CLUSTAL format seed alignment for MF_01983

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D6KD73_9ACTN          -------------------------------MTRRDS-------------ALDFRDFVAE
A0A059W017_STRA9      -------------------------------MTQRGS-------------ALNFRDFVDE
E4N6Q5_KITSK          ------------------MSAPSTPTPTPTPAPAPAP-------------ALDFRAFVDR
G9Z048_9ENTR          -------------------------------MSLIES-------------ALDLRTFLDE
FDC_PSEAE             ---------------------------------MNRS-------------ALDFRHFVDH
A2R0P7_ASPNC          ----------MLRMLRPGRRIPTH-PSRSFSTTPHRS---------NDSPALNFRSLLSA
G3XWH2_ASPNA          ----------MLRMLRPGRRIPTH-PSRTFSTTPHRS---------NDSPALNFRSLLSA
G7XLF0_ASPKW          ----------MLRILRPSRRIPSLRPSRAFSTTPLRA---------NDSPALNFRSLLSA
V5I5X3_BYSSN          -----MAHIITPKNLHLPLPFCGHAQLRLLSMSAVQS----NVSDENKKPHLNFRSLISV
V5FWM0_BYSSN          -------MRLTAAGACTTRRLFSPSQQRCFSKSRCRSIDHRAISEANNSPHLNFRSFISA
A0A1D8PQ75_CANAL      ---------------------------------------------MSLNPALKFRDFIQV
C4YSE5_CANAW          ---------------------------------------------MSLNPALKFRDFIQV
FDC1_CANDC            ---------------------------------------------MSLNPALKFRDFIQV
C5E506_ZYGRC          -------------------------------------------MAPKLTPVLKFRDFLEA
Q6BJQ8_DEBHA          --------------------------------------------MSNLRPELRFRDFLQV
FDC1_YEAST            --------------------------------------------MRKLNPALEFRDFIQV
J8TRN5_SACK1          --------------------------------------------MSALNPALQFRDFIQV
K0KNG7_WICCF          --------------------------MSSKVFVRELHNTVKRTNSQQLKPGLRFRDFISQ
R1EM06_BOTPV          ---------------------------------------------------MNFRSFVEA
K2RUE8_MACPH          ---------------------------------------------------MNFRSFVDA
H3H3G9_PHYRM          -MLSSRLSRKAGQLSSARASVNVGNNISPAGQSFLHSGASPDYDPAQNLPHLNFRSFVEA
A0A0A2J5F4_PENEN      --------------------------------------------MTNTEPHLCFRSFVEA
K9FG02_PEND2          --------------------------------------------MTNTEPHLCFRSFVEA
B6HRC8_PENRW          --------------------------------------------MANTEPHLCFRSFVEA
E9ENN2_METRA          --------------------------------------------MAADPPHLCFRAFVDA
FDC1_ASPNC            --------------------------------------------MSAQPAHLCFRSFVEA
G3Y7U5_ASPNA          --------------------------------------------MSAQPAHLCFRSFVEA
G7XVA2_ASPKW          --------------------------------------------MSAQPAHLCFRSFVEA
Q0C7I7_ASPTN          ---------------------------------------------MSAKPDLCFRDFVDA
