CLUSTAL format seed alignment for MF_01980

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       -------------------------------------------------------MAPAL
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------MAAATL
PFPB2_ARATH       -------------------------------------------------------MASQL
Q5CUU9_CRYPI      ------------------------------------------------------MSNYKQ
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      ------MEKHKEKEGNPVQGKDTEMLNCLMQK-----LTSKNFLEEKEGKNRFYLVENKD
Q5CTQ1_CRYPI      MFLNGEMNRSQRNAIRRLRSLAVILEDTHIDKERSIPLISKAITSQKHIRRRDSIERNIA
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      -----------------------------------------------MDIENAQIHLSEL
                                                                              

PFPA1_ARATH       --------------MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAE
PFPA2_ARATH       --------------MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAK
PFPA_SOLTU        --------------MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAAD
PFPA_RICCO        --------------MDSDFGIPRELSDLQKLRSLYKPELPPCLQGTTVRVELGDGTTACS
PFPB1_ARATH       AVTRDLTAVG-SPENAPAKGRASVYSEVQSSRINNTLPLPSVLKGAFKIVE---GPASSA
PFPB_RICCO        --------MA-TPN---SGRAASVYSEVQSSRIEHVLPLPSVLNHPFKIVQ---GPPSSA
PFPB_SOLTU        SLLNNGELAS-SVKSPGTGRYAAVYSEVQNSRLDHPLPLPSVLGSPFKVVD---GPPSSA
PFPB2_ARATH       DLIGGDYIAGISINPPTNSRVTSVYSEVQASRIDHTLPLPSVFKTPFKIID---GPPSSS
Q5CUU9_CRYPI      TELKRNKGDSRDVSLLSASSLHEGQSNMQMWRRRWEPCLPHILRSPLSIKE---VSAFEG
PFP_TREPA         ----------------------MSISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTA
PFP_SPITD         ---------------------MTRISPLQKARYGYVPKLPPVLQDEIARIQAELGQPTEA
PFP_ENTHI         ----------------------MSLSALHKYRLQYKPVLPKHI-ADIDNITIEEGAKTQS
PFP_BORBU         ----------------------MNTSLFKQERQKYIPKLPNILKKDFNNISLVYGENTEA
PFP_PORGN         ----------------------MAKSALHLARMSYQPKMPASLQGAVKII---EGKATEA
PFP_GIAIC         ------------------------MSAFEVYRRKFKPALPRAIQGASYHLH--TEEKTHP
O84210_CHLTR      -----------------MELLSVNKSYFELQRLHYRPDTLSLLNSLCSMHIQ-EKPSSEP
Q7RPY3_PLAYO      VKIKKLK------EHGHSASLNDNLSPLQYERIKYKPTLPKALANEYQILDEDFGDEFIN
Q5CTQ1_CRYPI      TRLDSFKLSMGGKPHLHSADLFENFSPVQLERQKWVPTLPYSLSSNCIKIKEIEIPDLIQ
O84208_CHLTR      -----------------------MSSNKHASLCQKTPSLCRELQKAPALLLT-EDIRFKA
Q7RC66_PLAYO      QEERRKHKIALPGILKNKIVIKENDIILNNNEKELEPYFPNIIKNPLITLEIDNTNLENY
                                              .             :                 

PFPA1_ARATH       AADSH--TMARAFPHTLGQPLAHFLRETAQVPDAHIIT--ELPSVRVGIVFCGRQAPGGH
PFPA2_ARATH       AGDAH--IIARAFPHTLGQPLAHFLRATAKVADAQIIT--EHPVKRVGIVFCGRQAPGGH
PFPA_SOLTU        PSGEH--TIKRFFPHTYGQPLAHFLRATAKVPDAQIIT--EHPAIRVGVLFCGRQSPGGH
PFPA_RICCO        EAGAH--TISRSFPHTYGQPLAHFLRATAKVADAHIIS--EHPAMRVGVVFCGRQSPGGH
PFPB1_ARATH       AGNPD--EIAKLFPGLYGQ--PSVAVVPD-QDAPSSA-----PKLKIGVVLSGGQAPGGH
PFPB_RICCO        AGNPD--EIAKLFPNLFGQ--PSAMLVPDVADSLDSN-----QQLKIGLVLSGGQAPGGH
PFPB_SOLTU        AGHPE--EIAKLFPSLYGQ--PCVSLVPDDSGDVAMN-----QILKIGVVLSGGQAPGGH
PFPB2_ARATH       AGHPE--EIEKLFPNLFGQ--PSALLVPNQSNEVSSD-----QKLKIGVVLSGGQAPGGH
Q5CUU9_CRYPI      MGKMERSDVSAYFPLTSGNSLVKFEAISDGSSSWKKF-----PARRIGVVLSGGQASGGH
PFP_TREPA         VADYD--ALRSLFARTYGQPLVNFVNASEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGH
PFP_SPITD         VADRE--DLKRLFANTYGKPIATLTRGSNPEAG---------RRRTVGVILSGGPAPGGH
PFP_ENTHI         AVNQK--ELSELFKHTYGLPICNIVAGKNADIH---------RVIRCGFILSGGPAAGGH
PFP_BORBU         IQDRQ--ALKEFFKNTYGLPIISFTEGESSLSFS--------KALNIGIILSGGPAPGGH
PFP_PORGN         VSDKE--EIAAIFPRTYGLPLISFAPGGERTEY---------PPTNVGVILSGGQAPGGH
PFP_GIAIC         VADEQ--DIAALFPKTTHLPLLDIQPDTGAPKLL--------EPKRVGVIFSGGQAPGGH
O84210_CHLTR      ASDLL----AKHIPHLCALPDLTLQKDAPSSSE----------PLRIGVLLSGGQAPGGH
Q7RPY3_PLAYO      KNDYE--EIKKFFKSIDNLPMINVKETNNNELFKGGN------VLKIGIILSGGPAPGGH
Q5CTQ1_CRYPI      K-DEN--KLKELLPNTFGRPCIEITRDESKNSENSDH------ALRVGIVLSGGPAPGGH
O84208_CHLTR      LLNERIDSVAELFPCTYNSPYYKFISKSDLSAET--------SPLKVGVMLSGGPAPGGH
Q7RC66_PLAYO      NDHSWYQTMSTNISDPISKDNSTSNSFIKEMTNIYNDD----DIIKIGILFVGLQAPGGH
                              :                                  ..:: *  :.***

