CLUSTAL format seed alignment for MF_01979

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PFP_THEMA         ----------------------------------------------MAERLGILVGGGPA
A8F8M0_PSELT      ----------------------------------------------MSGKVGILVGGGPA
B5YIA7_THEYD      -----------------------------------------------METVGIIVGGGPA
I0AL84_IGNAJ      ---------------------------MTIAP----------------KKLAILVGGGPA
Q08ST9_STIAD      MPYLYKHCYICQTPSGLGGEILKIPQVFADSPPSSGQDAANPFEAGDMKKLAIVVAGGPA
D1B7G6_THEAS      ----------------------------------------------MINRLAILCGGGPA
I4BX58_ACEMN      -------------------------------------------MNFKGNTLALICGGGPA
C9LUB8_SELS3      -------------------------------------------MIGIKNVIAIICGGGPA
I0GNN8_SELRL      -------------------------------------------MIGIKNVIAVVCGGGPA
PFP_NAEFO         -------------------------------MLSSSHLPTTIVTPKNVPTLGVLVGGGPA
PFP1_TRIVA        -------------------------------------------MSTEAPVLGILCGGGPA
PFP2_TRIVA        -------------------------------------------MSTEAPVLGILCGGGPA
PFP3_TRIVA        -------------------------------------------MSAEAPVLGILCGGGPA
                                                                    :.:: .****

PFP_THEMA         PGINSVISSVTIEAINNGLEVIGIYDGFKHLVEGK----TNMVKKLSIEDVSRIHIEGGS
A8F8M0_PSELT      PGINSVINAVTIEAINNGLEVVGIYDGFEHLMKAQ----TTFVRHLTISDVSRIHIEGGS
B5YIA7_THEYD      PGINGTISAATIEAINQGKKVIGIKGGFKPLFDGN----LSCAMPLSVDDVSRIHTKGGS
I0AL84_IGNAJ      PGINSVIGAATIRAAVEGIEVLGIKDGFQWIMEGD----ITRVKELTIHNVSRIHFRGGS
Q08ST9_STIAD      PGINSVIGAATIRACLSGVEVLGIQDGFKWLSEGD----ISRVVPLTIADTSRIHFRGGS
D1B7G6_THEAS      PGINSVISSAAIEAINHGWEVFGLLDGFKPISKG-----RFEAIRLTIDQVSRIHTEGGS
I4BX58_ACEMN      PGINNVIASVTIEARNNGWDVLGICDGFSRLATA-----NKRVIPLTIDMVSRIHTEGGS
C9LUB8_SELS3      PGINSVISAVTIEADRHGWDVLGIYDGFSRLARG-----EKKYVRLDMERVNRIHLTGGC
I0GNN8_SELRL      PGINSVISGVVNEATRQGWDVLGMYDGFSRLARG-----EKNYIRLEPKNISRIHLTGGC
PFP_NAEFO         PGINGVIGAVTIEAINNGYRVLGFLEGFQNLILQD----DSKIVELTIDSVSRIHFEGGS
PFP1_TRIVA        PGLNGVIAGATLYALRLGWKVIGFMEGFKYLCTGDVDVVKAHTIDLTYDIVSRIHFQGGT
PFP2_TRIVA        PGLNGVIAGATLYALRLGWKVIGFMEGFKYLCTGDIETVKAHTIDLTYDIVSRIHFQGGT
PFP3_TRIVA        PGLNGVIAGATLYALRLGWKVIGFMEGFKYLCTGDVDVVKAHTIDLTYDIVSRIHFQGGT
                  **:*..* ...  *   *  *.*:  **. :              *     .***  ** 

