CLUSTAL format seed alignment for MF_01976

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PFP_AMYME        ------MRVGVLTGGGDCPGLNAVIRAVVRKGIEAHGWEIVGFRSGWRGPLT-------G
PFP_AMYMS        ------MRVGVLTGGGDCPGLNAVIRAVVRKGIEVHGWDFVGFRNGWNGPLT-------G
PFP_STRCO        ------MKVGVLTGGGDCPGLNAVIRAVVRKGVQEYGYDFTGFRDGWRGPLE-------G
PFKA2_STRCO      ------MRIGVLTAGGDCPGLNAVIRSVVHRAVDNYGDEVIGFEDGYAGLLD-------G
PFKA3_STRCO      ------MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFRDGWKGLLE-------C
PFKA_COREF       ---MGAMRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLA-------D
PFKA_CORGL       ---MEDMRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLG-------D
PFKA_MYCTU       ------MRIGVLTGGGDCPGLNAVIRAVVRTCHARYGSSVVGFQNGFRGLLE-------N
PFKA_MYCTO       ------MRIGVLTGGGDCPGLNAVIRAVVRTCHARYGSSVVGFQNGFRGLLE-------N
PFKA_MYCBO       ------MRIGVLTGGGDCPGLNAVIRAVVRTCHARYGSSVVGFQNGFRGLLE-------N
PFKA_MYCLE       ------MRIGILTGGGDCPGLNAVIRAIVRTCDARYGSSVVGFQDGWRGLLE-------N
PFP_DICTH        ---MSKMRIGVLTGGGDCPGLNPAIRGIVMRAL-DYGDEVIGLKYGWAGLLK-------A
PFP_THETK        ------MKIGVLTGGGDAPGLNIAVYTFVKLA--ERKHEVYAIYHGWRGLLN-------K
PFKA3_BACTN      ------MRIGILTSGGDCPGINATIRGVCKTAINHYGMEVIGIHSGFQGLLT-------K
PFKA_SPITD       MKRPATRTFGILTSGGDCPGLNAAIRGVTKAAYWRYGMSIIGISHGYRGLIE-------G
PFKA_PROFC       ----MSMRVGILTSGGDSPGLNAAIRGFGKAAVSTYGMELIGFRDGMRGLAE-------N
PFKA2_CLOPE      -MMQPIKKIAILTGGGDCPGLNAVIRAVTRTAILKYGYEVIGYKFGYRGLYN-------N
PFKA_CHLSY       -MASKKQRIGVLTSGGDAPGLNAVIRAVVKSAS-GLGWEVIGIHDGFEGLLG-------T
PFKA_CHLAA       -MASKKQRIGVLTSGGDAPGLNAVIRAVVKSAS-GLGWEVIGIHDGFEGLLG-------T
PFKA_CHLAD       -MASKKQRIGVLTSGGDAPGLNAVIRAVVKSAS-SLGWEVIGIHDGFEGLLG-------T
PFKA1_NOSS1      --MSKSRRIGILTSGGDCSGLNAVIRAVVHCASGK-GWEVFGIRQATLGLMA-----RPP
PFKA1_SYNY3      --MGEIKRIGILTSGGDCAGLNAVIRSVVHHAIGTYGWEVIGIQEATQGLME-----NPS
PFKA2_NOSS1      ----MRKRIGILTSGGDCPGLNCVIRAVVSHATLTYDWEVLGIPYATQGLRE-------R
PFKA_TRIV2       ----MRKKIGILTSGGDCPGLNCVIRAVVSHATLTYDWEVFGIPYATQGLLE-------R
PFKA_THEEB       -MSSSRKRLGVFTSGGDCPGLNTAIRAIVAHATLSYGWEVLGILHATQGLIE-------R
PFKA2_SYNY3      ---MGTKRIGILTSGGDCPGLNAVIRAVVKASALK-GWEVYGIPYGTDGFVEVAHGKYQA