PFPA1_ARATH       NVIWGLFEALKVHNAKSTLLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQ
PFPA2_ARATH       NVVWGLYEALKVHNAKNTLLGFLGGSEGLFAQKTLEITDEVLQTYKNQGGYDMLGRTKDQ
PFPA_SOLTU        NVIWGLHDALKVHNPKNILLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQ
PFPA_RICCO        NVVWGLHNALKIHNPNSTLLGFLGGSEGLFAQKTLEVTDDILSTYKNQGGYDLLGRTKDQ
PFPB1_ARATH       NVISGLFDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDK
PFPB_RICCO        NVISGIFDYLQDRAKGSILYGFRGGPAGIMKCNYVQLTADYIHPYRNQGGFDMICSGRDK
PFPB_SOLTU        NVISGIFDYLQTHCKGSTMYGFRGGPAGVMKGKYVVLTPEFIYPYRNQGGFDMICSGRDK
PFPB2_ARATH       NVICGIFDYLQEYARGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGFDMICSGRDK
Q5CUU9_CRYPI      NVIAGLMSYIKLCNQSSQLFGFLGGPEGVYSGRYRELTEDDINGILNQGGFNIICSGRHK
PFP_TREPA         NVIAGLFDGLKRWHADSVLIGFLGGPAGVLSGDHIEICADRVDAYRNTGGFDLIGSGRTK
PFP_SPITD         NVICGLFDALKKANRESTLIGFKGGPSGILDDEWIEFTDSLINQYRNTGGFDIIGSGRTK
PFP_ENTHI         NVVAGLFDGLMKGNKENKLYGFRCGAGGILSNDYIEITAELVDKHRNTGGFDLVGSGRTK
PFP_BORBU         NVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTK
PFP_PORGN         NVIAGLFDEMKLLNPDSRLFGFLMGPDGLIEHKYRELTAEVIDEYRNTGGFDMIGSGRTK
PFP_GIAIC         NVLCGLYDKLQQIAPKSVLLGFQNGPKGLMTNKYVELTEKFLEPFRNMGGFHAIGSGRDK
O84210_CHLTR      NVVIGLFEGLRAFNKETKLFGFIKGPLGLIRGLYKDLDISVIYDYYNAGGFDMLSSSREK
Q7RPY3_PLAYO      NVISGIYDYAKRYNEESQVIGFLGGIDGLYSKNYVTITDNLMNKFRNLGGFNMLWSGRGK
Q5CTQ1_CRYPI      NVICGVYDFIKNHHPDSQLFGFLGGLDGLFKSTYKVISDELMDRFRNQGGFDMLWSGRGR
O84208_CHLTR      NVILGLLHSIKKLHPNSQLLGFIRNGEGLLNNNTVEITDEFIEEFRNSGGFNCIGTGRTN
Q7RC66_PLAYO      NVICGTLDYLKKKNKKNILYGFINGFDGINEYNFMELKNEYISMFRNSGGFDMINKGVKN
                  **: *           . . **  .  *:       .  . :    * **:. :     .

PFPA1_ARATH       IKTTE-QVNAALKACTDLKLDGLVIIGGVISNTDAAHLAEFFA-----------------
PFPA2_ARATH       IRTTE-QVNAALKACTDLKLDSLVIIGGVTSNTDAAHLAEFFA-----------------
PFPA_SOLTU        IRTTE-QVNAAMAACKALKLDGLVIIGGVTSNTDAAHLAEKFA-----------------
PFPA_RICCO        IRTTE-QVHAALTTCKNLKLDGLVIIGGVTSNTDAAQLAETFA-----------------
PFPB1_ARATH       IETPD-QFKQAEETAKKLDLDGLVVIGGDDSNTNACLLAENFR-----------------
PFPB_RICCO        IETPE-QFKQAEETAGKLDLNGLVVIGGDDSNTNACLLAENFR-----------------
PFPB_SOLTU        IETPE-QFKQAEETAKKLDLDGLVVIGGDDSNTNACLLAENFR-----------------
PFPB2_ARATH       IETPE-QFKQAEETVTKMDLDGLVVIGGDDSNTNACLLAEHFR-----------------
Q5CUU9_CRYPI      IETEE-QMRASLEICEKLKLHGLVVIGGDDSNTNAAVLAEYFK-----------------
PFP_TREPA         IESES-QFAAAAQTVTRMALDALVVVGGDDSNTNAALLAEHFV-----------------
PFP_SPITD         IETPE-QFAKALENAKKHGLDALVIIGGDDSNTNAALLAEYFV-----------------
PFP_ENTHI         IETEE-QFATAFKHITALKLNAMVVVGGDDSNTNAALLAEYFA-----------------
PFP_BORBU         IETEE-HYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFK-----------------
PFP_PORGN         LDKPE-QFEAGLEILRELDIKALVIIGGDDSNTNACILAEYYA-----------------
PFP_GIAIC         IAKPE-DFDAAAKTAKDNNLDIICIIGGDDSNTNACLLAEDFL-----------------
O84210_CHLTR      IKTKE-QKSAILATVKKMKLHGLLIVGGDNSNTDTAMLAEYFI-----------------
Q7RPY3_PLAYO      VRNKD-DLLAIENIVIKLKLNGLVIIGGDGSNSNAALIAEYLK-----------------
Q5CTQ1_CRYPI      INGEQ-DLERVEKVCEQLQLHGLIVIGGDGSNSNAALIADYMA-----------------
O84208_CHLTR      IITEE-NKARCLQTANELDLDGLVIIGGDGSNTATAILAEYFA-----------------
Q7RC66_PLAYO      IHENYINIKRCFKICRHLDLNGLIIVGGVDTSKEVAILSEYFEFVHNSVNKQNHDSDVAS
                  :     .            :. : ::**  :.. .. :::                    

