVGVMKAGQTFTIEPMINAG
MAP1_MYCBO        ---RFGYNVVRDFTGHGIGTTFHNGL-VVLHYDQPA----VETIMQPGMTFTIEPMINLG
MAP12_MYCTU       ---RFGYNVVRDFTGHGIGTTFHNGL-VVLHYDQPA----VETIMQPGMTFTIEPMINLG
MAP12_HUMAN       ---QNGFQVCPHFVGHGIGSYFHGHP-EIWHHAND-----SDLPMEEGMAFTIEPIITEG
MAP12_MOUSE       ---QNGLQVCPHFVGHGIGSYFHGHP-EIWHHAND-----NDLPMEEGMAFTIEPIITEG
MAP12_DANRE       ---SNGFRVCPYFIGHGIGEYFHGHP-EIWHHAND-----NDLKMEEGMSFTIEPILMEG
MAP1B_ARATH       ---KFGYNVVERFVGHGVGPVFHSEP-LIYHYRND-----EPGLMVEGQTFTIEPILTIG
MAP1C_ARATH       ---KYGYNM-ERFIGHGVGTVLHSEP-LIYLHSNYDY---ELEYMIEGQTFTLEPILTIG
MAP1D_ARATH       ---KHKYGVVRQFVGHGVGSVFHADP-VVLHFRNN-----EAGRMVLNQTFTIEPMLTIG
MAP12_DICDI       ---KYSLSVTPEFTGHGIGQLFHTAP-FVFQCANE-----FDSVMKEGMIFTIEPVLVES
MAP1_CHLMU        ---RYGFSVVDQFVGHGVGVRFHENP-YVAHHRNSC-----KIPLAPGMTFTIEPMINVG
MAP1_CHLTR        ---KYGFSVVDQFVGHGVGVKFHENP-FVAHHRNSC-----KIPLAPGMIFTIEPMINVG
MAP1_CHLPN        ---TYGFSVVDQFVGHGVGIEFHENP-YVPHYRNRS-----MIPLAPGMIFTIEPMINVG
MAP1_STAAC        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAAR        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAAS        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAA1        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAAM        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAAW        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAAN        ---QNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKD---K-TLLTEGMVLAIEPFISSN