PFP_THEMA         ILRTSRVNPAKSEETLEKTVQTLKKLGIKYLVTIGGDDTAFSASKVCERSK----GEIKV
A8F8M0_PSELT      ILRTSRANPTKKAEDLQNVVRALKELQVRYLVTIGGDDTAFSASSVMKVSN----GALRV
B5YIA7_THEYD      ILRTSREHAERVKEKFPVLMETLKKLGIKYLITIGGDGTLFMANWIEREAR----GEINV
I0AL84_IGNAJ      YIGISRANPTKDKKHLENTVTSLLRLNVDKLITIGGDDTAYSALKVNEMAA----GRIKV
Q08ST9_STIAD      HIGISRANPTRSPEHLQRTIDAMERLGVGMLITIGGDGTATLAQIISEKTR----GKIRV
D1B7G6_THEAS      IIRTSRHNPTVDREDMERAVDTLADAGISHLITIGGDDTAYSALMLSRQSLAKRAHPIRI
I4BX58_ACEMN      ILRTSRFNPTKSEQTLKTVVENLVDLGVTHIVTIGGDDTAYAAYKLSEFAREKLGLNIHF
C9LUB8_SELS3      ILQMSRYNPTKKESDLRTVVDTLTELGVTHVVTIGGDDTAYSAMAVSNYAR-QIGKTINV
I0GNN8_SELRL      ILKMSRFNPTKKESDLRTVVETLTELGVTHLVTIGGDDTAYSSAAVSDYAR-KMGRTINV
PFP_NAEFO         ILKTSRANPTKKQEDLQKVVKQLQKFNVSLLVTIGGDDTAFSSMSVAKAAN----NEIHV
PFP1_TRIVA        IIQTSRANPRKSPELQENVRKCLRALKVRYFLTIGGDDTASSAVSVASGMN---GNEISV
PFP2_TRIVA        IIQTSRANPRKSTELQENVRKCLRALKVRYFLTIGGDDTASSAVSVAQGMD---GNEISV
PFP3_TRIVA        IIQTSRANPRKSTELQENVRKCLRALKVRYFLTIGGDDTASSAVSVAQGMD---GNEISV
                   :  ** :.    .        :    :  .:*****.*   :  :           : .

PFP_THEMA         VHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTN-RWYFVAMMGREAGHL
A8F8M0_PSELT      AHVPKTIDNDLPLPGGMPTFGFETARHVGTELVYNLMQDSRTTN-RWYFVVVMGRKAGHL
B5YIA7_THEYD      VHVPKTIDNDLPLPGGASTFGYETARHWGVEIVKNIMEDARVSA-RWYFLTIMGRYTGHL
I0AL84_IGNAJ      VHVPKTIDNDLDLPHGIPTFGFQTARHIGVDIVKNLMVDAQTTS-RWYFVISMGRKAGHL
Q08ST9_STIAD      VHVPKTIDNDIDLPHDTSTFGFQTARHVGVDIVKNLMVDAKTTS-RWYFVVAQGRKAGHL
D1B7G6_THEAS      AHVPKTIDNDLPLPEGIPTFGFETARSLGAQLLTNIMEDARTTG-RWFLCVTMGRATGHL
I4BX58_ACEMN      VHVPKTIDNDLPLPEGLPTFGFETARALGAELVMNLMEDAKTMG-RWFLVVTMGRSSGHL
C9LUB8_SELS3      VHVPKTIDNDLPLPEGIPTFGFETARAFGTEEIENLMEDARTSNNRWYFTIAMGRTAGHL
I0GNN8_SELRL      VHVPKTIDNDLPLPEGIPTFGFETARAFGTQEVENLMEDARTTNNRWYFTIAMGRTAGHL
PFP_NAEFO         VTLPKTIDNDLPLPYGIPTFGYETAREFGANVVRNLMTDASTAS-RYFIVVAMGRQAGHL
PFP1_TRIVA        ISCPKTIDNDLPLPADQSTFGFHTARSLGMEIIRNLMVDSKSAP-RWFLVEAMGRSAGHL
PFP2_TRIVA        ISCPKTIDNDLPLPADQSTFGFHTARSLGMEIIRNLMVDSKSAP-RWFLVEAMGRSAGHL
PFP3_TRIVA        ISCPKTIDNDLPLPSDQSTFGFHTARSLGMEIIRNLMVDSKSAP-RWFLVEAMGRSAGHL
                     *******: ** . .***:.***  . : : *:* *:     *:::    ** :***