PFPA1_ARATH       --------------------------------------------------------AAKC
PFPA2_ARATH       --------------------------------------------------------EAKC
PFPA_SOLTU        --------------------------------------------------------ETKC
PFPA_RICCO        --------------------------------------------------------EAKC
PFPB1_ARATH       --------------------------------------------------------SKNL
PFPB_RICCO        --------------------------------------------------------SKNL
PFPB_SOLTU        --------------------------------------------------------SKNL
PFPB2_ARATH       --------------------------------------------------------AKNM
Q5CUU9_CRYPI      --------------------------------------------------------RNSS
PFP_TREPA         --------------------------------------------------------NSGI
PFP_SPITD         --------------------------------------------------------QQGA
PFP_ENTHI         --------------------------------------------------------AHGS
PFP_BORBU         --------------------------------------------------------KNGE
PFP_PORGN         --------------------------------------------------------SIDA
PFP_GIAIC         --------------------------------------------------------KRGL
O84210_CHLTR      --------------------------------------------------------EHNC
Q7RPY3_PLAYO      --------------------------------------------------------ERNI
Q5CTQ1_CRYPI      --------------------------------------------------------KKNK
O84208_CHLTR      --------------------------------------------------------KHQA
Q7RC66_PLAYO      ITDTSNITNKSPSSIFIENQNNEFIDDNTYHQDDTYNIVSDISDEEVKKKYPKKIRRIKK
                                                                              

PFPA1_ARATH       STKVVGVPVTTNGDLKN-QFVEANVGFDTICKVNSQLISNACTDALSAEKYYYFIRLMGR
PFPA2_ARATH       STKVVGVPVTINGDLKN-QFVEANVGFDTTCKVNSQLISNICTDALSAEKYYYFVRLMGR
PFPA_SOLTU        LTKVVGVPVTLNGDLKN-QFVEANVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR
PFPA_RICCO        PTKVVGVPVTLNGDLKN-QFVETNVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGR
PFPB1_ARATH       KTRVIGCPKTIDGDLKC-KEVPTSFGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGR
PFPB_RICCO        KTRVIGCPKTIDGDLKC-KEVPTSFGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGR
PFPB_SOLTU        KTRVIGCPKTIDGDLKS-KEVPTSFGFDTACKIYAEMIGNVMIDARSTGKYYHFVRLMGR
PFPB2_ARATH       KTLVIGCPKTIDGDLKS-KEVPTSFGFDTACKIYSEMIGNVMIDARSTGKYYHFVRLMGR
Q5CUU9_CRYPI      STVVVGCPKTIDGDLKN-EVIETSFGYDTAVKTYSEQIGSIMDAIKTEGYGYYFVRLMGR
PFP_TREPA         STKVIGVPKTIDGDLKN-EAIETSFGFDTATKTYSELIGNIARDACSARKYWHFIKLMGR
PFP_SPITD         PIQVIGIPKTIDGDLKN-EYIEASFGFDTATKVYAELIGNIARDAISSRKYWHFIRLMGR
PFP_ENTHI         DCVFVGVPKTIDGDLKN-QYIETSFGFDTACKTYSELIGNIQRDAISSRKYWHFIKVMGR
PFP_BORBU         NIQVIGVPKTIDADLRN-DHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGR
PFP_PORGN         GIQVIGCPKTIDGDLKN-KQIETSFGFDTAAKVYSELIGNIQRDCNSARKYWHFIKLMGR
PFP_GIAIC         KTAVIGVPKTIDRDLYSTKGIECSFGFDSSTKVYAELIGNICYDCLSAKKYWHFIRLMGR
O84210_CHLTR      PTAVIGVPKTIDGDLKN-AWIETPLGFHTSCRTYSEMIGNLEKDVLSTRKYHHFVKLMGE
Q7RPY3_PLAYO      PISVIGVPKTIDGDLKS-ESIEISFGFDTATRTYSEIIGNLCTDVKTGNNVYHVVRVMGR
Q5CTQ1_CRYPI      NFCIVGVPKTIDGDLKN-PAIEVSFGFDTAARTYAECVGNLCSDICTSQNVYHFVRVMGR
O84208_CHLTR      KTVLVGVPKTIDGDLQH-LFLDLTFGFDTATKFYSSIISNISRDALSCKGHYHFIKLMGR
Q7RC66_PLAYO      KTKIISVPTSIHNEIKN-DKVECSLGFDTTIFTTCQYISYLMSYIQTYKKGYHFVKVIGN
                     .:. * : . ::     :   .*:.:     .. :.       :     :.::::*.

