CLUSTAL format seed alignment for MF_01982

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MENG_THEEB            ------------------------------------------------------------
K9RUE5_SYNP3          ------------------------------------------------------------
A8I8C3_CHLRE          ----------------MRCLESSQRGVALGRGRAAAPFRRVHSSVRLGVVRVATDDAALP
Q7NPC8_GLOVI          ------------------------------------------------------------
U5QLV6_9CYAN          ------------------------------------------------------------
MENG_ARATH            ---------------------------------MAAL-LGIVSPVTFTGKH--PVNS-RS
D7KNF1_ARALL          ---------------------------------MAALVLGIVSPVTFTGKL--LPNS-RS
M4DIM2_BRARP          ---------------------------------MASL-LGIVFPVTFPRHG--QLPV-KT
A0A087HQM5_ARAAL      ---------------------------------MTVL--GLALPVTFTGQQ--LPVTSRS
D7TDK4_VITVI          ---------------------------------MASLHFLLR---PSSNPN--LLAL-PS
B9HLS4_POPTR          ---------------------------------MASLQLQLSFGYQSSSCR--HLPI-ST
M1BTJ6_SOLTU          ---------------------------------MASLHVALSSLPGP---------SFRP
A0A3Q7JU43_SOLLC      ---------------------------------MASLHVPLSSLPRP---------SFRP
M0SED0_MUSAM          ----------MGAVNGPAPPPSAVRHLHSASWSPSSLPIRCSSLGLPRRPFLFLLRSPRR
I1JC50_SOYBN          -----------------------------------------------MAMTFVPS-TSSS
G7K058_MEDTR          ----------------------------------MYFNLTRESCECCVAEMFPAVAPYPS
K7TQN1_MAIZE          ---------------------------------MVALTAGISVATGVVFSP-AGRRRGRG
C5YBW2_SORBI          ---------------------------------MVALTAGISVAAGVVFSP-AGRRRGRG
B8ARR3_ORYSI          ---------------------------------MATLAAAISAGPAAPAPA-ARRRRRGG
Q7X6S1_ORYSJ          ---------------------------------MATLAAAISAGPAAPAPA-ARRRRRRG
J3LZF4_ORYBR          ---------------------------------MAALTAAISSTPAAPGPA-ARRRR---
A9T5P7_PHYPA          MVVSSSFCVGRSSIHGTRLGHCKETERIACGFNPVRSEFTRRISASVTLPSVDDRVDRKP
MENG_SYNY3            ------------------------------------------------------------
D3EMS0_ATETH          ------------------------------------------------------------
K9YQ14_CYASC          ------------------------------------------------------------
K9Z0K4_CYAAP          ------------------------------------------------------------
B7KG10_GLOC7          ------------------------------------------------------------
E0U743_GLOV7          ------------------------------------------------------------
B0JPN2_MICAN          ------------------------------------------------------------
MENG_NOSS1            ------------------------------------------------------------
MENG_TRIV2            ------------------------------------------------------------
MENG_NOSP7            ------------------------------------------------------------
K9W3A1_9CYAN          ------------------------------------------------------------