B8NJ67_ASPFN          -------------------------------------------MAAINEVDHSFRAFVEA
Q2UP67_ASPOR          -------------------------------------------MAAINEVDHSFRAFVEA
M7THT1_BOTF1          --------------------------------MASTDLSSYLSKSNRELPHLNFREFVEA
G2XWX0_BOTF4          --------------------------------MASTDLSSYLSKSNRELPHLNFREFVEA
M3DF95_SPHMS          ---------------------------------MSSSKQQHLSHANQELPHLNFRSFVQA
F9FQB3_FUSOF          -------------------------------------------MPSKTLPHMDFRSYVEA
N4TMS4_FUSC1          -------------------------------------------MPSKTLPHMDFRSYVDA
N1RYW4_FUSC4          -------------------------------------------MPSKTLPHMDFRSYVEA
A0A0D2YAR9_FUSO4      -------------------------------------------MPSKTLPHMDFRSYVEA
S0E299_GIBF5          -------------------------------------------MASKSLPHMDFRSYVEA
W7MPM7_GIBM7          -------------------------------------------MASKSLPHMDFRSYVEA
T0K816_COLGC          ----------------------------------------MSWTNPQDLPHMNFRSFVEA
L2G6I9_COLFN          ----------------------------------------MSSTNPQDLPHMNFRSFVEA
H1VUR4_COLHI          ----------------------------------------MSPTNPQDLPHLNFRSFVAA
F0XL98_GROCL          ------------------------------------------MASSQDLPHMSFRAFVDE
S3D5R7_OPHP1          ------------------------------------------MASFDEHPHTSFRAFVDT
V2WJP2_MONRO          -----------------------------------MLRKLPSFQSVQELPHLSFRSFVEA
G9MUK3_HYPVG          --------------------------------------MPHTRDRDPEPPHLSFRTFVDS
G9P0U1_HYPAI          --------------------------------------MASTPDRDPEPPHLSFRSFVDS
C7ZQ90_NECH7          --------------------------------------------MDSTSPALSFRAFVDA
G9MXT8_HYPVG          -----------------------------------MSQIALPEASDPEPPHLSFRSFVNA
G9NLP8_HYPAI          ----------------------------------MSSTTYKSEAFDPEPPHLSFRSFVEA
G9NTM9_HYPAI          -------------------------------------MSSKYDPNDPEPAHLSFRSFINA
S0E5U5_GIBF5          -------------------MQQLHPTLRNRLLASRGLRRSLSGGNSSSPAHLDFRAFVDT
W7LPC4_GIBM7          ------------------MMQRFRPSLTNKLLASRASRRPLSAGRTSTPTHLDFRAFVDT
F9F9A1_FUSOF          ---------------------------------------------MSVPAHLDFRVFVDT
I1RL84_GIBZE          ---------MAISGRYINLATRCTGVRRALSTSRPISTANKQLEVDPIEAQLDFRKFLDI
K3VFV3_FUSPC          ---------MAISGRYINLATRCTGVRRTLSKSRTISTANKQLEVDPVEAQLDFRKFLDI
N4UU57_FUSC1          MIQAPSKLHLLFPRGVTSNLMKRGGVSGALPRGRKYSTSQTADGPDPQEAQLDYRKFLDM
N1S2F1_FUSC4          MIQAPSKLHLLFPRGLTSNLMKRGGVSGALPRGRKYSTSQTADGPDPQEAQLDYRKFLDM