PFPA1_ARATH       KHSHVALECTLQSHPNMVILGEEVAASKLTIFDIAKQICDAVQARAVED-KNHGVILIPE
PFPA2_ARATH       KHSHVALECTLQSHPNMVILGEEVTASKLTIFDIIKQICDAVQARAEQD-KNHGVILIPE
PFPA_SOLTU        KASHVALECTLQSHPNMVILGEEVAASKLTIFDITQQICDAVQARAEHD-KNHGVILLPE
PFPA_RICCO        KASHVALECTLQSHPNMVILGEEVAASKLTLFDLTKQVCDAVQARAEQD-KYHGVILLPE
PFPB1_ARATH       AASHITLECALQTHPNITIIGEEVSAQKQTLKNVTDYMVDVICKRAELG-YNYGVILIPE
PFPB_RICCO        AASHITLECALQTHPNITIIGEEVAAKKLALKDVTDYIVDVICKRADLG-YNYGVILIPE
PFPB_SOLTU        AASHITLECALQTHPNVTLIGEEVFAKKLTLKNVTDYIADVVCKRAESG-YNYGVILIPE
PFPB2_ARATH       AASHITLECALQTHPNITIIGEEVFEKKLTLKNVTDNIVDVIYKRAENG-YNYGVILVPE
Q5CUU9_CRYPI      SASHITLECGLQTRANMILIGEEIKEENRSLMSIVDEIVEMILKRDSLG-KKHGIVLLPE
PFP_TREPA         SASHIALECALKTQPNVCLISEEVAAQSLTLAQIVQSLCDTIATRAQHG-EHFGIVLVPE
PFP_SPITD         SASHIALECALQTHPNVCIVSEEVREKNMTLSQIVDQIVDAVVKRAAKG-ENFGVVLVPE
PFP_ENTHI         SASHIALEAALETQPTYCIISEEVEDKKMTVSQIASEIADIVIERHKKG-LNFGVVLIPE
PFP_BORBU         SASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNG-DNFGVVIVPE
PFP_PORGN         SASHITLECALQTHPNICIVSEEVEANNYYLDDVVTYIAETVVRRSEAG-MNFGTVLIPE
PFP_GIAIC         SASHITLECGLQTHANICLVGEEILSKKMTSRQLFEYLADCVTKRADSG-KNYGVCLVPE
O84210_CHLTR      QASHSTLECGLQTLPNITLIGEEVAVQHASLQSLSLSIAQGLIERFHRG-KDYSTILIPE
Q7RPY3_PLAYO      SASHVVLECALQTRPNIVLIGEEVEKDKVPLKKIINNIVDVILKRHDLN-KNYGVILLPE
Q5CTQ1_CRYPI      SASHLALEVALQTRPNIVFIAEEVEQEGITLFEIVKNIVDLMEERSKMG-KMYGIILIPE
O84208_CHLTR      SSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICETIADRAAMG-KYHGVILIPE
Q7RC66_PLAYO      KSSHIALECFFQTKANIVLISEEIKKKKMTLNDIVNFITNSIKIRYKNGEKKYGIIIIPE
                    ** .**  ::: ..  ::.**:  .      :   : . :  *   .   ..  ::**

PFPA1_ARATH       GLIVSIPEVYALLKEIHGLLRQGVSA----------------------------------
PFPA2_ARATH       GLVESIPELYALLKEIHGLLKEGVQV----------------------------------
PFPA_SOLTU        GLIESIPEVYALLQEIHGLLRQGVSA----------------------------------
PFPA_RICCO        GLIESIPEVYALLKEIHGLLRQGVSP----------------------------------
PFPB1_ARATH       GLIDFIPEVQELIAELNEILANEV------------------------------------
PFPB_RICCO        GLIDFIPEVQNLIAELNEILAHDV------------------------------------
PFPB_SOLTU        GLIDFIPEVQQLIAELNEILAHDV------------------------------------
PFPB2_ARATH       GLIDFIPEVQQLISELNEVLAEGN------------------------------------
Q5CUU9_CRYPI      GLIEFIPEFETLIKELNLILLKTN------------------------------------
PFP_TREPA         GLIEFIPEMKALITELNEVMARRAQE---------------------------FEALDTP
PFP_SPITD         GLIEFIPEVGALIDELNTLLAKEAEV---------------------------FNRIDDP
PFP_ENTHI         GLVEFIPEVKALIKELNNLLAHKKEE---------------------------YSKITEF
PFP_BORBU         GLIEFIPEVKSLMLELCDIFDKNEGE---------------------------FKGLNIE
PFP_PORGN         GLIEFLPAMKRLIKELNEFLSQNDAE---------------------------FKLIKR-
PFP_GIAIC         GLIEFIPENNELFAYLNNTLLPHW----------------------------------TG
O84210_CHLTR      GLIKQIPDTKRLIQELNTLIAEGQ------------------------------------
Q7RPY3_PLAYO      GLIEFIPEIKILIEELNIILKTSNP-----------------------------------
Q5CTQ1_CRYPI      GLIEFIPEMKILIQELNEILDKLKYEG------------------------SECDQEASP
O84208_CHLTR      GVIEFIPEIQSLVKEIESIPEQEN------------------------------------
Q7RC66_PLAYO      GILKNVQDIKKLVNLCLHFKTEFIKNENAQNETTQNENTQNEKYYNPDLEYLYSPSKQIM
                  *::  :     *.                                               

