CLUSTAL format seed alignment for MF_01981

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PFKA_TREPA        ------------------------------------------------------------
PFKA_BORBU        ------------------------------------------------------------
Q8EXU6_LEPIN      ------------------------------------------------------------
PFKA3_ARATH       --------------------MSTVES---------------------SKPKIINGSC---
PFKA7_ARATH       --------------------MSSPRS---------------------NKPKIVNGPG---
PFKA1_ARATH       -------------------MSSSVPN---------------------SDRKIVTGPA---
PFKA6_ARATH       -------------------MASNGVD---------------------EQIKLVEGPA---
PFKA4_ARATH       MEASISFLGSTKPNISLFNPSSNVLPRRDFPLPALKLKKVSVLPRILHQKRLIRAQCSDG
PFKA2_ARATH       ------------------------------------------------------------
PFKA5_ARATH       -MDALSQAISSGISVPYKNNSSSLVPSHGLTSLILRKSRSPVNPS--SRSRVSVRASEIQ
PFKA_AMYME        ------------------------------------------------------------
PFKA_LEIDO        --------------------------------------------------METR------
PFKA_TRYBB        ------------------------------------------------MAVESR------
PFKA_TRYBO        ------------------------------------------------MDEPSN------
PFKA_ENTHI        ---------------------------------------------------MSV------
                                                                              

PFKA_TREPA        -------MAHLPKE---------------YDFSIESLGESKI-----------PSPIYLS
PFKA_BORBU        -------MYRIKNEN--------------LDFKIDSLGECKQ-----------NNP-LID
Q8EXU6_LEPIN      -----------------------------METKIQNFGECSI-----------PSPADYE
PFKA3_ARATH       -------GYVLED----------------VPHLSDYLPGLPTYPN--------PLQDNPA
PFKA7_ARATH       -------GYILQD----------------VPHLIDYLPDLPTYPN--------PLQDNPA
PFKA1_ARATH       -------GYILED----------------VPHFSDDFPDHPTYPN--------PLQDNAA
PFKA6_ARATH       -------GYVLED----------------VPHLSDYILDLPTYPN--------PLQSNAA
PFKA4_ARATH       FKPEEDDGFVLED----------------VPHLTKFLPDLPSYPN--------PLKESQA
PFKA2_ARATH       --------MAAET----------------SIRKLPSLSGLRHRRN--------PLEDNPY
PFKA5_ARATH       HSKTSASSIDLSDPDWKLKYEKDFEQRFSIPHITDVLPDAEAIRSTFCLKMRSPTEDFVG
PFKA_AMYME        ------MTLHLDD------------------LRVRLLGECRY-----------DSPFAEV
PFKA_LEIDO        -----------------------------HHLNTKMVPSYQ--APLSKVTAADLTVERLP
PFKA_TRYBB        -----------------------------SRVTSKLVKAHR--AMLNSVTQEDLKVDRLP
PFKA_TRYBO        -----------------------------MSTTSSKIPQYDFYSDVDNLHPDQFRIQCLP
PFKA_ENTHI        -----------------------------KRRDHILIPKNP------DAPLPSLKIEEVG
                                                      .                       