K9SJ07_9CYAN          ---------------------------------------------------MTNLINKTT
K9SS97_9SYNE          --------------------------------------------------MISDFVASSE
Q10XM7_TRIEI          ------------------------------------------------------------
B8HKE0_CYAP4          ------------------------------------------------------------
MENG_SYNE7            ------------------------------------------------------------
MENG_SYNP6            ------------------------------------------------------------
Q2JPD0_SYNJB          ------------------------------------------------------------
K9P6F5_CYAGP          ------------------------------------------------------------
Q7U5M9_SYNPX          ------------------------------------------------------------
A5GMN3_SYNPW          ------------------------------------------------------------
A5GRH5_SYNR3          ------------------------------------------------------------
Q46GY8_PROMT          ------------------------------------------------------------
Q7V2P1_PROMP          ------------------------------------------------------------
Q7VDF0_PROMA          ------------------------------------------------------------
                                                                                  

MENG_THEEB            -----------MTNIQALFERIAPLYDRLNDQLSFGLHHVWKQMAVDWLELPQGATALDL
K9RUE5_SYNP3          ---MELTSSPTPSQVQALFNRIAPVYDPLNDWLSLGLHRVWKQMAVKWSQVQPGQSALDV
A8I8C3_CHLRE          GPQGAFVPGQEAEARQGIFNRIAPVYDELNNNLSFGQHWVWKQMTVKWSGAKPGGKALDV
Q7NPC8_GLOVI          --------MQGSQEIQGIFNAIAPVYDQINDRMSFGLHRVWKKMAIRWTDCKPGDTVLDL
U5QLV6_9CYAN          --------MSERSEILRIFNAIAPVYDRLNDQMSFGLHRVWKKMAVAWTECPAGGTALDL
MENG_ARATH            RRRTVVKCS---NERRILFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGAKKGDYVLDL
D7KNF1_ARALL          RRRMVVKCS---NERRILFNRIAPVYDNLNDLLSFGQHRIWKNMTVSWSGAKTGDNVLDL
M4DIM2_BRARP          RRRSVVKSSSSSDERQTLFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGARTGDKVLDL
A0A087HQM5_ARAAL      RHSLVVKCS---SERQILFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGAKTGDHVLDL
D7TDK4_VITVI          RSRP-VQCAN---ERQALFSRIAPVYDNLNDFLSLGQHRIWKRMAVSWSGAKRGDDVLDL
B9HLS4_POPTR          FSYPSIRCAN---DRQLLFNRIAPVYDNLNDLLSLGQHRIWKRMAVSWTGAKLGDCVLDL
M1BTJ6_SOLTU          TGKLVIRCSA---DRQALFNRIAPVYDNLNDLLSLGQHRIWKRMAVSWSGAKEGDDVLDI
A0A3Q7JU43_SOLLC      TGKLLIRCSA---DRQALFNRIAPVYDNLNDLLSLGQHRIWKRMAVSWSGAKEGDTVLDI
M0SED0_MUSAM          LGNNRVRCSA---ERHALFNRIAPVYDNLNDMLSLGQHRSWKRMCVSWSGAKRGNRVLDL
I1JC50_SOYBN          FRPTLIRCANS-NERRALFSRIAPVYDNLNDLLSLGQHRIWKRMAVSWTGAKMGDRVLDV
G7K058_MEDTR          YRPTSIRCS---NDRQALFNRIAPVYDNLNDLLSLGQHRIWKRMAVSWTEAKKGDRVLDV
K7TQN1_MAIZE          HAAFRCSSSSAG-ERQALFSRIAPVYDHLNDVLSLGQHRTWKRICVSWSRAKMGDRVLDL
C5YBW2_SORBI          PDAFRCSASSAG-ERQALFSRIAPVYDLLNDVLSLGQHRTWKRICVSWSRVKMGDRVLDL