                         .. :*.***..*:* .:  .           . .   .  *           

PFP_AMYME        DSRPLGLDD---------VEEILIRGGTILGSS-RTNPYK-----------EEGGVEKIR
PFP_AMYMS        DSRPLGLND---------VEDILTRGGTILRSS-RTNPYK-----------VEGGVDKIK
PFP_STRCO        DTVPLDIPA---------VRGILPRGGTVLGSS-RTNPLK-----------QRDGIRRIK
PFKA2_STRCO      RYRALDLNA---------VSGILARGGTILGSS-RLERDR-----------LREACENAG
PFKA3_STRCO      DYLKLDLDA---------VGGILARGGTILGSS-RVRPEH-----------LRDGVERAR
PFKA_COREF       RRVQLYDDED--------IDRILLRGGTILGTG-RLHPDK-----------FRAGIDQVK
PFKA_CORGL       RRVQLYDDED--------IDRILLRGGTILGTG-RLHPDK-----------FKAGIDQIK
PFKA_MYCTU       RRVQLHNDDR--------NDRLLAKGGTMLGTA-RVHPDK-----------LRAGLPQIM
PFKA_MYCTO       RRVQLHNDDR--------NDRLLAKGGTMLGTA-RVHPDK-----------LRAGLPQIM
PFKA_MYCBO       RRVQLHNDDR--------NDRLLAKGGTMLGTA-RVHPDK-----------LRAGLPQIM
PFKA_MYCLE       RRMQLCNDDR--------NDRLLAKGGTMLGTA-HVHPDK-----------LRAGLHQIK
PFP_DICTH        DTMPLSLEM---------VEDILEIGGTILGSS-RTNPFK-----------KEEDVQKCV
PFP_THETK        EVKRVSSRD---------LLDFAFSGGTYIRTS-RTNPFK-----------DEERARLLE
PFKA3_BACTN      DIESFTDKS---------LSGLLNQGGTMLGTS-REKPFK-----KGGVVSDVDKPALIL
PFKA_SPITD       DARLLHPRD---------FDGILTRGGTILGTS-REKPFKPDP-GEKDSEAGSRKVEAII
PFKA_PROFC       RFMQLDSHA---------LSGILTTGGTILGTS-RDKVHK-----MLVDGKVQNMIPVIK
PFKA2_CLOPE      DFVKLDLDS---------VSGILHRGGTILHSSNKDNLFDYQVEDENGKIVKKDVSDVGV
PFKA_CHLSY       KSYRVLTNAD--------VQGLLPRGGTILRTTNKGHFGP----RRSDELSEADPYVRAV
PFKA_CHLAA       KSYRVLTNAD--------VQGLLPRGGTILRTTNKGHFGP----RRSDELSEADPYVRAV
PFKA_CHLAD       KSYRVLTNAD--------VQGLLPRGGTILRTTNKGHFGP----RRSDELSEADPYVRAV
PFKA1_NOSS1      QVSKLEIDQ---------VDPLLTSGGTMLGTTNKGDPFAFPMPDG----SFCDRSSEII
PFKA1_SYNY3      KAIALHRDN---------IDHLLMMGGTFLGTTNKGNPFAFPMADG----TVRDRTEDII
PFKA2_NOSS1      QAIALNMHGWD----LRGIDPLLNMGGTILGTINKGD--TLAHVD------------EML
PFKA_TRIV2       QAIALNMHGWD----LRGIDPLLNMGGTILGTINKGD--TLAHVD------------EML
PFKA_THEEB       KAIPLNAEG------LGGMDVLLNMGGTILGAINKGD--TLGHAD------------EVI
PFKA2_SYNY3      EDLLLTKHGYALPGMLKGLDVLQFLSGSVLGSLSKGHPEQPAIAE------------AIL