PFKA_TREPA        HTLGDFI-----PNYVSDNEYISHELSARLGETVGPF--------THKNLMERAGPRQKI
PFKA_BORBU        FYASEGS-----SHFV--NEKNKIKFSVYRNEDKGDR--------YEDVLLEKAGPREKI
Q8EXU6_LEPIN      YYTSDTS-----RLIFRTVFQSKEDWNSYVQE--GP------------DFFEQAGPREKI
PFKA3_ARATH       YSVVKQ-------YFVDADDSVPQKIVVHKDGPR-------------GIHFRRAGPRQKV
PFKA7_ARATH       YSVVKQ-------YFVHADDSVPEKVVVHKDGPR-------------GVHFRRAGPRQKV
PFKA1_ARATH       YSVVKQ-------YFVDEDDTVPQKIVVHPDSPR-------------GTHFRRAGPRQRV
PFKA6_ARATH       YSVVRQ-------YFVDEDDTVQEKIVVHKDSPR-------------GTHFRRAGPRQKV
PFKA4_ARATH       YAIVKR-------TFVSSEDVVAQNIVVQKGSKR-------------GVHFRRAGPRERV
PFKA2_ARATH       FHPSNG-------FYITPSDVILAQVAYDHSAHSQS-----------RVAYHRAGPRREI
PFKA5_ARATH       GYPSDEEW----HGYINNNDRVLLKVISYSSPTSAGAECLDHDCSWVEQWIHRAGPREKI
PFKA_AMYME        LSTKRTSP----HYVAEGDRVLLEDTVAMLAEHSLPS--------VQAPSFEAAGPRRKI
PFKA_LEIDO        GCKYMNP----SKKHILREEYRDKVKHIMYDPRPQEDLDAEYPVSCNKLVCELAAARKHL
PFKA_TRYBB        GADYPNP----SKKYSSRTEFRDKTDYIMYNPRPRDEPSSENPVSVSPLLCELAAARSRI
PFKA_TRYBO        GRNFISPLVEQKKDFVKAHVIHDKDLDIMYDPMPK----GKCNISQSCLTLPLACPRVSL
PFKA_ENTHI        ECTIDNI-------YASPEPFVNGMTMKLSAVKNH-------GIERDSGEVELAGPMEKI
                                                                       * .   :

PFKA_TREPA        FFNPHHVHAGIVTCGGLCPGLNDVIRAIVRCLWGRYGVKRISGIRFGYKGLLPDYNFDIL
PFKA_BORBU        YFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGYQGLLPESNSPFI
Q8EXU6_LEPIN      YFNPQEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKRYSHQPI
PFKA3_ARATH       YFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGIDGGYRGFYAK---NTV
PFKA7_ARATH       YFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYMYGVKRILGIDGGYRGFYAK---NTI
PFKA1_ARATH       YFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGIDGGYRGFYAR---NTI
PFKA6_ARATH       YFKPSDVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVIGVDCGFRGFYSK---NTV
PFKA4_ARATH       YFRSDEVKACIVTCGGLCPGINTVIREIVCGLNNMYGVNNILGIQGGYRGFYSK---NTM
PFKA2_ARATH       MYEPSAVKAAIVTCGGLCPGMNTVIRELVVGLWELYGVREIYGIPAGYRGFYSM---KAV
PFKA5_ARATH       YFRPEEVKAAIITCGGLCPGLNDVIRHIVITL-EIYGVKNIVGIPFGYRGFSDKD-LTEM
PFKA_AMYME        YFDPARVTAGIVTCGGLCPGLNNVIRGLVQELSVHYRVKRIVGFRNG-PGLTAAHRDDTV
PFKA_LEIDO        HFNPSETSIGIVTCGGICPGLNDVIRSITLTGIISYRVKRVVGFRYGYWGLSKEGSKTAI
PFKA_TRYBB        HFNPTETTIGIVTCGGICPGLNDVIRSITLTGINVYNVKRVIGFRFGYWGLSKKGSQTAI
PFKA_TRYBO        HFDPSKTTVAMVTCGGVCPGLNDVIRGITLAAVCSYHVKKVIGFKYGYWGLSKAGRHTAI
PFKA_ENTHI        FYNPETTKVAIVTCGGLCPGLNNVIRGLVLNLYNRYHVNNIFGLRWGYEGLVPELS-EVQ
                   : .  .   : ****:***:* *** :.      * * .: *.  *  *:         