MAP1_STAES        ---QNDLTVIKNLTGHGVGQSLHEAPNHVMNYFDPKD---K-TLLKEGQVIAVEPFISTH
MAP1_STAEQ        ---QNDLTVIKNLTGHGVGQSLHEAPNHVMNYFDPKD---K-TLLKEGQVIAVEPFISTH
MAP12_BACSU       ---SQGFTVIKTLTGHGIGRSLHEAPNHIMNYYDPFD---N-ALFKNGTVIALEPFISTK
Q9CHV6_LACLA      ---SRGYGVVRDLVGHGVGPTMHEEPMVPHY--GRAG---RGLRLREGMVLTIEPMINTG
Q8DPV1_STRR6      ---SRGYGVVRDLVGHGVGPTMHEEPMVPNY--GIAG---RGLRLREGMVLTIEPMINTG
MAP1_AQUAE        ---KYGFKTILRYGGHGVGRKVHQEPFVPNNVKDIGK---KNPRLRQGMVIAIEPMLSIG
MAP1_MYCCT        ---SFDFSVPRDYTGHGIGLALHEDP-YIPNYGIPN----TGIRLQEGMVICIEPMVQMG
MAP1_MYCGE        ---NKGYFLVKEFGGHGCGIKIHEDP-LILNWGEKNQ----GVRLQEGMVICIEPMVMTD
MAP1_MYCPN        ---SKGYYLLKQFGGHGCGIKVHEEP-LILNYGKPDT----GTKLEPGMVLCIEPMVMTD
MAP1_MYCGA        ---KYGYSVIKDFGGHGCGIKIHEDP-IILNYGTKKS----SELLTPNMVICIEPMFFEK
                                ***     *                        .  . :**..   

MAP1_HELPY        QGE---PKILADKWSVVSV-DGLNTSHHEHTIAIVGNKAVILTER---------------
MAP1_HELPJ        QGE---PKILADKWSVVSV-DGLNTSHHEHTIAIVGNKAVILTER---------------
MAP1_ALKHC        SRY---VRTLSDNWTVVTV-DGKKCAHFEHTIAITETGYEILTKA---------------
MAP11_BACSU       SRY---VKTLADNWTVVTV-DGKKCAHFEHTIAITETGFDILTRV---------------
MAP13_SYNY3       SRF---TRTLGDRWTVVTV-DNALSAQFEHTVLVTATGYELLTDRRLV------------
MAP1_CLOAB        TYM---VKTQSNDWTVVTQ-DGSLAAHYENTVAILDNGPEILTLCE--------------
MAP1_CLOPE        SYR---VKTLDDGWTVVTA-DGKLSAHYENTVAILPNGPEILTLIK--------------
MAP11_MYCTU       TTK---TVVLDDKWTVTTA-DGSRAAHWEHTVAVTDDGPRILTLG---------------
MAP1_BORBU        GHK---VSIKSDGWTVFAS-DLSYSAHFEHTVAVVDGLPLILSEV---------------
MAP1_TREPA        TDE---VRTSADGWTVVTA-DGSCACHVEHTVAVFADHTEVLTEPTEVERTG--------
MAP1_ECO57        KKE---IRTMKDGWTVKTK-DRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE--
MAP1_ECOL6        KKE---IRTMKDGWTVKTK-DRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE--
MAP1_SHIFL        KKE---IRTMKDGWTVKTK-DRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE--
MAP1_ECOLI        KKE---IRTMKDGWTVKTK-DRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE--
MAP1_SALTI        DYR---IRTMKDGWTVKTK-DRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE--
MAP1_SALTY        DYR---IRTMKDGWTVKTK-DRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE--
MAP1_HAEIN        KKE---VRVMGDGWTVKTK-DRSHSAQYEHQLIVTETGCEVMTIRDEEIAEGRISRIMVN
MAP1_BUCAI        NPE---VKCMKDGWTVKTK-DRSLSAQYEHTVLVTEYGCDILTWQKDEDISQKLVNIN--
MAP1_BUCAP        SHE---VKCMKDGWTVKTK-DHSLSAQYEHTVLITENGCDILTWQKNEKIPSKFINK---
MAP1_BUCBP        SCE---VQCTNDGWTVKTK-DKSLSAQYEHTILVNEEGCEILTLQKGEQISRILKNLT--
MAP1_RICPR        NYDT--ILSKLDGWTVTTR-DKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY------
MAP11_SYNY3       TWE---AVLLDDGWTAITK-DGKLSAQFEHTIAVTEDGVEILTLGE--------------
MAP12_SYNY3       TYE---LTFLADGWTVITK-DKKLSAQFEHTVVVTEEGVEILTLA---------------
MAP1_YEAST        TW---KDMTWPDDWTSTTQ-DGKLSAQFEHTLLVTEHGVEILTARNKKSPGGPRQRIK--
MAP1_SCHPO        PA---RDITWPDDWTSSTA-SGRCSAQFEHTLLVTETGCEVLTARLPNSPGGPLK-----
MAP11_HUMAN       GW---QDETWPDGWTAVTR-DGKRSAQFEHTLLVTDTGCEILTRRLD-SARPHFMSQF--
MAP1_PONAB        GW---QDETWPDGWTAVTR-DGKRSAQFEHTLLVTDTGCEILTRRLD-SARPHFMSQF--
MAP11_MOUSE       GW---QDETWPDGWTAVTR-DGKRSAQFEHTLLVTDTGCEILTRRLD-SSRPHFMSQF--
MAP1_BOVIN        GW---QDETWPDGWTAVTR-DGKRSAQFEHTLLVTDTGCEILTRRLD-SAQPHFMSQF--
MAP1_CHICK        GW---QDETWPDGWTAVTR-DGKRSAQFEHTLLVTDTGCEILTRRLD-SIRPHFMSQ---
MAP1_XENLA        GW---QDETWPDGWTAITR-DGKRSAQFEHTLLVTETGCEILTCRLEENGRPYFIS----
MAP1_XENTR        GW---QDETWPDGWTAITR-DGKRSAQFEHTLLVTETGCEILTRRLEENGRPHFIS----
MAP11_DANRE       GW---QDETWPDGWTAVTR-DGKRSAQFEHTLLVTETGCEILTRRLEDNGRAHFLSQM--
MAP11_DICDI       TW---QDEIWPDSWTAVTA-DGKRSAQFEHTLVITETGCEVLTKRTNGSYIDRHFK----