PFPA1_ARATH       ----DKISTQLSPWSSALFEFLPPFIKKQLL---LHPESDDSAQLSQIETEKLLAYLVET
PFPA2_ARATH       ----DNISTQLSSWSSALFEFLPPFIKKQLL---LHPESDDSAQLSQIETEKLLAYLVET
PFPA_SOLTU        ----DKISSQLSPWASALFEFLPHFIRKQLL---LHPESDDSAQLSQIETEKLIAHLVET
PFPA_RICCO        ----NNISSQLSPWASALFEFLPPFIKKQLL---LYPESDDSAQLSQIETEKLLAHLVEA
PFPB1_ARATH       VDENGLWKKKLTEQSLKLFDLLPEAIQEQLM---LERDPHGNVQVAKIETEKMLIQMVET
PFPB_RICCO        VDEGGLWKKKLTSQSLQLFEFLPVAIQEQLM---LERDPHGNVQVAKIETEKMLIQMVET
PFPB_SOLTU        VDEAGVWKKKLTPQCLELFELLPLAIQEQLL---LERDPHGNVQVAKIETEKMLIQMVET
PFPB2_ARATH       VDEEGQWKKNLKKETLEIFEFLPQTIQEQLM---LERDPHGNVQVAKIETEKMLIQMVET
Q5CUU9_CRYPI      DRK--QIIDSLSQEMKTLFLELPSDVQNQLL---LERDPHGNVQVAKIATEELLVHMAKE
PFP_TREPA         DAQRVWIEQALSASARAVFNALPAEISTQLL---ADRDPHGNVQVSRIDTERLLILQVTE
PFP_SPITD         RERISWVKGKLSGNNQHVFSSLPETIQAQLL---MDRDPHGNVQVSRIETEKLLIEMVSS
PFP_ENTHI         SAQKAFVCENISESCAATFKNLPDNIAKQLL---LDRDPHGNVNVSAIETESFVSGIVKA
PFP_BORBU         KMKEIFV-AKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQS
PFP_PORGN         SAQRQYIKNKLSPENSRLYDSLPVDVARQLI---ADRDPHGNVQVSLIATEKLLADMTAQ
PFP_GIAIC         ELTADAVAAKLPDPLRTTFMAIPASIRTQLL---LDRDPHGNIAISQIETEKFLGAGVQQ
O84210_CHLTR      -FSVHNLDQQLSPMAIETFSSLPENIRDQLL---LDRDSYGNIRVSKIAIEELLASLVSK
Q7RPY3_PLAYO      ---SEPFDASKLKESRDLWNFLPQIIKDQLL---LDRESTGYIQVGKVATERLIINLVES
Q5CTQ1_CRYPI      DDFDKKICSCLSESSAKIWEYLPENIREQLL---LDREATGQIQVAKIATERLLILLVEA
O84208_CHLTR      ------LYQALSLSSQQLLCQFPEDICHQLL---YNRDAHGNVYVSKISVDKLLIHLVRQ
Q7RC66_PLAYO      NKFKTYIHTNMDKENLDLFQYFPLFFQNQFL----AEIFSDNFQYNNLGVEDLLAFLVKK
                                       :*  .  :::         .      :  : :.      

PFPA1_ARATH       EMNKRLKEGTYKGKK---------------------------FNAICHFFGYQARGSLPS
PFPA2_ARATH       EMNKRLKEGTYKGKK---------------------------FNAICHFFGYQARGSLPS
PFPA_SOLTU        EMNKRLKEGTYKGKK---------------------------FNAICHFFGYQARGSLPS
PFPA_RICCO        EMNKRLKEGTYKGKK---------------------------FNAICHFFGYQARGSLPS
PFPB1_ARATH       ELEKRKQAGAYKGQF----------------------------MGQSHFFGYEGRCGLPT
PFPB_RICCO        ELEKRKQQGTYKAHF----------------------------KGQSHFFGYEGRCGLPT
PFPB_SOLTU        ELDQRKQKGAYNAQF----------------------------KGQSHFFGYEGRCGLPS
PFPB2_ARATH       ELEKKKTEGTYEREF----------------------------MGKSHFFGYEGRCGLPT
Q5CUU9_CRYPI      KLERVKKDYILDNV-------------------------------KTHYFGYEGRCALPS
PFP_TREPA         RLAQMKQEGTYTGVF----------------------------SSIAHFFGYEGRCAFPS
PFP_SPITD         RLKALKEEGAYKGKF----------------------------SALNHFFGYEARCAFPS
PFP_ENTHI         EIVKR----GIKVPF----------------------------TPVHHFFGYEGRCAFPS
PFP_BORBU         RLNDMKKRGEYKGSF----------------------------TPVDHFFGYEGRSAFPS
PFP_PORGN         KLAEWAEEGRFQGRF----------------------------STLTHFFGYEGRCAMPS
PFP_GIAIC         VLRER----GSKTKF----------------------------TPLYHFFGYEGRCAAPS
O84210_CHLTR      EISKL----EPTMSF----------------------------SPVTHFLGYESRASFPS
Q7RPY3_PLAYO      ELAKLKNVNLNIHF-------------------------------MAHYLGYEGRCALPS
Q5CTQ1_CRYPI      ELHRRHGTSFYYDFEHGQTKETISDQVEISNKSNGSILMPFGFTMMHHYLGYEGRCAMPS
O84208_CHLTR      HLETHFRQVPFNAIS--------------------------------HFLGYEGRSGTPT
Q7RC66_PLAYO      QVEVEIDEIELITHY----------------------------------YGNEVTSALPT
                   :                                                * :   . *:

PFPA1_ARATH       KFDCDYAYVLGHICYHILAAGLNGYMATVTNLK---SPVNKWKCGATPITAMMTVKHWSQ
PFPA2_ARATH       KFDCDYAYVLGHVCYHILAAGLNGYMATVTNLK---SPVNKWKCGAAPISAMMTVKRWSQ
PFPA_SOLTU        KFDCDYAYVLGHVCYHILAAGLNGYMATITNLK---NPANKWHCGASPISAMMTVKRYGR
PFPA_RICCO        KFDCDYAYVLGHICYHVLAAGLNGYMATATNLK---NPVNKWRCGAAPIAAMMTVKRWAQ
PFPB1_ARATH       NFDATYCYALGYGAGVLLNSGKTGLISSVGNLA---APVEEWTVGGTALTALMDVE----
PFPB_RICCO        NFDSTYCYALGYAAGALLHSGKTGLISSVGNLG---APVAEWTVGGTALTSLMDVE----
PFPB_SOLTU        NFDSTYCYALGYGAGSLLQSGKTGLISSVGNLA---APVEEWTVGGTALTALMDVE----
PFPB2_ARATH       NFDATYCYALGYGAGSLLQSGKTGLISSVGNLA---APVEEWTVGGTALTSLMDVE----
Q5CUU9_CRYPI      NFDASYCFALGHTAAALIDNQRSGYMAVVRKLS---LTPEQWEPAGCPLTYMMNIE----
PFP_TREPA         NFDADYCYTLGLTACLLAVHRFTGYVASVRNLT---SSVAEWAVGGVPLTMLMNME----
PFP_SPITD         NFDADYCYALGFTAFVLIANGLTGYIAAIKNLA---RPAVEWKPMGIPLTMMMNME----
PFP_ENTHI         NFDSTYCYALGYTAFILLALKKTGQICCISGLQ---KPAEEWICGGVPLTIMMNME----
PFP_BORBU         NFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLN---LKPTDWIAGGVPLTMLMNME----
PFP_PORGN         NFDANYCYCLGRAASILIAAGKTGYMAAIKNTA---DPVSEWEAGGVPMTMMMNME----
PFP_GIAIC         DFDCSLCYSLGAVAAILGCNGKTGYMASLRNLV---RPPADWSPIGLPLTCLMNME----
O84210_CHLTR      NFDSNYGLALGIAASLFLVRGKTGYMVTIGNLA---EAYTEWTIAATPLYKMMHLE----
Q7RPY3_PLAYO      NFDSNYCYSLGYNAALLIDHKKTGYMSIIRNLK---NSYEDWIPAGIPFLRIMHVCKD--
Q5CTQ1_CRYPI      NFDSNYCYALGHCAGALVYKGMNGYLAVIRGLE---GNPLSWQACGISITRIMEVKKS--
O84208_CHLTR      HFDNVYSYNLGYGAGVLVFNRCNGYLSTIEGLT---SPIEKWRLRALPIVRMLTTKQ---
Q7RC66_PLAYO      NFDCAYSYILGFGCVEMIINKYNGYMCSVTNLKNILSNVNKIKIVGIPIYKFIKIEKKEK
                  .**      **  .  .     .* :              .    . .:  ::       

PFPA1_ARATH       DASY-----------TLTSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQ
PFPA2_ARATH       NSGS-------------TTIGRPVIHPASVDLKGKAYDLLRQNAQKFLMEDMYRNPGPVQ
PFPA_SOLTU        GPGK-------------ASIGVPALHPATVDLRGKSYELLSQNATKFLLDDVYRNPGPLQ
PFPA_RICCO        NPGA-------------TSIGKPAIHPAAVDLKGKAYELLRLNAVKFLMDDLYRNPGPLQ
PFPB1_ARATH       ---------------RRHGKFKPVIKKAMVELEGAPFKKFASLREEWALKNRYISPGPIQ
PFPB_RICCO        ---------------RRHGKFKPVIKKAMVELEGAPFKKFASLREEWALKNRYVSPGPIQ
PFPB_SOLTU        ---------------RRHGKFKPVIKKAMVELEGAPFKKFASKREEWALNNRYINPGPIQ
PFPB2_ARATH       ---------------RRHGKFKPVIKKAMVELEGAPFKKFASQREEWALKNRYISPGPIQ
Q5CUU9_CRYPI      ---------------LRKGKSVPVIKKYLVDLKGQSYLAYCQVRSEWKLNDYYRNPGPIQ
PFP_TREPA         ---------------RRHGSQKPVIKKALVDLEGMPFRVFSRRRASWALKTSYVYPGAVQ
PFP_SPITD         ---------------KRHGKMKPVIRKALVDLEGAPFKRFATQRDAWATESAYVFPGAIQ
PFP_ENTHI         ---------------QRNGEMKPVIKKALVEIEGKPFKFYQSKRAQWASAEDFVFPGAIQ
PFP_BORBU         ---------------ERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQ
PFP_PORGN         ---------------RRSGKMKPVIRKALVDMDGEPYRALREMRREWALSTEYVYPGPIQ
PFP_GIAIC         ---------------MRHGHKTPVIMKQMTDLNGNPYKLLARNRDTWLMNDDYQNPGPIQ
O84210_CHLTR      ---------------KRFNQETPVIKTDSVSPDAPMAKYLHKMKKICLLEDSYRFPGPLQ
Q7RPY3_PLAYO      ---------------NF-GKEYPAVKKYLVDLNSPLFNVLKQVRSLWSLYDLYRSPGPIQ
Q5CTQ1_CRYPI      ---------------RQDGQCYAAVTRQLVDLNGPLFKLLKQVRDIWKFQDLYRAPGPLQ
O84208_CHLTR      ---------------GKDSKHYPLIKKRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQ
Q7RC66_PLAYO      INCCENDNYNQLFIKEKNLGIKTKARTKKVSLNDEYFLTYKTLRSKYLESDNYRILSGIQ
                                        .      ..                     :   . :*