PFKA_TREPA        PLTPEVIDNCHKTGGSLLGTSRGGGNRVVDIVDGIERLNLHILFIIGGDGSQKGAKEIAD
PFKA_BORBU        NLNPDVVDDINKFGGTILGSSRGG-IKPVEIVDTLERMNINMIFNIGGDGTQKGSLLIAE
Q8EXU6_LEPIN      ELTPEKVAHIVDEGGSMLSSSRGN-QSPEEMVDSLSFYGVKILFCIGGDGTLRGARTIVD
PFKA3_ARATH       SLDSKVVNDIHKRGGTILGTSRGG-HDTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFE
PFKA7_ARATH       PLNSKVVNDIHKRGGTIIGTSRGG-HDTNKIVDSIQDRGINQVYIIGGDGTQRGASVIFE
PFKA1_ARATH       HLDLKTVNDIHRSGGTILGTSRGG-HNTTKIVDSIQDRGINQVYIIGGDGSQKGAAAIFE
PFKA6_ARATH       ALTPKTVSDIHKRGGTILGTSRGG-HDTSKIVDNIQDREINQVYIIGGDGTQKGANAIYK
PFKA4_ARATH       NLTPKVVNDIHKRGGTFLQTSRGG-HDTAKIVDNIQDRGINQVYIIGGGGTQKGAEKIYE
PFKA2_ARATH       KLDPKAVHDWHKKGGTVLATSRGG-FHLQKIVDAIHLNGYNQVYIIGGDGTMRGAVEIFK
PFKA5_ARATH       PLSRKVVQNIHLSGGSLLGVSRGG-PSVSEIVDSMEERGINMLFVLGGNGTHAGANAIHN
PFKA_AMYME        ELTPEVVRDIHNLGGTILGSSRGG-QDADEMVETLALHGVDVMFVIGGDGGMRAATFLSG
PFKA_LEIDO        ELSRSDVRQIHRFGGTILGSSRGP-QNPKEMVDTLVRMKINILFTVGGDGTQRGALTIYE
PFKA_TRYBB        ELHRGRVTNIHHYGGTILGSSRGP-QDPKEMVDTLERLGVNILFTVGGDGTQRGALVISQ
PFKA_TRYBO        ELTSNIVRGLRHLGGTFLGTSRGG-QNISDMVDTLVEYGVNILFTIGGDGTQKGAVAISE
PFKA_ENTHI        RLTPEIVSDIHQKGGSILGTSRGA-QSPEVMAQFLIDNNFNILFTLGGDGTLRGANAINK
                   *    :      **:.:  ***       :.: :     . :: :**.*   .:  :  

PFKA_TREPA        EIKHRNLKISIIGIPKTVDNDISFVQKSFGFDTAIVKATEAVAAAHMEARSQINGIGLVK
PFKA_BORBU        EIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEANSAYNGIGLVK
Q8EXU6_LEPIN      EIAKRKEKISVVGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECAHVEAKGAPNGIGLVK
PFKA3_ARATH       EIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVK
PFKA7_ARATH       EIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVK
PFKA1_ARATH       EIRKRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVK
PFKA6_ARATH       EIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGIVK
PFKA4_ARATH       EVERRGLQVAVSGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVK
PFKA2_ARATH       EISLRKLEVGITVIPKTVDNDVGIIDRSFGFQTAVEMAQEAISAAHVEAESAVNGIGLVK
PFKA5_ARATH       ECRKRKIKVAVVGVPKTIDNDILHMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGIGVVK
PFKA_AMYME        AIRARGLDIAVIGVPKTIDNDLPFTDQSFGFQSAFARATDFISAVSVEAAASPNGVGIVK
PFKA_LEIDO        EAKRPGENIAVFGVPKTIDNDLAFSHRTFGFQTAVEQAVNAVRAAYAEAVSLNYGVGIVK
PFKA_TRYBB        EAKRRGVDISVFGVPKTIDNDLSFSHRTFGFQTAVEKAVQAIRAAYAEAVSANYGVGVVK
PFKA_TRYBO        EVNRRGLDIAVFGIPKTIDNDLSFSQRTFGYETAVSEAVIAIRAAHAEAISHEYGVGIVK
PFKA_ENTHI        ELRRRKVPITVVGIPKTIDNDICYTDSTFGFQTAVGLSQEAINAVHSEAKSAKNGIGIVR
                          : :  :***:***.   . :**:.:*.  :   :  .  *. .   *:*.*:

PFKA_TREPA        LMGRESGFIATYTAIASHETNFVLIPEVSFDLDGPNGLLAHLEKRIALRK------HAVL
PFKA_BORBU        VMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEKESLEEIPHAVI
Q8EXU6_LEPIN      LMGRHSGFIAVNAALASRNVNYCLIPEVDFDLFGNEAFLDDLKKRIQKKG------HAVI
PFKA3_ARATH       LMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESG------HMVL
PFKA7_ARATH       LMGRYSGYIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFIERRLKDHG------HMVI
PFKA1_ARATH       LMGRYSGFIAMHATLASRDVDCCLIPESPFFLEGSGGLFEFIDKRLKESG------HMVI
PFKA6_ARATH       LMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENG------HMVI
PFKA4_ARATH       LMGRYSGFIAMIATLANRDVDCCLIPESPFFLEGKGGLFEFIEERLKENR------HMVI
PFKA2_ARATH       LMGRSTGHIALHATLSSRDVDCCLIPEMDFYLEGKGGLFEFLEKRLKERG------HAVL
PFKA5_ARATH       LMGRNSGFIAMQASLASGQVDICLIPEVPFNLHGPNGVLKHLKYLIETKG------SAVI
PFKA_AMYME        LMGRHSGFIAAYAALAANSADVVLIPEVPFALDGDDGLLAHVERLVRAKG------FAVV
PFKA_LEIDO        LMGRESGFIAAQTTVASAQANICLIPENPLPKE---TVMRLIERRLQQSR------NCVI
PFKA_TRYBB        LMGRDSGFIAAQAAVASAQANICLVPENPISEQ---EVMSLLERRFCHSR------SCVI
PFKA_TRYBO        LMGRNSGFIAASATVASALSHICLIPEKNVSKK---VLLSLIEARFMMAK------DIVI
PFKA_ENTHI        LMGRDAGFIALYASLANGDANLVLIPEIDIPIT---QICEFVGKRIMSKG------HVVI
                  :*** :*.**  ::::    .  *:**  .       .   :   .            *:

PFKA_TREPA        VVAEGAGQDLMVNADGVPSGDSQGGSLRVSSGTDASGNKRLADIGLFLKEKIGVYFKEK-
PFKA_BORBU        LIAEGAGQKYF---DHFPKK------------KDDSGNLLYEDIGLYIKDKITEYFKAK-
Q8EXU6_LEPIN      IVAEGAGQKFF---DSTEER-------------DSSGNLKLKDIGLFLKDTMTEFFKKE-
PFKA3_ARATH       VIAEGAGQDLMSKSM-ESMT-----------LKDASGNKLLKDVGLWLSQSIKDHFNQK-
PFKA7_ARATH       VLAEGAGQDLMCKSM-ESTP-----------M-DASGNKLLKDVGLWLSQSIKDHFKKN-
PFKA1_ARATH       VIAEGAGQDLLSESMKESTT-----------LKDASGNKLLQDIGLWISQRIKDHFAK--
PFKA6_ARATH       VIAEGAGQDLVAESI----E-----------QQDASGNKLLKDVGLWMSLKIKEYFAKHN
PFKA4_ARATH       VIAEGAGQDYVAQSM-RASE-----------TKDASGNRLLLDVGLWLTQQIKDHFTNVR
PFKA2_ARATH       VVAEGAGQEMIPRNE-SQKQ-----------ERDESGNAVFLDVGVWFKSVLKAWWEREH
PFKA5_ARATH       CVAEGAGQNFLEKTN----------------AKDASGNAVLGDFGVYIQQETKKYFKEI-
PFKA_AMYME        VVAEGAGQDLFDAHGLPQLN---------GRGTDASGNVKLGNIGELLRTSIEAHLTAA-
PFKA_LEIDO        VVAEGFGQDWETGTG----------------GHDASGNKKLVDIGFILKKEVESWLRANK
PFKA_TRYBB        IVAEGFGQDWGRGSG----------------GYDASGNKKLIDIGVILTEKVKAFLKANK
PFKA_TRYBO        VVAEGFGQDWPDCNEDL--------------GSDASGNKRLTDIGLVIKKIVQDHLSKN-
PFKA_ENTHI        VVAEGALQNQKPKDLDL--------------GTDKSGNILHWDSINYLRDSITKYLKSI-
                   :***  *.                        * ***    :    :            