A0A0D2XFD3_FUSO4      MLQAPSKLHLKFPRGLTSNLMKHGGVSGALPRGRKYSTSQTADGPDPQEAQLDYRKFLDM
S0E1W4_GIBF5          MLQAPSKLRLLSPRGLSKSLMERGRIAGALPSSKKYSTSQNADGPDPQEAQLDYRKFLDI
W7MB44_GIBM7          -----------------------------MPFRKRYSTSQ---GPDPQEAQLDYRKFLDM
A0A098DUR0_GIBZE      --------MFRLTHHQILSSLKPASIRVRL----YSSKASLNSN--QGDPQLDFRSFVEV
W7MV59_GIBM7          --------MFRLTHHQILSSLKPTSIRVRL----YSSKVSLNSN--QGDPQLDFRSFVEV
K2RXK3_MACPH          --------MYRVNHRQVLLSLQSCATATRRPSRPYSRKASLASN--QGDPRLDFRAFVEV
J5JUI9_BEAB2          --------MAFVFTSRVSRPCAHLLIVQPLARSAYRTQSTLSSQPAHVAAQLDFRTFVDV
E9F3A3_METRA          --------MAFVFTSRVSRASVHLRFTRPFARSAYRAQSTLSSQPDHVAAQLDFRTFVDV
F9FLW8_FUSOF          --------MLSIRDR--------------------SAKARPDSA----AAQLDFRTFIEL
M2UK91_COCH5          --------------------------MATTTTAQGTSSALQASQ--SPSAPHDFRAFLDV
M2SNX0_COCSN          -----------------------------------MSSALPASE--SPSAPHDFRAFLDV
A0A0A2KE66_PENEN      -------------------------------------MSTEKLS-----AASSLRTFLEE
A0A0A2LGV1_PENIT      -------------------------------------MSTEKLS-----AATSLRTFLEE
A2QSX6_ASPNC          -------------------------------------METTSVETVG--AADDFRQFIKE
T0LUE3_COLGC          ------------------------------------MVPPFHPSQSGGLAAANFRQYVKE
E9EE06_METAQ          -------------------------------------MAHQRGGENGDGPAMSFRRFIQE
B8N201_ASPFN          -------------------------------------MDHTA-------AAKDFRRFIQE
Q2ULG1_ASPOR          -------------------------------------MDHTA-------AAKDFRRFIQE
I4D2A6_DESAJ          -----------------------------------------------MHRIKSFREYIEN
M1MID8_9CLOT          -----------------------------------------------MNRIKSFRGYIEK
C7Q4D9_CATAD          -----------------------------------------------MRHLRSLREFIAE
C7QBU0_CATAD          -----------------------------------------------MTHLRSLREFIEA
A0A059VML0_STRA9      -----------------------------------------------MARIKDLRSYLDA
A0A059WBA5_STRA9      -----------------------------------------------MPRIKDLRAYLAA
A0A0A8EV26_9ACTN      -----------------------------------MYVQMVFVKEVPVQHPSDLREHIEA
B1MC75_MYCA9          -------------------------------------MSEIPIRMEIHMAFNDLRRYLAD
                                                                            *  :  

D6KD73_9ACTN          LLATGDAIDIGVPVSPTLEVGAVTRRVYDTRSPAPLFGNLTEG---APG---FRILGAPA
A0A059W017_STRA9      LLAVGDAVDVHRPVDPILEAAAVTRRVYETRSPAPLFENLTGT---EPG---YRLLGAPA