B8ARR3_ORYSI          FAAVSCGSSSADDERQALFRRIGPVYDHLNDVLSLGQHRTWKRICVSWSRARRGDRVLDL
Q7X6S1_ORYSJ          FAAVSCGSSSAADERQALFSRIAPVYDHLNDVLSLGQHRTWKRICVSWSRARRGDRVLDL
J3LZF4_ORYBR          FFAVRC-SSSAADERQVLFSRIAPVYDHLNDVLSLGQHRTWKRICVSWSRAKRGDRVLDL
A9T5P7_PHYPA          LVSTEQVGATEVGQRQQLFNKVAPMYDSLNDWLSLGQHRVWKRMAVAWSGAKRGDRVLDI
MENG_SYNY3            -MSNSLLTQPTQESVQQIFARIAPQYDDLNTFLSFGQHHIWKAMAVKWSGVSPGDRLLDV
D3EMS0_ATETH          -MNN---ISYSATDVQNIFNNIAPVYDELNTLLSMGQHKIWKQMTVKWSGSGLHDLGLDI
K9YQ14_CYASC          -MTSS--TKPTDKEIQNIFNNIAPIYDQMNNWLSFGVHHVWKKMAVKWSNAQPHHQGLDL
K9Z0K4_CYAAP          -MKST--PQP--QEIQEMFNRIAPVYDSLNDWLSLGLHRIWKLMAVKWTNPQPQSVALDL
B7KG10_GLOC7          -MIEE--AVPNASEIKAIFDRIAPVYDQMNHSLSLGQHRIWKQMTVKWSQAKPGNIALDV
E0U743_GLOV7          -MLNE--ALPDASEIKALFDRIAPVYDQMNNWLSLGQHRIWKQMTVKWSEPRPGDRGLDV
B0JPN2_MICAN          -MSNQ--SSPNSTEIQAIFDQIAPEYDRLNQELSLGLHRVWKLMTVKWCQPEKGDFALDI
MENG_NOSS1            ----------MTNKIRAIFDRIAPVYDQLNDWLSLGQHRIWKEMAIKWTGAKPGDTCLDL
MENG_TRIV2            ----------MTNEIRAIFDRIAPVYDQLNDWLSLGQHRIWKEMAIKWTGAKPGDTCLDL
MENG_NOSP7            ----------MTNEVQSIFNRIAPVYDQLNDWLSLGQHRIWKEMAVKWSAAKSGNTALDL
K9W3A1_9CYAN          ---MTTKISSNSAEIRDIFERIAPHYDQLNDWLSLGQHRIWKKMAVKWASPKPGDTCVDL
K9SJ07_9CYAN          DATDAK-DKPQASEVRQIFDRIAPVYDQLNDWLSLGQHRVWKKMAVNWAQPQPGDKFLDL
K9SS97_9SYNE          QTSQQLSQQPSQQEVQELFNQIAPMYDRLNDWLSLGQHRVWKKMAIAWTNPKAGDTYLDL
Q10XM7_TRIEI          -------MTDDSIEVKAIFNKIAPVYDQLNDLLSLGIHKVWKQMAVRWSEPDYGSTCLDL
B8HKE0_CYAP4          ----------MNHPVQDLFDRIAPVYDGLNDWLSLGQHRIWKRMTVKWSEAREGDTCLDL
MENG_SYNE7            ------MSVLAPDAVEGLFDQIAPIYDNLNDQLSFGLHRLWKRMAVKWSAAKPGDRVLDL
MENG_SYNP6            ------MSVLAPDAVEGLFDQIAPIYDNLNDQLSFGLHRLWKRMAVKWSAAKPGDRVLDL
Q2JPD0_SYNJB          ---MPSPTFEQPEEIRALFDRIAPHYDSLNQTLSLGLHQVWKRMAVRWSGASSGGYVLDL
K9P6F5_CYAGP          ------MATVDPRQISDLFDTIAPRYDQLNDLLSLGLHRLWKRQTLLWLRPRPGQRLLDL
Q7U5M9_SYNPX          ------MKPGDPAAVEQLFDSVASRYDQLNDLLSLGLHRQWKRQLQCLLRPAAGETWLDL
A5GMN3_SYNPW          ------MKPGDPEAVEQLFNDAAPTYDRLNDLLSFGLHRQWKRQMLLDLAPRSGESWLDL
A5GRH5_SYNR3          -------MPAEAQAVRQLFDEVAPHYDRLNDLLSLGLHRLWKREMVQRLAPVAGEQWLDL
Q46GY8_PROMT          ------MRPGNTKAIEEMFNSISSKYDFLNDIFSFGLHRFWKTRLLDILNPTFGEKWIDL
Q7V2P1_PROMP          ------MRYKKTNEVKSIFNNISCSYDFLNSLLSLGLHKYWKKTLVDLLKPINGENWADL
Q7VDF0_PROMA          ------MKPQDPIAIKELFDSVSKNYDFLNDLFSLGFHRIWKRQLLTWLKPASGEKWIDL
                                       :*   .  ** :*  :*:* *  **                *:

MENG_THEEB            CCGTGDLTRLLARRVG---RQGRVVGLDFAAAPLAIARQRSD---------HYPQIEWLQ
K9RUE5_SYNP3          CCGSGDLALLLARRVG---IQGQVVGLDFSTAQLEMAKIRSR---------GLGQIKWIQ
A8I8C3_CHLRE          CCGSGDIAFLLSRAVG---TKGEVTGLDFAAEMLEDASARQDEQRREGTAQGRANITWVQ
Q7NPC8_GLOVI          CCGTGDLAFLLARRVG---VAGTVWGVDFAAAQLAQARRRDR----------EGRVRWLE