PFPA1_ARATH       YDGPG-------------------------------------------------ADAKAV
PFPA2_ARATH       YDGPG-------------------------------------------------ADAKAV
PFPA_SOLTU        FDGPG-------------------------------------------------ADAKAV
PFPA_RICCO        FEGPG-------------------------------------------------ADAKPI
PFPB1_ARATH       FTGPGS-------------------------------------------------DSLSH
PFPB_RICCO        FMGPGS-------------------------------------------------DAASH
PFPB_SOLTU        FVGPVA-------------------------------------------------NKVNH
PFPB2_ARATH       FKGPGS-------------------------------------------------DARNH
Q5CUU9_CRYPI      FDGPNSGVTNYMISPPR-------------VEDLLRME-------------DRCENKMSH
PFP_TREPA         YYGPP-----------------------------------------------AVCDEPSV
PFP_SPITD         YYGPD-----------------------------------------------DVCNQPTM
PFP_ENTHI         YFGPS-----------------------------------------------EVCDQPTK
PFP_BORBU         YFGSS-----------------------------------------------EIVDEITE
PFP_PORGN         FFGPE-----------------------------------------------HVCDSPTM
PFP_GIAIC         QIATESAEGT------------------------------------------AVCARPTI
O84210_CHLTR      YFEEQA-----------------------------------------------LVDQRPL
Q7RPY3_PLAYO      FNGYLSNSRCYTVKIPE-------------KDELLCQNSDELNIIIESTTKGNSGQTEDT
Q5CTQ1_CRYPI      FEGPCSETIPYIVRTPE-------------LQDLLC---------------GEDASVTDT
O84208_CHLTR      IHSPED---------------------------------------------AHSDDFPPL
Q7RC66_PLAYO      YNYYIKGDNEKLVSYYKSGNKMFTNDNILYKSKMENEICNRINFTIIGIHNDIENCEKKN
                                                                              

PFPA1_ARATH       SLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSN--GG
PFPA2_ARATH       SLCVEDQDYMGKIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVTDVLTTISSSSTSG
PFPA_SOLTU        SLCVEDQDYIGRIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSVISSPSS-V
PFPA_RICCO        TLCVEDQDYMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVLLTMSSTSLDG
PFPB1_ARATH       TLLLELGAQ---------------------------------------------------
PFPB_RICCO        TLLLELGSVA--------------------------------------------------
PFPB_SOLTU        TLLLELGVDA--------------------------------------------------
PFPB2_ARATH       TLMLELGAQA--------------------------------------------------
Q5CUU9_CRYPI      KLSGSESSQNRSKDDMKIQKILLSTASKFNDDLIISSSCRDLDAYIITKCLPHQTGRHNS
PFP_TREPA         TIRLERPAPAANSSFGHRSS----------------------------------------
PFP_SPITD         TLKLEQGLE---------------------------------------------------
PFP_ENTHI         TLLLEQN-----------------------------------------------------
PFP_BORBU         TLKLELLK----------------------------------------------------
PFP_PORGN         TLRLEKNDR---------------------------------------------------
PFP_GIAIC         TLIEEARK----------------------------------------------------
O84210_CHLTR      TLLWEKGKLSENNATKF-------------------------------------------
Q7RPY3_PLAYO      VISGKPSKENGDKNGEKNGEKNKEVQHQSGYKSLGCMSELQTSRLYNKLELPELCSDLKA
Q5CTQ1_CRYPI      DINIVQPNNGGGKRGVFN-------------RIQGTLSSLQLYRTTYRPPLPLLLTHLKA
O84208_CHLTR      ILFLNHNEWQKRCSICLEIPDQDY------------------------------------
Q7RC66_PLAYO      EIDTHNFDKKNEQNFNCNYYKHLNNLSKVENILTKGIIKFNTNLIRHNTTIQVIENNFGN
                   :                                                          