                     .                :   .*: : :  :                         

PFP_AMYME        AVLADQGVDALIAIGGEDTLGVAKKLTDD-GIGVVGVPKTIDNDLAATDYTFGFDTAVHI
PFP_AMYMS        QVLADQGVDALIAIGGEDTLGVAKRLTDD-GIGVVGVPKTIDNDLGATDYTFGFDTAVSI
PFP_STRCO        DNLAALGVEALITIGGEDTLGVATRLADEYGVPCVGVPKTIDNDLSATDYTFGFDTAVGI
PFKA2_STRCO      DMIQNFGIDALIPIGGEGTLTAARMLSDA-GLPVVGVPKTIDNDISSTDRTFGFDTAVGV
PFKA3_STRCO      GHVEELGLDAIIPIGGEGTLKAARLLSDN-GLPIVGVPKTIDNDIAVTDVTFGFDTAVTV
PFKA_COREF       ANLADAGIDALIPIGGEGTLKGAKWLADN-GIPVVGVPKTIDNDVNGTDFTFGFDSAVSV
PFKA_CORGL       ANLEDAGIDALIPIGGEGTLKGAKWLSDN-GIPVVGVPKTIDNDVNGTDFTFGFDTAVAV
PFKA_MYCTU       QTLDDNGIDVLIPIGGEGTLTAASWLSEE-NVPVVGVPKTIDNDIDCTDVTFGHDTALTV
PFKA_MYCTO       QTLDDNGIDVLIPIGGEGTLTAASWLSEE-NVPVVGVPKTIDNDIDCTDVTFGHDTALTV
PFKA_MYCBO       QTLDDNGIDVLIPIGGEGTLTAASWLSEE-NVPVVGVPKTIDNDIDCTDVTFGHDTALTV
PFKA_MYCLE       QTLDDNGIDVLIPIGGEGTLTAAHWLSQE-DVPVVGVPKTIDNDIDCTDVTFGHDTALTV
PFP_DICTH        ENFKKLNLDALIAIGGEDTLGVASKFSKLG-LPMIGVPKTIDKDLEETDYTLGFDTAVEV
PFP_THETK        SNVKELGLDVVVAIGGDDTLGAAGEAQRRGILDAVGIPKTIDNDVYGTDYTIGFDSAVNA
PFKA3_BACTN      QNIQEMGLDCVVCIGGNGTQKTAAKFAAM-GVNIVSVPKTIDNDIWGTDISFGFDSAVSI
PFKA_SPITD       ENYHKLHLDCLVVLGGNGTHKTAYLLQQA-GLNVIGLPKTIDNDIWGTDVTFGFHSAVDI
PFKA_PROFC       KNYEKNKLDALVCLGGGGTAKNAKRLSDA-GMNVITLPKTIDNDLVGTDQTFGFATALEI
PFKA2_CLOPE      ENLKKEGVDALVVIGGDGTLTSARDFSRK-GVNVIGVPKTIDNDLLATDVTFGFNTATEI
PFKA_CHLSY       KAIEEMGLRALITIGGEGTQRIALELHKL-GAPVIGVPKTIDNDLAGTDRTFGFDTALQV
PFKA_CHLAA       KAIEEMGLRALITIGGEGTQRIALELHKL-GAPVIGVPKTIDNDLAGTDRTFGFDTALQV
PFKA_CHLAD       KAIEEMGLRALITIGGEGTQRIALELHKL-GAPVIGVPKTIDNDLAGTDRTFGFDTALQV
PFKA1_NOSS1      AGYHQLDLDALIGIGGDGSLAILRRLAQQGAINLVGIPKTIDNDIGITEHAIGFDTAVNI
PFKA1_SYNY3      AGYRQLGLDALIGIGGDGSLAILRRIAQQGGINLVGIPKTIDNDVGATEISIGFDTATNI
PFKA2_NOSS1      ASYQALALDALIVIGGDGSLGILHELASRGNWNLVAIPKTIDNDVALTERAVGFDTAVNT
PFKA_TRIV2       ASYEALALDALIVIGGDGSLGILHELASRGNWNLVAIPKTIDSDVALTERAVGFDTAVNT
PFKA_THEEB       AGYYELGLDALIAICGDGSLRILHQLAQKGNWNFLAIPKTIDNDVALTDRAIGFDTAVNT
PFKA2_SYNY3      KGYAILDLEALIVIGGDGSLDIIYDLAQKGNWHIIAIPKTIDNDVPFTDLAVGFSTAVDI
                        :  :: : * .:               : :*****.*:  *: :.*. :*   