U5QLV6_9CYAN          CCGTGDLALLLARRVG---PKGQVYGVDFAAAQLEQARRRDR----------QGRVQWME
MENG_ARATH            CCGSGDLAFLLSEKVG---STGKVMGLDFSSEQLAVAATRQSL----KARSCYKCIEWIE
D7KNF1_ARALL          CCGSGDLAFLLSEKVG---STGKVLGLDFSSEQLAVAASRQNL----KARSCYKCIEWIE
M4DIM2_BRARP          CCGSGDLAFLLSEKVG---PSGKVMGLDFSSEQLAVAASRQKL----RGRSCYKCIEWIE
A0A087HQM5_ARAAL      CCGSGDLSFLLSEKVG---FNGKVMGLDFSSEQLAVASSRQNL----RDRSCYKCIEWIE
D7TDK4_VITVI          CCGSGDLAFLLSERVG---SDGKVIGFDFSREQLSVASSRQHL----LSKACYKNIEWIE
B9HLS4_POPTR          CCGSGDLAFLLSEKVG---SNGKVSGLDFSKEQLLMASSRQHL----LSKACYKNIEWIE
M1BTJ6_SOLTU          CCGSGDLTFLLSEKVG---SHGKAVGLDFSNEQLLMASTRQKL----RSKTCYKNIKWME
A0A3Q7JU43_SOLLC      CCGSGDLTFLLSEKVG---PHGKAVGLDFSNEQLLIASTRQKL----RSKTCYKNIKWME
M0SED0_MUSAM          CCGSGDLVFFLSQKVG---TEGEVYGLDFSREQLSIASRREDL----YWKACYKNIEWIE
I1JC50_SOYBN          CCGSGDLSFLLSDQVG---SHGKVIGLDFSKDQLLFASSRQES----LSKNCFTNIEWVE
G7K058_MEDTR          CCGSGDLSFLLSNKVA---SNGKVIGLDFSKEQLMVASSR--S----FSTNCFNNIEWVE
K7TQN1_MAIZE          CCGSGDLAFLLSQKVG---LDGEVMAVDFSSQQLQTAAGRQEQ----RWKLCYKNIKWIE
C5YBW2_SORBI          CCGSGDLAFLLSQKVG---LDGEVMAVDFSRQQLQTAADRQEQ----RWKLCYKNIKWIE
B8ARR3_ORYSI          CCGSGDLAFLLSQKVG---LDGQVMAVDFSSQQLQTAASRQDQ----RWKPCYKNIKWIE
Q7X6S1_ORYSJ          CCGSGDLAFLLSQKVG---LDGQVMAVDFSSQQLQTAASRQDQ----RWKPCYKNIKWIE
J3LZF4_ORYBR          CCGSGDLAFLLSEKVG---LDGQ---------QLQTAANRQEQ----RWKPCYKNIKWIE
A9T5P7_PHYPA          CCGSGDVSFLLAEKVK---PTGNVVGLDFAQEQLDVAARRE------DDSNLCSKIEWRL
MENG_SYNY3            CCGSGDLAFQGAKVVG---TRGKVVGLDFCAELLAIAAGKH------KSKYAHLPMQWLQ
D3EMS0_ATETH          CCGSGDLTKLLAQKVG---KKGKVIGVDFSRELLAIAAQRN------HKYYPSLPIEWML
K9YQ14_CYASC          CCGTGDLTFLLAKQI----THGKVYGVDFSSQLLAVAQEKQ------QQKPSINNITWIE
K9Z0K4_CYAAP          CCGSGDLTFLLRQQV----IKGRVIGVDFSSELLDVARVKA------KNR-GYDDIEWVK
B7KG10_GLOC7          CCGSGDLTQLLARQVG---KTGQVIGLDFSPQLLTIARQRI------AEKSSHLPIRFRE
E0U743_GLOV7          CCGSGDLSQLLARQVG---KKGQVIGVDFSPQLLAIARQRA------ALTSPHLRLEFVE
B0JPN2_MICAN          CCGSGDLTNLLSKQVG---KTGKVIGLDFSPQQLKIARQRF------SATN----INWME
MENG_NOSS1            CCGSGDLALRLARRVG---STGQVSGVDFSANLLETAKQRAQ------SQYPQPNISWVE
MENG_TRIV2            CCGSGDLALRLARRVG---STGQVYGVDFSANLLETAKQRAQ------AQYPQPHISWVE
MENG_NOSP7            CCGSGDLALRLARRVG---ATGYVYGVDFSCNLLETAKERSQ------KQYPQPAIAWVE
K9W3A1_9CYAN          CCGSGDLTKLLAKEVG---GQGKVYGVDFSPQQMAIGKEK----------FPLPQIEWIE
K9SJ07_9CYAN          CCGSGDVAMLLAKRVA---PAGKVIGVDFACEQLAIAAERTCE----LPPPIGNCLIWQE
K9SS97_9SYNE          CCGSGDVAMMLARKIANKNHTGQVFGVDFSESQLAIACHRTQS----LPH-LQPYLTWQQ
Q10XM7_TRIEI          CCGSGDLAYMLAKHVG---NTGHVFGVDFSREQLAIARNREPP----LLNKISPI-HWVE
B8HKE0_CYAP4          CCGSGDLAVLLGAVVG---RAGTVIGLDFAPAQLAIARQRS---------HHQPQIEWIQ
MENG_SYNE7            CCGSGDLAFLLAKVVG---SKGQVIGFDRSQALLSVAGDRA------RQLASALVIDWQR
MENG_SYNP6            CCGSGDLAFLLAKVVG---SKGQVIGFDRSQALLSVAGDRA------RQLASALVIDWQR