E4N6Q5_KITSK          LLADGDAVAVRRPVDPHLEVGAVTRRVYETAAPAPLFTALTAG---APG---CRILGAPA
G9Z048_9ENTR          LRRRGDLIDVNCEVETRLELAAITRRVYEQRLSAPLFNHLKEG---LPG---ARVLGAPA
FDC_PSEAE             LRRQGDLVDVHTEVDANLEIGAITRRVYERRAPAPLFHNIRDS---LPG---ARVLGAPA
A2R0P7_ASPNC          LRAQDDLVDITQPASPDLEIAALTRRVYESHSPAPLFHNVTDT---DPETGLFKILGAPV
G3XWH2_ASPNA          LRAQDDLVDITQPASPDLEIAALTRRVYESHSPAPLFHNVTNT---DPETGLFKILGAPV
G7XLF0_ASPKW          LRAQDDLIDITQTTSPDLEIAALTRRVYETQSRAPLFHNVTDT---DPETGLFKILGAPV
V5I5X3_BYSSN          LRQQDDLVDIKDAVSSNLEAAAITRRVYETLAPAPLFHNVSGT---DPKSGLFKILGAPV
V5FWM0_BYSSN          LRQQGDLVDVNEPVSSDLEAAAVTRRVYEKRAAAPLFHNVSDK---DPQTGLFKILGAPV
A0A1D8PQ75_CANAL      LKNEGDLVEIDTEVDSNLEVGAITRKAYENKLAAPLFNNLKQDPGNIDPKNLFRILGCPG
C4YSE5_CANAW          LKNEGDLVEIDTEVDPNLEVGAITRKAYENKLAAPLFNNLKQDPGNVDPKNLFRILGCPG
FDC1_CANDC            LKNEGDLIEIDTEVDPNLEVGAITRKAYENKLAAPLFNNLKQDPENIDPKNLFRILGCPG
C5E506_ZYGRC          LRREGDLVEIFQEVDPHLEVGAIMRKVYENKLPVPLFKNLKQPKGNVDPDNLFDIAGCIG
Q6BJQ8_DEBHA          LKNENDLVEITHECDPNLEVGAIMRKVYEEKLPVPLFKNLKKDPKNPDPSNLFNIVGCLG
FDC1_YEAST            LKDEDDLIEITEEIDPNLEVGAIMRKAYESHLPAPLFKNLKGAS-----KDLFSILGCPA
J8TRN5_SACK1          LKDEDDLIEITKEVDPNLEVGAIMRKAYESKLPAPFFKNIKGAS-----KDLFNILGCPA
K0KNG7_WICCF          LQKDGDLIEINKEVDPHLEIGAITRKVYEERLPAPLFNNVKGQQ-----KNLFRILGAPG
R1EM06_BOTPV          LKSDGDIAEINSEKDPNLEVSAIIRRSNETDDKAPLFNNVKGA-----QNGLFRILGGPG
K2RUE8_MACPH          LKQDGDIAEINTEKDPNLEVAAIIRRACETDDKAPLFNNVKGA-----KNGLFRILGAPA
H3H3G9_PHYRM          LKVDGDIAEINAEKDPILEVSAIIRRSNELDDKAPLFNNVKGA-----KNGLFRILGGPN
A0A0A2J5F4_PENEN      LKADNDLVEIDSPIDPNLEAAAITRLVCETDDKAPLFNNLIGA-----ENGLFRILGAPA
K9FG02_PEND2          LKADNDLVEIDSPIDPNLEAAAITRLVCETDDKAPLFNNLIGA-----KNGLFRILGAPA
B6HRC8_PENRW          LKADNDLVEIDTPVDPNLEAAAITRLVCETDDKAPLFNNLIGA-----ENGLFRILGAPG
E9ENN2_METRA          LKADNDLVEINTPVDPHLEAAAITRRVCETNDKAPLFNNVIGS-----HNGLFRILGAPG
FDC1_ASPNC            LKVDNDLVEINTPIDPNLEAAAITRRVCETNDKAPLFNNLIGM-----KNGLFRILGAPG
G3Y7U5_ASPNA          LKVDNDLVEINTPIDPNLEAAAITRRVCETNDKAPLFNNLIGM-----KNGLFRILGAPG
G7XVA2_ASPKW          LKADNDLVEIDTPIDPNLEAAAITRRVCETNDKAPLFNNLIGM-----KNGLFRILGAPG
Q0C7I7_ASPTN          LKQDNDLVEIDTPVDPNLEAAAITRRVCETNNKAPLFNNLIGM-----QHGLFRILGAPG
B8NJ67_ASPFN          LKADDDLVEINTEIDSNLEAAAITRLVCETDDKAPLFNNLKGMG----KNGLFRILGAPG
Q2UP67_ASPOR          LKADDDLVEINTEIDSNLEAAAITRLVCETDDKAPLFNNLKGMG----KNGLFRILGAPG
M7THT1_BOTF1          LKKDDDIVEIDDEIDPYLEAGAIIRKACETDAPAPLFNNMKGA-----ENGLWRILGAPA