PFP_AMYME        ATEAIDRLRTTAESHYRAMVVEVMGRHAGWIALHAGLAGGANVILVPER-----PFSVEQ
PFP_AMYMS        ATEAIDRLHTTAESHHRALVVEVMGRHAGWIALHSGLAGGASVILVPER-----HFNVDQ
PFP_STRCO        ATEAIDRLHTTAESHMRVLVVEVMGRHAGWIALHSGLAGGANVILIPEQ-----RFDVEQ
PFKA2_STRCO      ATEAMDRLKTTAESHQRVMVVEVMGRHAGWIALESGMAAGAHGICLPER-----PFDPAD
PFKA3_STRCO      ATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHSGMAAGAHAVVVPER-----PFDIDE
PFKA_COREF       ATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHAGMAGGAHYTVIPEV-----PFDISE
PFKA_CORGL       ATDAVDRLHTTAESHNRVMIVEVMGRHVGWIALHAGMAGGAHYTVIPEV-----PFDIAE
PFKA_MYCTU       ATEAIDRLHSTAESHERVMLVEVMGRHAGWIALNAGLASGAHMTLIPEQ-----PFDIEE
PFKA_MYCTO       ATEAIDRLHSTAESHERVMLVEVMGRHAGWIALNAGLASGAHMTLIPEQ-----PFDIEE
PFKA_MYCBO       ATEAIDRLHSTAESHERVMLVEVMGRHAGWIALNAGLASGAHMTLIPEQ-----PFDIEE
PFKA_MYCLE       ATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALSSGLASGAHMTLIPEQ-----PFDVEE
PFP_DICTH        VVDAIKRLRDTARSHARVIVVEIMGRHAGWLALYGGLAGGADYILIPEV-----EPNLED
PFP_THETK        AIEATESFKTTLISHERIGVVEVMGREAGWIALFTGLSTMADAVLIPER-----PASWDS
PFKA3_BACTN      ATDAIDRLHSTASSHKRVMVIEVMGHKAGWIALYSGMAGGGDVILVPEI-----PYNIKN
PFKA_SPITD       ATEAIDRLHSTAHAHNRVMVIEVMGHKAGWLALYAGIAGGGDIILIPEI-----PYDLAH
PFKA_PROFC       ATDAVDRLHSTAHSHHRIILTEIMGHRAGWLALGAGIAGGADVILLPEV-----PYNVES
PFKA2_CLOPE      ATEALDRLHTTAESHHRIMLLEVMGRNAGWIALESGIAGSADVILLPEI-----PYDINK
PFKA_CHLSY       ATDAIDRLHTTAASHNRVMVLEVMGRHTGWIALHAGLAGGADVILIPEI-----PFSIER
PFKA_CHLAA       ATDAIDRLHTTAASHNRVMVLEVMGRHTGWIALHAGLAGGADVILIPEI-----PFSIER
PFKA_CHLAD       ATDAIDRLHTTAASHNRVMVLEVMGRHTGWIALHAGLAGGADVILIPEI-----PFTIER
PFKA1_NOSS1      ATEALDRLHFTAASHSRVMILEVMGRDAGHIALAAGIAGGADVILIPEI-----LYSMDD
PFKA1_SYNY3      ATEALDRLHFTAASHNRVMVLEVMGRDAGHIALAAGIGGGADIILIPEI-----PYRIQS
PFKA2_NOSS1      IVDALNRLTFTAASHDRVMIVEVMGRSAGHLALHAGIAGGADVILIPEI-----SYTISG
PFKA_TRIV2       IVDALNRLTFTAASHDRVMIVEVMGRSAGHLALHAGIAGGADVILIPEI-----SYTISG
PFKA_THEEB       VVEALNRITSTAASHDRVFVVEVMGRTAGHLALYSGIAGGADIILIPEI-----PYSIEG
PFKA2_SYNY3      VTQALYDLTFTAASHERIIIVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRN
                   :*   :  *  :* *  : ::**: .* ::*  *:.  .    :**            

PFP_AMYME        VVEWV-ERRFEK-MYAPIIVVAEGAVPEGGA-----------------EVLRTGEKDAFG
PFP_AMYMS        VVSWV-ERRFEK-EFAPIIVVAEGALPEGGE-----------------EKLLTGEKDAFG
PFP_STRCO        VCSWV-TSRFRA-SYAPIVVVAEGAMPRDGD-----------------MVLKDESLDSYG
PFKA2_STRCO      LVKMV-EERFSRGKKFAVVCVAEGAHPAEGS-----------------MDYGKGAIDKFG
PFKA3_STRCO      LTAKV-GERFSAGKRFAIVVAAEGAKPKAGT-----------------MDFDEGGKDVYG
PFKA_COREF       ICKRM-ERRFQMGEKYGIIVVAEGALPKEGT-----------------MELREGEVDQFG
PFKA_CORGL       ICKAM-ERRFQMGEKYGIIVVAEGALPREGT-----------------MELREGHIDQFG
PFKA_MYCTU       VCRLV-KGRFQRGDSHFICVVAEGAKPAPGT-----------------IMLREGGLDEFG
PFKA_MYCTO       VCRLV-KGRFQRGDSHFICVVAEGAKPAPGT-----------------IMLREGGLDEFG
PFKA_MYCBO       VCRLV-KGRFQRGDSHFICVVAEGAKPAPGT-----------------IMLREGGLDEFG
PFKA_MYCLE       VCCLV-KRRFQRGDSHFICVVAEGAKPVPGS-----------------ITLRQGGMDEFG
PFP_DICTH        LYNHI-RKLYARGRNHAVVAIAEGVQLPGFTY----------------QKGQEGMVDAFG
PFP_THETK        VAKRV-KEAYNE-RRWALVVVSEGIKEYG------------------------GPKDEYG
PFKA3_BACTN      IGNTI-LERLKKGKPYSIVVVAEGILTD--------------------------GRKRAA
PFKA_SPITD       IVHHL-QTRQQRGKEFSIVVVAEGALSRE-----------------ESLMSKEERKKRRK
PFKA_PROFC       IAAAI-SRRSAHGSNFSVVAVAEGARNERDAAELAAADALVREADSPVARDAAKTHRANV
PFKA2_CLOPE      IVEKV-KEREEAGKQFTIIVVAEGAKPKD-----------------GEVVVSKIVDDSPD
PFKA_CHLSY       VAEKV-MARDQQGSSFSIIVVAEGARPRGGS------------------------EMYIA
PFKA_CHLAA       VAEKV-MARDQQGSSFSIIVVAEGARPRGGS------------------------EMYIA
PFKA_CHLAD       VAEKV-HARDAQGSAFSIIVVAEGARPRGGS------------------------EMYIA
PFKA1_NOSS1      ICYHIKHRQ-EEGKNYCLIIVSEAVRTQDGE--------------------ILTLTNRLG
PFKA1_SYNY3      VCNKIRQRQ-AEGKNFCLVMVSEAVRTELGD--------------------QVKQIQQFG
PFKA2_NOSS1      LCQHIAELRDRWQRKFAIVVVAEGAKLCLED--------------------VQENIASSC
PFKA_TRIV2       LCQYIAELRDRWQRKFAIVVVAEGAKLCLED--------------------VQENIASAC
PFKA_THEEB       ICQHLQKLRDRWGRQFALIVVAEGSKQLEED--------------------ANH------
PFKA2_SYNY3      CCYQLMNLR-KSGRHFALIVISEGVHDQNNK--------------------KNKHIADYL
                     :            :   :*.                                    