Q2JPD0_SYNJB          CCGTGDLALQLARRVG---RRGHVVGLDFSPAMLAIARRRSR-------LFPGYSLEWVL
K9P6F5_CYAGP          CCGTGDLALLLASRVR---PGGLVLGLDAAAAPLAIARRRAARQ-------PWLPLQWQQ
Q7U5M9_SYNPX          CCGTGDLALELARRVR---PGGSVLGLDAAAAPLELARHRQSRQ-------PWLNVVFQQ
A5GMN3_SYNPW          CCGTGDLALALARRVR---PGGQVVGVDTAEAPLALARQRAARE-------PWLTLAFQQ
A5GRH5_SYNR3          CCGTGDLALVLAERLR---RGGAVLAVDAAAAPLLQARRRHKRC-------PWLPVEWLQ
Q46GY8_PROMT          CCGTGDMSILLARYIK---SSKNITGIDSASQALVVARERSKQ--------NYSSIEWIN
Q7V2P1_PROMP          CCGTGDLSFLIFKKVR---PNGSVTGIDSAKEILNIAKEKSKLI-------ENKFISWEM
Q7VDF0_PROMA          CCGTGDLSLPLARLVR---PFGSVIGVDFSRAQINCAHKRSLKE-------PWLPISWLN
                      ***:**:       :                  :  .  :                 :  

MENG_THEEB            GDALAVPFAPQTFQGITIGYGLRNVVDIPQALREMFRLLVPGGRAAILDFSHPQT-SALE
K9RUE5_SYNP3          GDALGLPFDDGSFDGATLGYGLRNVSDIPQCLSELYRVLRPGGWVAILDFSHPQE-LWLK
A8I8C3_CHLRE          GDAMDLPFESASFDAATMGYGLRNVASIPTALKELHRVLRPGCAVAILDFNNCTD-PIPD
Q7NPC8_GLOVI          ADALDLPFADDSFDAVTQGFGLRNVVDIPACFAQLRRVLKPGGRAVILDLHAPAD-AGWR
U5QLV6_9CYAN          ADALALPFAGGSFDAITQSFGLRNVVDIPACLQQMRRVLKAGGRAVILDLHRPAD-ERWR
MENG_ARATH            GDAIDLPFDDCEFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSILDFNKSNQ-SVTT
D7KNF1_ARALL          GDAIDLPFDDCEFDAITMGYGLRNVVDRLRAMKEMYRVLKPGSRVSILDFNKSNQ-SVTT
M4DIM2_BRARP          GDATDLPFDDCEFDAITMGYGLRNVVDRDRAMREMCRVLKPGSRVSILDFNKSNQ-SVTA
A0A087HQM5_ARAAL      GDALDLPFDDCKFDAITMGYGLRNVVDRDRAMREMYRVLKPGSRVSILDFNKSNQ-PMTR
D7TDK4_VITVI          GDATKLPFSDCSFDAITMGYGLRNVLDRGKAMQEMFRVLKPGSRVSILDFNKSTK-PFIT
B9HLS4_POPTR          GDATELPFPDCYFDAITMGYGLRNVVDKRKAVQEMFRVLKPGSKASVLDFNKSTQ-PFVA
M1BTJ6_SOLTU          GNALDLPFPDSSFDAVTIGYGLRNVVDRHRAMSEICRVLKPGSTLSVLDFNKSIN-PLST
A0A3Q7JU43_SOLLC      GNALDLPFPDSSFDAVTIGYGLRNVVDRHRAMTEICRVMKPGSTLSVLDFNKSIN-PLST
M0SED0_MUSAM          GDALDLPFSDGYFDAITIGYGLRNLIDRQKAMREIFRVLKPGSKVSILDFNKSTS-SLVN
I1JC50_SOYBN          GDALDLPFSDGWFDAITMGYGLRNVVDKQKAMQEIFRVLKTGSTVSILDFNKSNE-LLTS
G7K058_MEDTR          GDALDLPFSDAWFDAITMGYGLRNVVDKRKAMQEILRVLKPGSTASILDFNKSNE-LLTS
K7TQN1_MAIZE          GDALDLPFTDCYFDAVTVGYGLRNVVDKSKAMQEIYRVLKPGSRASILDFNKSSS-LFTA
C5YBW2_SORBI          GDALDLPFTDCYFDAVTVGYGLRNVVNKSKAMREIYRVLKPGSRASILDFNKSSS-LFTA
B8ARR3_ORYSI          GDALDLPFTDCYFDAVTVGYGLRNVVDKPKAMREIFRVLKPGSRASILDFNKSSS-LFTT
Q7X6S1_ORYSJ          GDALDLPFTDCYFDAVTVGYGLRNVVDKPKAMREIFRVLKPGSRASILDFNKSSS-LFTT
J3LZF4_ORYBR          GDALGLPFADCYFDAVTVGYGLRNVVDKPKAMREIFRVLKPGSRASVLDFNKSSS-LFTT
A9T5P7_PHYPA          GDALALPFDEGSFDAVTMGYGLRNVASVPLALKEIRSVLKPGSKASILDFNRSEN-DSVV
MENG_SYNY3            GDALALPFSDNEFDGATMGYGLRNVGNIPQALTELQRVLKPGKKVAILDFHQPGN-ALAA
D3EMS0_ATETH          GDALNLPFEDNTFDCVTMGYGLRNIIDIPRCLQEINRVLKPFAKVAILDFQHPTN-AWQQ