PFKA_TREPA        --RIHINLKYIDPSYLIRSAVAAPIDSIYCERLGNNAVHAAMCGKTKMIIGLVHNKFVHL
PFKA_BORBU        --NIQFTLKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKMLISLWSTKFVHI
Q8EXU6_LEPIN      --NIPVNIKYIDPSYIIRSIPANAEDSVFCGFLAQNAVHAGMAGKTDMVVGMWNNVFTHL
PFKA3_ARATH       --KMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYI
PFKA7_ARATH       --KMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYI
PFKA1_ARATH       --KMTLTLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYI
PFKA6_ARATH       --VMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYI
PFKA4_ARATH       --KMMINMKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYSGFTVGPVNSRHAYI
PFKA2_ARATH       -PDELFTVKYIDPTYMIRAVPANATDNLYCTLLAHSAIHGVMAGYTGFVPGPINGNYAYI
PFKA5_ARATH       --STPIDVKYIDPTYMIRAVRANASDGILCTVLGQNAVHGAFAGYSGITVGIINTHYAYL
PFKA_AMYME        --GLAPTMRYIDPSYAIRSIPANAYDSVYCLRLAHAAVHAAMAGRTEAAVARWRRRFVHV
PFKA_LEIDO        EKFPQGTVKYIDPSYMIRACPPSSNDALFCTNLATLAVHEAMAGATGCIISMRYNNYILV
PFKA_TRYBB        SRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHNNYILV
PFKA_TRYBO        PKYHQSTVKYIDPSYMIRACPASTSDAAFCSNLSTLAVHEAMAGRTACLITLWYSNFVLV
PFKA_ENTHI        -GIEEHTIKFVDPSYMIRSAPCSAADAHFCMCLANAAVHVAMAGKTGLVICHHHNNFVSV
                         ::::**:* **:    . *   .  *.  *:*  :.* .             :

PFKA_TREPA        PIDVVVCQRKHVNPE-GSLWRDALDATGQPIVMKNII-----------------------
PFKA_BORBU        PIKMAVIDRNKVNPN-GSFWRDVLSSTGQPISMKN-------------------------
Q8EXU6_LEPIN      PISVAIQERKVLQPDRSTLWRSLLASTGQPAHMLAK------------------------
PFKA3_ARATH       PFYRITEKQNHVVIT-DRMWARLLSSTNQPSFLGPKDVFD-NKEKPMSALLDDGNCNGVV
PFKA7_ARATH       PFYRITETQNNVVIT-DRMWARLLSSTNQPSFLGPKDTSEEKKELPETPLLDDG----AV
PFKA1_ARATH       PFNRITEKQNKVVIT-DRMWARLLSSTNQPSFMKQADKIHSNQLVGEPGTMKW-------
PFKA6_ARATH       PFNRITERQNKVVIT-DRMWARMLSSTNQPSFMNPP--------KGTTEFTD--------
PFKA4_ARATH       PISQVTEVTNTVKLT-DRMWARLLASTNQPSFLTGEGALQNVIDMETQEKIDNMKISSI-
PFKA2_ARATH       PLEEVAQTKNQVNTR-DHKWAWVRSVTNQPDFETNVKG----------------------
PFKA5_ARATH       PITEVIAYPKSVDPN-SRMWHRCLTSTGQPDFI---------------------------
PFKA_AMYME        PFSLMTRRRNQVDPD-GDLWMSVLETTCQPAEFGAVAARERISSGFC-------------
PFKA_LEIDO        PIKAATSVRRVVSLR-GALWRQVREITVGLSDDVQQWNEQDLRRHLESLNVERERIIARL
PFKA_TRYBB        PIKVATSVRRVLDLR-GQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRLHEEL
PFKA_TRYBO        PIKTAVSHRKIVSTG-GALWRQVREVTVDGSGDIAMVHQQELSRELKAINAHRNSIMEQL
PFKA_ENTHI        PIDRTSYYIKRVNTD-GPLYTMMTAIEKPK------------------------------
                  *:       . :    .  :                                        

PFKA_TREPA        -----------
PFKA_BORBU        -----------
Q8EXU6_LEPIN      -----------
PFKA3_ARATH       DVPPVTKEITK
PFKA7_ARATH       DIPPVTKEVTK
PFKA1_ARATH       -----------
PFKA6_ARATH       -----------
PFKA4_ARATH       -----------
PFKA2_ARATH       -----------
PFKA5_ARATH       -----------
PFKA_AMYME        -----------
PFKA_LEIDO        ASKV-------
PFKA_TRYBB        AKL--------
PFKA_TRYBO        SKL--------
PFKA_ENTHI        -----------