PFP_AMYME        HVQLGGVGTWLADEIA-----ERTGKESRAVVLGHTQRGGTPTAYDRVLATRFGLHAVDA
PFP_AMYMS        HVRLGGIGTWLADEIA-----HRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLNAVDA
PFP_STRCO        HVRLSGVGEWLAKQIE-----KRTGNEARTTVLGHVQRGGTPSAFDRWLATRFGLHAVDC
PFKA2_STRCO      HERFQGIGTALAFELE-----RRLGKEAKPVILGHVQRGGVPTAYDRVLATRFGWHAVEA
PFKA3_STRCO      HERFAGIARQLSIELE-----ERLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEA
PFKA_COREF       HKTFTGIGQQIADEVH-----RRLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAARA
PFKA_CORGL       HKTFTGIGQQIADEIH-----VRLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAARA
PFKA_MYCTU       HERFTGVAAQLAVEVE-----KRINKDVRVTVLGHIQRGGTPTAYDRVLATRFGVNAADA
PFKA_MYCTO       HERFTGVAAQLAVEVE-----KRINKDVRVTVLGHIQRGGTPTAYDRVLATRFGVNAADA
PFKA_MYCBO       HERFTGVAAQLAVEVE-----KRINKDVRVTVLGHIQRGGTPTAYDRVLATRFGVNAADA
PFKA_MYCLE       HERFTGVAAQLGAEVE-----KRINKDVRVTVLGHVQRGGTPTAFDRVLATRFGVNAADA
PFP_DICTH        HIRLGGVGNVLAEEIQ-----KNLGIETRAVILSHLQRGGSPSIRDRIMGLLLGKKAVDL
PFP_THETK        HSRLGGVGNELAEYIE-----RSTGIEARAVVLGHTIRGVPPTAFDRILAVRYATAAYEA
PFKA3_BACTN      EY--------IAQEIE-----YETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATEL
PFKA_SPITD       KNRFPTKGYEVAHLIQ-----EATGMETRVTVLGYLQRGGTPSPYDRLLATRFGTAAAEL
PFKA_PROFC       EASHRAHTFTLATELE-----KATGLESRVTILGYVQRGGTPCGRDRVLATVLGTAGADL
PFKA2_CLOPE      PIRLGGIANKLAIDLE----GLIKNHEIRSTVLGHIQRGGNTSTYDRILSTKYGVKAVEL
PFKA_CHLSY       EGRLGGIGHWVGEQLE-----KLTAKEVRVVVLGHLQRGGSPSPYDRLLSTRYGAAAVQA
PFKA_CHLAA       EGRLGGIGHWVGEQLE-----KLTAKEVRVVVLGHLQRGGSPSPYDRLLSTRYGAAAVQA
PFKA_CHLAD       EGRLGGIGHWVGEQLE-----RLTGKDVRVVVLGHLQRGGSPSPYDRLLSTRYGAAAVQA
PFKA1_NOSS1      QSRYGGIGEYLAD----QIS-DRIGAETRVTVLGHIQRGGIASPLDRLVASAFGVAAVNL
PFKA1_SYNY3      EDRYGGIGKYIAE----QIA-QRTGAETRVTVLGHIQRGGIPSPFDRLLGSVFGVAAVDL
PFKA2_NOSS1      APSKCGRGQYIAD--QIAQC-SKNLIDTRVSVLGHIQRGGIPSALDRLTATVFGKTAVDL
PFKA_TRIV2       VSPKCGRGQYIAE--QIARC-SKNLIDTRVSVLGHIQRGGIPSALDRLTATVFGKTAVDL
PFKA_THEEB       -PRHCSIGQYIAD--KIAQH-SPIPIELRVSVLGHIQRGGAPMAMDRLLAAGMGNTAVDL
PFKA2_SYNY3      AEEISETSQHLCDIKDPAFC-DLISLDIRATTLGHLQRSGTPLSFDRLLATVFGIRAVEL
                           :               : :   *.:  *.  .   **  .   .  .   