K9YQ14_CYASC          SDVLTLPFDDNTFDCATMGYGLRNVIDIPLALGEIHRVLKPNSKVAILDFHRPSD-SLLA
K9Z0K4_CYAAP          ADVLSLPFQDNTFDCVTMGYGLRNVQDIPSCLREINRVLKPNGRAAILDFHQPSN-YFVA
B7KG10_GLOC7          GDALALPFDENSFDCATMGYGLRNVTDIPRCLQELHRVLRRGAKVAILDFHRPKA-PIMQ
E0U743_GLOV7          GDALKLPFENNTFHCATMGYGLRNVTDIPLCLRELHRVLSSGAKVAILDFHQPQG-QLMQ
B0JPN2_MICAN          GDALNLPFADSSFDCATIGYGLRNVVDITQCLGELYRVLKPGAKAAILDFHQPTQ-TIAK
MENG_NOSS1            ANVLDLPFKDNQFDAATMGYGLRNVTDIPRSLQELHRVLKPNAKAAILDFHRPNN-QQFR
MENG_TRIV2            ANVLDLPFEDNQFDAATMGYGLRNVTDIPRSLQELRRVLKPNAKAAILDFHRPNN-QQFR
MENG_NOSP7            ADVLNLPFDDNQFDAATMGYGLRNVKDIPRSLQELHRVLKPGAKAAILDFHRPSN-PQLR
K9W3A1_9CYAN          ADVLDLPFPDNNFDAATMGYGLRNVVDISRSLQEIYRVLKPGAKAAILDFHLAYQ-PFLQ
K9SJ07_9CYAN          GDALDLPFADRYFDGATIAYGLRNVTNISKCLAELQRVLKPGAIAAILDFNRTEN-PIAA
K9SS97_9SYNE          GDALHLEFPDQTFDGATLSYGLRNVLDIPKCLAELYRVLKPKAVVAILDFHRPSN-PQTQ
Q10XM7_TRIEI          ANALSLPFPHNYFDCATMGYGLRNVSNIPLCLQELYRVLKPNAKAAILDMHCPSS-STIR
B8HKE0_CYAP4          GDALTIPYPDNSFAAITMGYGLRNVSDIPTCLREIYRVLQPGKKAALLDFNPSEL-PWIQ
MENG_SYNE7            GDALDLPFPDDHFDAATLGYGLRNVPDIPTVLRQLQRVLKPGARAAILDMHRPYS-PLLR
MENG_SYNP6            GDALDLPFPDDHFDAATLGYGLRNVPDIPTVLRQLQRVLKPGARAAILDMHRPYS-PLLR
Q2JPD0_SYNJB          GDALALPFPDSSFDAITMGYGLRNVTDIPQALREIRRVLKPGRRAAILDFHRPTGIPLCE
K9P6F5_CYAGP          GDALATGLADGWADGAVMAYGLRNLADPAAGLVELRRLLRPGGRAAVLDFNRPDPASAPA
Q7U5M9_SYNPX          GDALSTGLPDASADGIVMAYGLRNLADPVVGLKEMARLLKPGRLAGVLDFNRLTTAGPAA
A5GMN3_SYNPW          GDALALNAETASVDGVVMAYGLRNLADPAAGLQEIKRVLRPGGRAGLLDFNRLQPTSMAA
A5GRH5_SYNR3          ADALAVPRAAASFDGAVMAYGLRNLPDPAAGLRELRRLLQRDGRAAVLDFNR--GGGAAS
Q46GY8_PROMT          GDALETNLTSHQFDGLLMAYGLRNLSSPYSGLEEAFRILKPGGRAGILDFRSFEGTSIQG
Q7V2P1_PROMP          QDILEIDEDLKNYDGICMSYGLRNLVNVEEGLKKVFNLLSDTGRAGFLDFNHSKFNSIAD
Q7VDF0_PROMA          EDVLKAGLPSSTFDGVVMAYGLRNLSSPEAGLKEIHRLLKPGARAGVLDFNHTIEGSKNS
                       :                .:****: .    . :   ::       .**:          

MENG_THEEB            QFQQWYLQQWVVPTARHYGLAAEYDYLWPSIQAFPTPPTLCALIQQAGFERVKHYPLLGG
K9RUE5_SYNP3          NFQAWYLQQIVVPLAKTYNLTDEYTYLIPSLARYPKPPELITMAQAAGFQAVTFYPLMGG
A8I8C3_CHLRE          AMQAFFLEQLVVPAARRYGLAAEYEYLRPSIKRFPTGPEQVRLAREAGFAAARHYPIGFD
Q7NPC8_GLOVI          AFQRWYLEGWVTALGRAQGLEAEYAYIAPSLERFPTGDEQVRLAQQAGFSQASHYPLIGG
U5QLV6_9CYAN          AFQQWYLSERVTDLGREMGLTAEYAYIAPSLERFVSGEEQEALALAAGFKQARHYPLVGG
MENG_ARATH            FMQGWMIDNVVVPVATVYDLAKEYEYLKYSINGYLTGEELETLALEAGFSSACHYEISGG
D7KNF1_ARALL          FMQDWMIDNVVVPVATVYGLAKEYEYLKYSINGYLTGEELETLALEAGFSSACHYEISGG
M4DIM2_BRARP          FMQDWMIDNVVVPVATLYDLAKEYEYLKYSINGYLTGEELEALALEACFSSARHYEISGG
A0A087HQM5_ARAAL      FMQEWMIDNVVVPVASFYSLAKEYEYLKYSINGYLTGQELEALALEAGFSSARHYEISGG
D7TDK4_VITVI          SIQEWMIDNVVVPVATGYGLADEYAYLKSSVQEFLTGKELEKLALEMGFSNAKHYEIGGG
B9HLS4_POPTR          SFQEWMIDNAVVPVATAYGLAKEYEYLKGSIREFLTGNELEELALEAGFSTAKHYEISGG