PFP_THEMA         ALGVGKAASATITIIPEEF-------KEGVTLEEVCDVLDGAILKRKLMGR-DDGVAVIG
A8F8M0_PSELT      ALGIGKAASAALTVIGEEFR------KERIKLSEVCDLLEAAIIKRKALGR-NDGLAVIA
B5YIA7_THEYD      ALGVGKAAGATLTIIPEEFP------EEKISFKKVADILTGAIIKRLSMGR-DHGVVIMA
I0AL84_IGNAJ      ALGIGKATGATITLIPEEFS------GKEIKLNHIVDILVGAIIKRLSYGR-PDGVAIIA
Q08ST9_STIAD      ALSIGKAVGATVTLIPEEFR------GKKVPFATVVDILTGSVLKRLAYGR-PDGIALLA
D1B7G6_THEAS      ALGIGKSAGATLILIPEEF-------GPRVSLGTISDLIVGSVIKRLAMGR-GYGVAVVA
I4BX58_ACEMN      ALGIGKSASATLTVIPEEFE------GDTICLKHIIDIMSGAIIKRLALEK-DHGVIVAA
C9LUB8_SELS3      ALGMGRSAGAALTIIPEEFA------AESIPLQQVVDIITGSIVKRYLTGH-NYGVAVIA
I0GNN8_SELRL      ALGMGRSAGAALTIIPEEFP------EDKIPLQQVVDIITGAIVKRYLTGK-NYGVAVIA
PFP_NAEFO         ALGIGKSAGSHLTLIPEEFLPTTDSTEPEVTFSRICDMIEASIIKRLYTSKKDHGVIVLA
PFP1_TRIVA        ALGMAEASGAHLCLIPEEFK------QDEIEFEDVVELVEATILKRLAYGK-NYGVCVLA
PFP2_TRIVA        ALGMAEASGAHLCLIPEEFK------QDEIEFEDVVELVEATILKRLAYGK-NYGVCVLA
PFP3_TRIVA        ALGMAEASGAHLCLIPEEFK------QDEIEFEDVVELVEATILKRLAYGK-NYGVCVLA
                  **.:..: .: : :* ***          : :  : ::: .:::**    :   *: : .

PFP_THEMA         EGIAEKMDPEELANIPGVIV-EKDPHGHLRLAEIPLATILKRAIERRYAERGERIHIVDV
A8F8M0_PSELT      EGIGEMIDPKELASIPGVVV-ETDPHGHIRLSEIPLATILKREIQKRFAQRDEKINIIDV
B5YIA7_THEYD      EGLSEKFDPEELSHYEQL---EKDETGRVRLSEIQLGRIMKNFVKKSLEDMGIKLTIVDK
I0AL84_IGNAJ      EGLVEHLNPGDLEDLVTV---ERDAHDNIRIAEINFGEILKAKVQERLKQFGLKATIVAK
Q08ST9_STIAD      EGLADCIIPEDLAKYTEL---PRDHMGNLHVADIQLGEVLEKGVKERLAGLGLKATLIPK
D1B7G6_THEAS      EGLMGKIPPEELEELKTAD---RDEHGHVRYGEVNFSDALRDRVKRTLRELGIKVTLNDK
I4BX58_ACEMN      EGLISKIPSQELAAIDSIE---KDDYGHVRYAEINFSDVLKKQLNGELKKMGIPISVQNK
C9LUB8_SELS3      EGVIEKIAPEDFQKLGNLV---LDEHGHIRYAELDFGEILKQAVLAEVKKIGIKIAIVDK
I0GNN8_SELRL      EGVIEKIAPEDFKKLGTVV---TDEHGHIRYSELDFGEILKQAVLAEVKKLGIKITVIDK
PFP_NAEFO         EGLLEYMSTDELKQAFGSSL-KYDAHDHIMLAELDFGRLVRDEMRERMNRRGLKIAFTEK
PFP1_TRIVA        EGLVSKMSKKALYKLFGNREPPTDPHGHILLDDAELARSLSEELLKRLGNLGIRITP--K
PFP2_TRIVA        EGLVSKMSKKALYRLFGNREPPTDPHGHILLDDAELARSLSEELLKRLGNLGIRITP--K
PFP3_TRIVA        EGLVSKMSKKALYRLFGNREPPTDPHGHILLDDAELARSLSEELLKRLGNLGIRITP--K
                  **:   :    :           *  ..:   :  :.  :   :       .        