PFPA1_ARATH       Q-----------------------------------------------------------
PFPA2_ARATH       QQFA--------------------------------------------------------
PFPA_SOLTU        STPF--------------------------------------------------------
PFPA_RICCO        QKPL--------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      KILQLKEEEYSSGFTEIRENSQSKSSMGNSLACESLGLILSCLSTPGTQNVICGLVNGLP
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      KVRAGKQYISNDPYTQKQILSNYPNMSYENKFQIQEIFHDKYATPISFEIKIGIVFLSRQ
Q5CTQ1_CRYPI      RCKPTTQYNLSDPLIKRQITTCYPHLCNSNHFYCQEAQLDISSEEPNVGLRIGVLLMSRQ
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      KINCDTFNNINKITDFYIISENTINTKIMSKEMSKNITNNYHTNYNYMNRNDSIYSSFCK
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      SLKQLIVFKSLSDFSEGKALKVDLTSEGSLAFFENSLNSGGCIFPNGVEIKMNVSEKKSS
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      SPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLSNKYVIINDENIAKHLNQGGLELTGNSP
Q5CTQ1_CRYPI      APGIANVVWGLYHRLKMVRGRCLGFYGVKGFLQGKHITLTEKDVDLLPNQGGSELIGRTY
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      SVGVVMLSHVVPGVNNILVGLHQRLSINNLKLIGFIKGIKGLLNNETCIINDNNIKSSIN
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      NTTLKANDNQEFTNSSCVLSCKGLVSNDFLSQLLSFFNMRAIAIVGNSEAATFGASISEQ
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      EHSLFDEENR----------------------NKVCETVSKLQLNGLVMPGSNVTITEAA
Q5CTQ1_CRYPI      TECLVSKENL----------------------EKARKVCESLHLDGLVLCGSAFGMTQGA
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      LGGFPLLGNQISYNTDDNEIVHIYNLFNSDNIDKIIKSCENNKITNLVFIGDEKVISIMN
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      LICMSLNGMKSEIPVVFVPVCLENSISHQMIETCIGFDSVTKSISTLVGNLLTDSASATK
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      LLAEYFLEKKIHTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPK
Q5CTQ1_CRYPI      ILAEYFLQNNCNTKVVGVPATASNNLANDLVEACVGFDSSTKLYASLIGNVLTDAASMPK
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ILNEIFIKKNINIKIITVPISIYNSYDKNLIECSIGYHTTVHIISNIVSNIQRCSINLNK
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      YWYFMKMIGDKTSNVALEVGIQTHPNLVVIPERYADGKLSVYGSEMAGVTLDDIITEICD
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      YWHFIRLMGRSPSHEVLECALQTHPNMVIIAEEYGAADKTLWRVVQDIADVVCARAELGK
Q5CTQ1_CRYPI      YWHFIRLMGRQPSNEVLECALQTHPNVVIIAEEYGAADKTLVHIVEDVADVICKRAEFGK
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      YYYFVKIPANISSSLLLSIQLETHCNICCIGEPVVAGHLINLFTIVEHMSLVIIERINRK
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      IICLRSNQGNNFGGLLVSEGLFDQVYPTREYRKIFSRFSTQNLCNASNSGCEILGSES--
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      NYGTVLIPDALLMHLPHMKILLTEISDILNEASEKGE--------LIQARNDLVNLSNEK
Q5CTQ1_CRYPI      NFGTVLIPDALLSHLPDMKILISEINELRRFAEEHSEMKLFMSEMMSLGHSDHPTLSDHT
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      KNYGVILLTSNLLFCIKEFDDLCKDVDNNVKTEMEVAQIVNQEFVSDQ------------
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      ----------------------------------LSRYEKKVVEDFKLIFSDIDTRLIEN
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      IEKE---------------------------SPWISKLTPWSLALIKTFPQFIIKELLHV
Q5CTQ1_CRYPI      NSQEKSSRVDVADNKSSAANQEHSPTDSFDGSKYSSKMTPWSLALFKSLPRFIRREILSL
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ------------------------------------------------------------
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      LINSRKICDVRTEIILSALVQKELKFRRSKNKIKNGMNPVCFSFTDQVRACIPSDFDSTL
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      DLRSMRFEKLETEQLLLQMVKEELHQRKAKGKYSGVFMGLTHFFGYQGRSSLPSEFDCKL
Q5CTQ1_CRYPI      DVDSA-FSAIETEALLVLMIKKELKKRKQDNKYNGNFQPFTHFFGYQGRSAMPSQFDAKL
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ------------------------------------------------------------
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      GLMYGMLASKIINSNLVGGYVTGIKGVLSQTDSWNMYAIPISSLMTLNIEGDKIQDSRNN
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      AYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKLFAIPFISLMKILLRG----------
Q5CTQ1_CRYPI      GYALGHFASIVVESGLTGHLCSIRGLCGDVSDWRMTAIPFNCLMKIVP------------
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ------------------------------------------------------------
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      SNLSFESKKLLTESTLGNAGHQLEFICKLNSVNLRNNPSFKLLMNHIEKWEVDNTYANPG
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      -----------QGSKSLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDSSCNPG
Q5CTQ1_CRYPI      ------------SNDETHPELPSNIPTIPSSEVDLKGKAYRWLKIVQEHWAMQDRFCNPG
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ------------------------------------------------------------
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      PIQYFNLFKNLFNRTLFESEYVYTRNLKEMDQILLEIKTLCQLGVEKDILNSTIQHLKAI
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      PIQFEGNASNYYSRTLFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQLSGM
Q5CTQ1_CRYPI      PIQFDGAAANFYFRTLHEQQSEYYEMLKHVQNYAELVRETCTFGVNESFLKTAFVTLNGL
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ------------------------------------------------------------
                                                                              

PFPA1_ARATH       ------------------------------------------------------------
PFPA2_ARATH       ------------------------------------------------------------
PFPA_SOLTU        ------------------------------------------------------------
PFPA_RICCO        ------------------------------------------------------------
PFPB1_ARATH       ------------------------------------------------------------
PFPB_RICCO        ------------------------------------------------------------
PFPB_SOLTU        ------------------------------------------------------------
PFPB2_ARATH       ------------------------------------------------------------
Q5CUU9_CRYPI      QNSISIMSSCNHRKSKPEQIECIQKTNSIANYTSNLKCKSNNNETNLEMIVNNIINQETC
PFP_TREPA         ------------------------------------------------------------
PFP_SPITD         ------------------------------------------------------------
PFP_ENTHI         ------------------------------------------------------------
PFP_BORBU         ------------------------------------------------------------
PFP_PORGN         ------------------------------------------------------------
PFP_GIAIC         ------------------------------------------------------------
O84210_CHLTR      ------------------------------------------------------------
Q7RPY3_PLAYO      LVLAYKPNEIMQNMPSIGSIEDYYDWENQRKTDK--------------------------
Q5CTQ1_CRYPI      LNLRYRDGSLLSSLPDIGPIILQMKSNSGMLNNPTGQGETIEPIASELSNKAASNLHTSK
O84208_CHLTR      ------------------------------------------------------------
Q7RC66_PLAYO      ------------------------------------------------------------
                                                                              

PFPA1_ARATH       --------------------------
PFPA2_ARATH       --------------------------
PFPA_SOLTU        --------------------------
PFPA_RICCO        --------------------------
PFPB1_ARATH       --------------------------
PFPB_RICCO        --------------------------
PFPB_SOLTU        --------------------------
PFPB2_ARATH       --------------------------
Q5CUU9_CRYPI      N-------------------------
PFP_TREPA         --------------------------
PFP_SPITD         --------------------------
PFP_ENTHI         --------------------------
PFP_BORBU         --------------------------
PFP_PORGN         --------------------------
PFP_GIAIC         --------------------------
O84210_CHLTR      --------------------------
Q7RPY3_PLAYO      --------------------------
Q5CTQ1_CRYPI      YISQNNLHMAQSICPGVEEGPWNKTK
O84208_CHLTR      --------------------------
Q7RC66_PLAYO      --------------------------