M1BTJ6_SOLTU          TVQELMIENIVVPVASGYGLENEYKYLKSSIRDFLTGNELEKLALEVGFSTAKHFEIGFG
A0A3Q7JU43_SOLLC      TVQEMMIDNIVVPVASGYGLENEYKYLKSSIKDFLTGNELEKLALEVGFSTAEHFEIGFG
M0SED0_MUSAM          MLQEWIIDNVVVPTASEYGLSQEYKYLKTSIDEFLTGKELEKLAKEVGFSKAEHYEIGGG
I1JC50_SOYBN          AFTEWMIDNIVVPVATGYGLSEEYRYLKSSIREFLTGKELEKLALEVGFSAARHYEIGGG
G7K058_MEDTR          SFTEWMIDNIVVPVASVYGLSDDYKYLKSSIREFLTGKELEKLALEVGFSTARHYEIGGG
K7TQN1_MAIZE          SLQSWAIDNVVVPLASGYGLTEEYKYLKSSISQYLTGEELEKLAKEAGFCAAKHYELGGG
C5YBW2_SORBI          SLQSWAIDNVVVPLASGYGLTEEYKYLKSSIAQYLTGEELEKLAKEAGFCAAKHYELGGG
B8ARR3_ORYSI          SLQSWMIDNVVVPLASGYGLTEEYKYLKSSILHYLTEKELEELAKEAGFSAAKHYELGGG
Q7X6S1_ORYSJ          SLQSWMIDNVVVPLASGYGLTEEYKYLKSSILHYLTEKELEELAKEAGFSAAKHYELGGG
J3LZF4_ORYBR          SLQSWMIDNVVVPLASGYGLTEEYKYLKSSISQYLTGKELEELAKEAGFSAAKHYELGGG
A9T5P7_PHYPA          HFQGWMLDNLVVPGASLFGLADEYAYLKTSIARFPTGPQQEEFAMAAGFSKAVHYEIAGG
MENG_SYNY3            NFQRWYLANVVVPMAKQWRLTEEYAYLQPSLDRFPTGPKQVQFALEVGFAKAVHYPIAAG
D3EMS0_ATETH          IFQKWYLNSFVIPVAKHFKLEKEYSYIMPSLEKFPSGKRQIELAFEAGFDTPVYYSIAGG
K9YQ14_CYASC          QAQRWYIDNVVVNMAQYFGSTAEYAYINPSLDRFPDGKEQIKLAHQGGFSSAVHYPLAGG
K9Z0K4_CYAAP          NIQKWYLDNIVVTMADWLGKKEDYAYIYPSLQRFLRGDRQIELARQIGFSQSVHYPLLGE
B7KG10_GLOC7          AFQQWYLNFIVVPTAEGLGLTEEYAYINPSLKRFPTGNNQVKLGYQAGFNHAVHYSIAGG
E0U743_GLOV7          TFQQWYLKTIVVSTAERLGLTAEYAYITPSLERFPTGQQQVKLGLKAGFSHAIHYPIAGG
B0JPN2_MICAN          LFQNWYLDHIVVPAAERYGLTDQYAYISPSIDRFPQGREQVKLGYRSGFSGAVHYPLLAG
MENG_NOSS1            TFQQWYLDSIVVPLADRLGVKEEYAYISPSLDRFPIGKEQVEIALKVGFTSATHYPIANG
MENG_TRIV2            TFQQWYLDSIVVPLADRLGVKEEYAYISPSLDRFPIGKEQVEIALQVGFTSATHYPIANG
MENG_NOSP7            AFQQLYLNSFVVPVANYLGLKEEYAYISPSLDRFPIGKEQIELARQVGFAVATHYPIANG
K9W3A1_9CYAN          QFEHLFLENVAVPLAERFGLRDEYAYIWESLQKFPQGTQQVALAKQVGFA-ATHYPIVVG
K9SJ07_9CYAN          KFQQFYLDHIVVPIAKNQGMEAEYAYIMPSLERFPLDKEQVQLGLAAGFTQAKHYAIANT
K9SS97_9SYNE          QFQQFYLNNLVVPIAKLWNLEQEYAYLMPSLQRFPIGSDQVKLAIASGFSKATHYPILAG
Q10XM7_TRIEI          WFQKWYLDTVVVPVASNLGLTKEYAYISPSLTKFLTGKDQVALAYKLGFVNAKHYPIIGG
B8HKE0_CYAP4          AFQQFYLNHIVVPVAAQWGLTSEYAYILSSLEKFPPGRKQVDLALQAGFSQAVHYSIAVD
MENG_SYNE7            QFQQVYLDRWVVPAAAAQNCAAEYEYIDASLEAFPQGQQQVALAIAAGFQRAKHYELAAG
MENG_SYNP6            QFQQVYLDRWVVPAAAAQNCAAEYEYIDASLEAFPQGQQQVALAIAAGFQRAKHYELAAG
Q2JPD0_SYNJB          QFQRWYLNTQVVAQAKTLGLGSEYAYIDPSLDRFPSGEEQRQMALQAGFASAKFYPLAWG
K9P6F5_CYAGP          AFQRFYLRRLVVPTARAVGLPEQYAWLEESLARFPTGPVQEQLARAAGFAAARHRSLAGG
Q7U5M9_SYNPX          DFQRFYLRRLVVPVASAAGLKEEYAYLEESLKRFPDGTAQERLALEAGFAEARHHTLVAG
A5GMN3_SYNPW          RFQRAYLRRVVVPVADGLGLKDHYAYLEASLQRFPDGASQEQLARAVGFPLARHRPVAGG
A5GRH5_SYNR3          ALQTQALRRVVVPVASQLGLKEQYAYLETSIAEFPTGFEQEQMALSAGFSWAQHRPIAGG
Q46GY8_PROMT          LFQKIYLSFYVVPISSLFGLGKEYSYIKKSLVNFPSGEKQIHLALSAGFKKAKYQTLAMG