G2XWX0_BOTF4          LKKDDDIVEIDDEIDPYLEAGAIIRKACETDAPAPLFNNMKGA-----ENGLWRILGAPA
M3DF95_SPHMS          LKDDGDLIEIDDEIDPHLEAGAIIRRACETDGKAPLLNNLKGA-----KDGLWRILGAPA
F9FQB3_FUSOF          LEADGDLVSITEECDPHLEVGAIIRKVVENNDKAPLFNKLKGQD----ENGFWRILGAPN
N4TMS4_FUSC1          LEADGDLVSITEECDPHLEVGAIIRKVVENNDKAPLFNKLKGQD----ENGFWRILGAPN
N1RYW4_FUSC4          LEADSDLVSITEECDPHLEVGAIIRKVVENNDKAPLFNKLKGQD----ENGFWRILGAPN
A0A0D2YAR9_FUSO4      LEADGDLVSITEECDPHLEVGAIIRKVVENNDKAPLFNKLKGQD----ENGFWRILGAPN
S0E299_GIBF5          LEADGDLVSITEECDPHLEVGAIIRKVVETNDKAPLFNKLKGQD----ENGLWRLLGAPN
W7MPM7_GIBM7          LEADGDLVSITEECDPHLEVGAIIRKVVETNDKAPLFNKLKGQD----ENGLWRILGAPN
T0K816_COLGC          LKADGDLVEINEECDPNLEVGAIIRKVVESDERAPLFNKLKGQD----DNGLWRILGAPN
L2G6I9_COLFN          LKADGDLVEINEECDPNLEVGAIIRKVVESDERAPLFNKLKGQD----DNGLWRILGAPN
H1VUR4_COLHI          LKADGDLVEINEECDPHIEVGAVIRKVVESDERAPLFNRLKGQN----PDGLWRILGAPN
F0XL98_GROCL          LRADGDIVEINDECDADLEVGAIIRLACETDAKAPLFNKLKGMD----GNGLWRILGAPN
S3D5R7_OPHP1          LRADGDLVDINEECDADLEVAAIVRLACETDDKAPLFNKLKGQN----ENGLWRILGAPN
V2WJP2_MONRO          LRQDGDLVSISRQVDPHLEVAAICRRVCETDNKAPLFENVKGA-----QNGLFRILGAPA
G9MUK3_HYPVG          LRDDNDLVEVNDPIDPNLEAAAITRFVCETNDKAPLFNNVLGA-----KNGFFRILGAPA
G9P0U1_HYPAI          LREDNDLVEVNDPVDPNLEAAAITRLVCETNDKAPLFNNVLGA-----KNGFFRILGAPA
C7ZQ90_NECH7          LREDDDLVEIDAPVDPNLEAAAITRLVCETDNKAPLFNNLVGA-----QNGFFRILGAQA
G9MXT8_HYPVG          LRQDNDLVDIDAPIDANLEAAAITRLVCETDDKAPLFNNVIGA-----KDGLWRILGAPA
G9NLP8_HYPAI          LRQDNDLVDINEPVDPDLEAAAITRLVCETDDKAPLFNNVIGA-----KDGLWRILGAPA
G9NTM9_HYPAI          LRDDGDLADIEAPIDPNLQAAAITRLVCETDDKAPFFHNIIGA-----KDGLWRILGAPG
S0E5U5_GIBF5          LRENNDLTDITSEVDPKLEVAAAIRLAYEQRTKTPLFHNVKGE-----KDGLFRILGAPA
W7LPC4_GIBM7          LREDNDLADITSEVDPKLEVAAAIRLAYELRSKAPLFHNVKGA-----KEGLFRILGAPG
F9F9A1_FUSOF          LREDNDLTDISAEVDPKLEVAAAIRLAYEQRTKAPLFHNVKGA-----KDGLFRILGAPA
I1RL84_GIBZE          LRQDGDLAEIDKEVDPHLEIGAICRRVSEIRDKAPLFNNVKGS-----TDGLWRIFGNAA
K3VFV3_FUSPC          LRQDGDLAEIDKEVDPHLEIGAICRRVSEIRDKAPLFNNVKGS-----TDGLWRIFGNAA
N4UU57_FUSC1          LRHDNDLVEINTGADPHLELGAIIRRMSEVNDKAPLFNNIKGA-----RDGLWRVAGNAA
N1S2F1_FUSC4          LRHDNDLVEINTGVDPHLELGAIIRRVSEVNDKAPLFNNIKGA-----RDGLWRVAGNAA
A0A0D2XFD3_FUSO4      LRHDNDLVEINTGVDPHLELGAIIRRVSEVNDKAPLFNNIKGA-----RDGLWRVAGNAA
S0E1W4_GIBF5          LRHDNDLVEINTEVDPHLELGAIIRRVSEVNDKAPLFNNIKGA-----RDGLWRVAGNAA
W7MB44_GIBM7          LRHDNDLVEINTEVDPHLELGAIIRRVSEVNDKAPLFNNIKGA-----RDGLWRVAGNAA