MAP1A_ARATH       GW---RDRTWPDGWTAVTA-DGKRSAQFEHTLLVTETGVEVLTARLPSSPDVYPWLTK--
MAP1_MYCBO        AL---DYEIWDDGWTVVTK-DRKWTAQFEHTLLVTDTGVEILTCL---------------
MAP12_MYCTU       AL---DYEIWDDGWTVVTK-DRKWTAQFEHTLLVTDTGVEILTCL---------------
MAP12_HUMAN       SP---EFKVLEDAWTVVSL-DNQRSAQFEHTVLITSRGAQILTKLPHEA-----------
MAP12_MOUSE       SP---EFKVLEDAWTVVSL-DNQRSAQFEHTVLITPRGVEILTKLPQEA-----------
MAP12_DANRE       TS---GFRILSDKWTAVSV-DDKRSAQFEHTVVITSDGVEILTKLPEED-----------
MAP1B_ARATH       TT---ECVTWPDNWTTLTA-DGGVAAQFEHTILITRTGSEILTKC---------------
MAP1C_ARATH       TT---EFVTWPDKWTIVTA-DGGPAAQFEHTILITTTGAEILTISS--------------
MAP1D_ARATH       SR---NPIMWDDNWTVVTE-DASLSAQFEHTILITKDGAEILTKC---------------
MAP12_DICDI       TSPYAEWKMWDDKWTVSSR-EGGWSAQFEHTILVTKDGYEILTK----------------
MAP1_CHLMU        KKE--GFIDPTNHWEARTC-DHQPSAQWEHTVLITDSGYEILTLLDN-------------
MAP1_CHLTR        KKE--GFIDPINHWEARTC-DHQPSAQWEHAILITDSGCEVLTLLDK-------------
MAP1_CHLPN        KKE--GVVDPKNQWEARTC-DNQPSAQWEHTIAITETGYEILTLLND-------------
MAP1_STAAC        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAAR        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAAS        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAA1        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAAM        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAAW        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAAN        ASF--VTEG-KNEWAFETS-DKSFVAQIEHTVIVTKDGPILTTKIEEE------------
MAP1_STAES        ATF--VTEG-KNEWAFETK-DKSYVAQIEHTVIVTKDGPLLTTKIDD-------------
MAP1_STAEQ        ATF--VTEG-KNEWAFETK-DKSYVAQIEHTVIVTKDGPLLTTKIDD-------------
MAP12_BACSU       AET--IVEA-GDGWTFKTP-DKSMVAQVEHTIVITKDEPIILTKL---------------
Q9CHV6_LACLA      GWE--IDHDGERG--YVTL-DGSLSCQYEHQFVITKDGPVILTSQGEERTY---------
Q8DPV1_STRR6      DWE--IDTDMKTGWAHKTI-DGGLSCQYEHQFVITKDGPVILTSQGEEGTY---------
MAP1_AQUAE        TEE--TVED-GDGWTVKTK-DGSLAAHFEHTVAITKKGPVILTEL---------------
MAP1_MYCCT        TYK---TKIADDKWTVYSA-DHSITAHFEHTILITKDGCEVLTKTER-------------
MAP1_MYCGE        SSE--ITMA-ANNWNVLTL-KSKFNCHVEQMYHITNNGFECLTN----------------
MAP1_MYCPN        SDA--MVMH-NNSWNVLTP-KSRYNCHVEQMYVITTSGFECLTN----------------
MAP1_MYCGA        DNR--YYIDPDDSWSVKPVNKNQYVCHWEHMVLIKEDQAEILTL----------------
                                   .  .    .: *:   :        :                 

MAP1_HELPY        -
MAP1_HELPJ        -
MAP1_ALKHC        -
MAP11_BACSU       -
MAP13_SYNY3       -
MAP1_CLOAB        -
MAP1_CLOPE        -
MAP11_MYCTU       -
MAP1_BORBU        -
MAP1_TREPA        -
MAP1_ECO57        -
MAP1_ECOL6        -
MAP1_SHIFL        -
MAP1_ECOLI        -
MAP1_SALTI        -
MAP1_SALTY        -
MAP1_HAEIN        V
MAP1_BUCAI        -
MAP1_BUCAP        -
MAP1_BUCBP        -
MAP1_RICPR        -
MAP11_SYNY3       -
MAP12_SYNY3       -
MAP1_YEAST        -
MAP1_SCHPO        -
MAP11_HUMAN       -
MAP1_PONAB        -
MAP11_MOUSE       -
MAP1_BOVIN        -
MAP1_CHICK        -
MAP1_XENLA        -
MAP1_XENTR        -
MAP11_DANRE       -
MAP11_DICDI       -
MAP1A_ARATH       -
MAP1_MYCBO        -
MAP12_MYCTU       -
MAP12_HUMAN       -
MAP12_MOUSE       -
MAP12_DANRE       -
MAP1B_ARATH       -
MAP1C_ARATH       -
MAP1D_ARATH       -
MAP12_DICDI       -
MAP1_CHLMU        -
MAP1_CHLTR        -
MAP1_CHLPN        -
MAP1_STAAC        -
MAP1_STAAR        -
MAP1_STAAS        -
MAP1_STAA1        -
MAP1_STAAM        -
MAP1_STAAW        -
MAP1_STAAN        -
MAP1_STAES        -
MAP1_STAEQ        -
MAP12_BACSU       -
Q9CHV6_LACLA      -
Q8DPV1_STRR6      -
MAP1_AQUAE        -
MAP1_MYCCT        -
MAP1_MYCGE        -
MAP1_MYCPN        -
MAP1_MYCGA        -