Q7V2P1_PROMP          LFQKIYLRFVVVPISKIFRLSKEYSYIEKSIKNFPKGNELMLIAKGVGFKKVEYRTIFFN
Q7VDF0_PROMA          FFQKFYLRNFVVPIASKMGLKEEYAYLEESLKKFPVGLIQEQIAINVGFQEANYKTLAGG
                            :   .   .       .* ::  *:  :        :     *    .  :   

MENG_THEEB            LMAITVAQK----------------------
K9RUE5_SYNP3          LMGVLVGQHP---------------------
A8I8C3_CHLRE          LMGVLVATKGR--------------------
Q7NPC8_GLOVI          TVGVLVAQ-----------------------
U5QLV6_9CYAN          AVGVLVAG-----------------------
MENG_ARATH            FMGNLVAMR----------------------
D7KNF1_ARALL          FMGNLVAER----------------------
M4DIM2_BRARP          FMGNLVAVR----------------------
A0A087HQM5_ARAAL      FMGNLVAVR----------------------
D7TDK4_VITVI          IMGNLVAKR----------------------
B9HLS4_POPTR          LMGNLVATR----------------------
M1BTJ6_SOLTU          FMGNLVAIR----------------------
A0A3Q7JU43_SOLLC      FMGNLVAIR----------------------
M0SED0_MUSAM          FMGNLVATR----------------------
I1JC50_SOYBN          LMGCLVAKR----------------------
G7K058_MEDTR          LMGCLVAKH----------------------
K7TQN1_MAIZE          LMGNLVATR----------------------
C5YBW2_SORBI          LMGNLVATR----------------------
B8ARR3_ORYSI          LMGDLVATR----------------------
Q7X6S1_ORYSJ          LMGDLVATR----------------------
J3LZF4_ORYBR          LMGDLVATR----------------------
A9T5P7_PHYPA          LMGVLVVTK----------------------
MENG_SYNY3            LMGVLVAEK----------------------
D3EMS0_ATETH          MMGVLVGTKKYL-------------------
K9YQ14_CYASC          IMGILVLTK----------------------
K9Z0K4_CYAAP          MMGVLVLAK----------------------
B7KG10_GLOC7          MMGVLVLTK----------------------
E0U743_GLOV7          MMGVLVLTK----------------------
B0JPN2_MICAN          LMGVLVLKK----------------------
MENG_NOSS1            MMGVLIISK----------------------
MENG_TRIV2            MMGVLIISK----------------------
MENG_NOSP7            MMGVLVVSKF---------------------
K9W3A1_9CYAN          TMGVLVVTKPEA-------------------
K9SJ07_9CYAN          LMGVLVLTK----------------------
K9SS97_9SYNE          LMGILVLTK----------------------
Q10XM7_TRIEI          MMGILVITK----------------------
B8HKE0_CYAP4          TMGVLVLTK----------------------
MENG_SYNE7            LMGVLVVEA----------------------
MENG_SYNP6            LMGVLVVEA----------------------
Q2JPD0_SYNJB          MMGVLVIEKFRIVSINSINSTSPKGSDSPRL
K9P6F5_CYAGP          LMGMLELVA----------------------
Q7U5M9_SYNPX          QMGMLLLKR----------------------
A5GMN3_SYNPW          LMGLLTLRS----------------------
A5GRH5_SYNR3          LMGLLELRC----------------------
Q46GY8_PROMT          QMGILLLEA----------------------
Q7V2P1_PROMP          QMGILILEK----------------------
Q7VDF0_PROMA          QMGALLLRA----------------------
                       :.