PFP_AMYME        VADGDFGTMVALRGTDIVRVKLAEATA----------ELKTVPPER-----YEEAEVFFG
PFP_AMYMS        VADGDFGVMVALKGTDIVRVKLSEATA----------ELKTVPVER-----YQEAEVFFG
PFP_STRCO        VHDGDFGKMVALRGTDIVRVPIAEATA----------RLKTVDPAL-----YEEVGVFFG
PFKA2_STRCO      AHRGDFGRMTALRGTDVVMVPLAEAVT----------ELKTVPKDR-----MDEAESVF-
PFKA3_STRCO      VHRGEFGKMTALRGTDIEMVSLADAVE----------SLKTVPDAR-----YAEAECVL-
PFKA_COREF       CHEGQFNTVVALKGERIRMISFDEAVG----------TLKKVPMER-----WVTAQAMFG
PFKA_CORGL       CHEGSFDKVVALKGESIEMITFEEAVG----------TLKEVPFER-----WVTAQAMFG
PFKA_MYCTU       AHAGEYGQMVTLRGQDIGRVPLADAVR----------KLKLVPQSR-----YDDAAAFFG
PFKA_MYCTO       AHAGEYGQMVTLRGQDIGRVPLADAVR----------KLKLVPQSR-----YDDAAAFFG
PFKA_MYCBO       AHAGEYGQMVTLRGQDIGRVPLADAVR----------KLKLVPQSR-----YDDAAAFFG
PFKA_MYCLE       SHAGEYGQMVSLRGQDIGRVPLEDAVR----------QLKLVPESR-----YDDAAAFFG
PFP_DICTH        VHEGKSGLFVAVKGNELVPVDITLIEG----------KTKNVDPAF-----YESVKTFFN
PFP_THETK        VENGRYGVMVAYSNGDIAYVPIVDVVG----------KNRLVSGYW-----MRLYETYWP
PFKA3_BACTN      IANGQFGRMIALKGDDISSIPLEEVAG----------KLKLVTEDHDLVIQGRRMGICFG
PFKA_SPITD       LYRGDYGKMVALRDGEVVAIPLGEVAE----------KLKTVPPDHPLIDTARAVGTCFG
PFKA_PROFC       VAKGVFGVMVAAKGDGAEPVPLEEVAG----------KIRRVPVDHPWIRAAKEVGTGFG
PFKA2_CLOPE      INSNLFGNMVALKGNKVSYESLENVIG----------HTKNVDPEGELVNTAKSIGISFA
PFKA_CHLSY       AARGIYGEMVALRGQDIVTVPLAEACG----------HLNRVRPHSDLVLCARSLGIAFG
PFKA_CHLAA       AARGIYGEMVALRGQDIVTVPLAEACG----------HLNRVRPHSDLVLCARSLGIAFG
PFKA_CHLAD       AARGIYGEMVALRGQDIVTVPLAEACG----------YLNRVRPHSDLVLCARSLGIVFG
PFKA1_NOSS1      IEAAKYDYMVAWQNRQVITVPIEEAIA----------QYKAVNPEDALVKTARGLGIYLG
PFKA1_SYNY3      IAEGKFDHMVAWRNRQTISVPIEEAIQ----------TYQTVQLDGTLVKTARGLGICLG
PFKA2_NOSS1      IAQGKFGQMVAWQNGEAIPVPIQDVVA---------QSPLHVNPQGSLVQSARCLGIYVG
PFKA_TRIV2       VAQGKFGQMVAWQNGEAIPVPIQDVVA---------QSPLHVNPQGSLVQSARCLGIYVG
PFKA_THEEB       AAQGTFGRMVAWQAGQVVTVPIADVVA---------KCPRHVDPNSFLIRTAQGLGIYVG
PFKA2_SYNY3      IEQEIYDQVVIWRSGKVEHADLKPIISIIKECHQENRCPFPVDRDGFMVKTAKSLGIYLG
                       . .            :                   *                  

PFP_AMYME        ---------------------
PFP_AMYMS        ---------------------
PFP_STRCO        ---------------------
PFKA2_STRCO      ---------------------
PFKA3_STRCO      ---------------------
PFKA_COREF       ---------------------
PFKA_CORGL       ---------------------
PFKA_MYCTU       ---------------------
PFKA_MYCTO       ---------------------
PFKA_MYCBO       ---------------------
PFKA_MYCLE       ---------------------
PFP_DICTH        K--------------------
PFP_THETK        DLAG-----------------
PFKA3_BACTN      ---------------------
PFKA_SPITD       DGV------------------
PFKA_PROFC       D--------------------
PFKA2_CLOPE      D--------------------
PFKA_CHLSY       DEL------------------
PFKA_CHLAA       DEL------------------
PFKA_CHLAD       DEL------------------
PFKA1_NOSS1      E--------------------
PFKA1_SYNY3      ND-------------------
PFKA2_NOSS1      EKT------------------
PFKA_TRIV2       EKT------------------
PFKA_THEEB       DKPMLPYVDPTLCRDQVICAI
PFKA2_SYNY3      ED-------------------