PFP_THEMA         TIGYELRSARPIPFDIVYTRTLGYGAVRFLLGDYSD-LPGGMVCVVGGRIKILPFDAFMD
A8F8M0_PSELT      TLGYELRCARPTPFDIDYTRTLGYGAMRFLLGEYEENLTGGMVCLDNGRIRILPFEELID
B5YIA7_THEYD      NIGYELRSADPIPYDIEYTRNLGYGAVRYLL----RGGTGAMITFEEGHLRPIPFVELID
I0AL84_IGNAJ      NIGYELRCADPIPFDMEYTRDLGFAASQFILS----GGSGAMVSIQNGRFVPLYFNEILD
Q08ST9_STIAD      YIGYEVRCADPIPFDMEYTRDLGHCAARYIIQ----GGTEAVVAIINGQFQPLSFQTMKN
D1B7G6_THEAS      EIGYELRCAPPNAFDVEYTRNLGYGAFEFLQE----GGSGSMVTIQNNRIVPIPLEEIMD
I4BX58_ACEMN      EIGYEVRCAPPNPFDVEYTRNLGYGAFEFLAG----GGTNAVITIQNNQLTPIPFDEIVD
C9LUB8_SELS3      EIGYELRCAAPIAYDIDYARSLGYEAVQFLMR----GESGALITLQDNQAKPLFFDEIKD
I0GNN8_SELRL      EIGYELRCTAPIAYDIDYARQLGYSAVQFLMS----GDSGALISIQDNKAVPMRFEDIKD
PFP_NAEFO         NLGYELRCAPPNAFDREYTRDLGNGAVRYLLN----GGNGALITVQGVKMVPLSFDDLKD
PFP1_TRIVA        KIGYELRCADPVAFDAVYTRELGYGAIDAFLN----GHSAALIVRENGQVKPVQFKDLLD
PFP2_TRIVA        KIGYELRCADPVAFDAVYTRELGYGAIDAFLN----GHSAALIVRENGQVKPVQFKDLLD
PFP3_TRIVA        KIGYELRCADPVAFDAVYTRELGYGAIDAFLN----GHSAALIVRENGQVKPVQFKDLLD
                   :***:*.: * .:*  *:* **  *   :          .::     :   : :  : :

PFP_THEMA         PKTGRTKVRVVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHT
A8F8M0_PSELT      PSTGRTKVRMVDINSEHYRVARSYMIRLTRKDLQDEEMLSRLTRVARISREEFLEKFSKV
B5YIA7_THEYD      YRTGKVKIRKVDITSENYEVGRKYMIRLEAEDFEG-ERLKGLASVVKMSEKEFREKFFYV
I0AL84_IGNAJ      PKTNRTKVRMVDPSSESFYIARRYMLRLNQADFDDPHELAKLAATAGISIDEFRNQFYYL
Q08ST9_STIAD      PDTGMPRVRLVDVDSDRYQIARGFMLRLKREDFNKPEELARLATTTHLTPEAFRDQFFHL
D1B7G6_THEAS      PATGRTQQRPVNVESIQYRIARRYMIRLTPHDFQDPVALEALCRAARMDREAFVGRFRPL
I4BX58_ACEMN      PATGKMRIRLVDTNSLQYRIAKEYMIRLERGDFASEFLLNKMSRIANMTPQQFVEKYGYV
C9LUB8_SELS3      PETGKTRVRKVNIESVHYKIARGFMMRMEKADLDDP----GLANAYHMEKEEFKERYAYL
I0GNN8_SELRL      PATGKTMVRKVNIDSVHYQIARGLMMRLEKGDLDDP----GLANAYRMEPEEFKQRYSYL
PFP_NAEFO         PRTGKTRTRQVDVSSEGFQVAKRYMIRLEKKDFEKEETLKGLAATAKCSVEDFIKQFKYL
PFP1_TRIVA        PATGRVRTRLVDVTSQSFKVARVYMWRMSKKDYENKDLVARVAAAGKMTPEAFTEKFAHL
PFP2_TRIVA        PATGRVRTRLVDVTSQSFKVARVYMWRMSKKDYENKDLVARVAAAGKMTPEAFTEKFAHL
PFP3_TRIVA        PATGRVRTRLVDVTSQSFKVARVYMWR>--------------------------------
                    *.    * *:  *  : :.:  * *                                 

PFP_THEMA         TELP--------------------------------------------
A8F8M0_PSELT      AEI---------------------------------------------
B5YIA7_THEYD      TT----------------------------------------------
I0AL84_IGNAJ      IENDLLYKFIREGKIELASQDSNWAYNPPVPSRDAENELNGESMLPNL
Q08ST9_STIAD      VKDEP--EVTPDAGLKLMTQQ---------------------------
D1B7G6_THEAS      ADV---------------------------------------------
I4BX58_ACEMN      AGL---------------------------------------------
C9LUB8_SELS3      FE----------------------------------------------
I0GNN8_SELRL      FPEEPDVTAEA-------------------------------------
PFP_NAEFO         VQ----------------------------------------------
PFP1_TRIVA        TDVVVE------------------------------------------
PFP2_TRIVA        TDVVIE------------------------------------------
PFP3_TRIVA        ------------------------------------------------