A0A098DUR0_GIBZE      LRKDGDLADIDQEVDPNLEVGAVVRRVSETNAKAPLFHNVKGT-----RNGLWKMFGNAA
W7MV59_GIBM7          LRKDGDLADIYQEVDPNLEVGAVVRRVSETNAKAPLFHNVKGT-----RNGLWKMFGNAA
K2RXK3_MACPH          LRKDGDLVDVNQEVDANLEVGAIVRRVSETNAKAPLFHNVKGA-----RDGLWKIFGNAA
J5JUI9_BEAB2          LRADGDLAEINEQVDPHLEVGAIVRRVSEVNGKAPLFNSVKGA-----KNGLWRMFGNAA
E9F3A3_METRA          LRADGDLAEINEQVDPHLEVGAIVRRVSEVNGKAPLFNNVKGA-----KNGLWRIFGNAA
F9FLW8_FUSOF          LRYDDDLVEITREVDPYLEVGAIVRRVSEVDAKAPLFMNVKGA-----KNGLWKMFGNAA
M2UK91_COCH5          LRADNDLVEINTEVDPHLEVGATARRVSETDGKAPLFNNVKGA-----RNGLWRIFSNAA
M2SNX0_COCSN          LRADNDLVEINTEVDPHLEVGATARRVSETNGKAPLFNNVKGA-----RNGLWRIFSNAA
A0A0A2KE66_PENEN      CKAEGDVVEIDLEVDPHLESGAISRRAYETGSPMPLINNPKGKDGP---EGLFRILGAPV
A0A0A2LGV1_PENIT      CKAEGDVVEIDLEVDPHLESGAISRRAYETGSPMPLINNPKGKDGP---EGLFRILGAPV
A2QSX6_ASPNC          LEDENDLIVITKEVDPHLELAAITRKVYETEEKAPLFENIRGRQG----SGLFRILGAPI
T0LUE3_COLGC          LAEEGDLLSISKEVDPRLELAAIVRKVYETEDKAPLFENIKGRQN----NGLFRVLGAPV
E9EE06_METAQ          LKDEQDLLEVNSEVDPYLELAAIIRRVYEEEEKAPLFNNIQGRND----NGLFRILGAPV
B8N201_ASPFN          LEDEGELLTITKEVDPHLELAAIVRKVCETGERAPLFTNPKGRKD----DGLFRVIGASI
Q2ULG1_ASPOR          LEDEGELLTITKEVDPHLELAAIVRKVCETGERAPLFTNPKGRKD----DGLFRVIGASI
I4D2A6_DESAJ          LKVLGEVKEIEEEVDWNLEMGAIIRWCNENCAPAPLFNNIKG------VEKGFRALGAPA
M1MID8_9CLOT          LNEIGEVKEINQEVDWNLEMGAIIRWCNENGAPSPLFNKIKD------VEEGFRAIGAPA
C7Q4D9_CATAD          LELIGELQTIDEEVDWNLEIGAVIRRSYDLRAPAPLFTTITGY-----QDTGFQVLGAPA
C7QBU0_CATAD          LDEIGEIQRIDREVDWNLEAGAITRRSYDLRAPAPLFTNLTGY-----QGTGFALLGAPG
A0A059VML0_STRA9      LDALGDLRTVDRLVDPDLEVGAIIRRSYETVAPAPLFTNIKD------TAPGFRLLGAPG
A0A059WBA5_STRA9      LEELGDLRTVDRQVDPHLEVGAIIRRSYETCAAAPLFTNIKG------TAPGYRLLGAPG
A0A0A8EV26_9ACTN      LEKLGDLDRVHDEVDWNLEAAAQTRYSTEHHLPAPLFENVAG------VAEGFRLLGAPA
B1MC75_MYCA9          LEAHGELRTIKTPVSTEIQLGAIARLACETYGPAALFENLVGYP-------TFRGLAAFE
                           :   :    .  :: .*  *   :     .::                   .   

D6KD73_9ACTN          GLSTVP-GETYGRLAAHFGLPRDTTPRDLLERLVAAMH-ARPVPPRIVP--TGP---CKE
A0A059W017_STRA9      GLSSGP-AGTYGRLAAHFGLPRETTPRELLDRLITAMH-AEPVAPRVVD--SGP---CKE
E4N6Q5_KITSK          GLNRDP-DARYGRLAAHVGLGRTAGAREIVERLVAAMH-AEPVPPRLVA--TGP---CKQ
G9Z048_9ENTR          GMLRDP-AKEYARLALHFGLPEHTRPAELIMTIRAAMM-ATPVPPVRVA--KGA---VQE
FDC_PSEAE             GLRADR-ARAHSRLALHFGLPEHSGPRDIVAMLRAAMR-AEPIAPRRLE--RGP---VQE
A2R0P7_ASPNC          GLRADP-ATRFGRLAIQLGLPQNATPLDILEKLIAAKH-STPLPPTPVPASSAP---CKE
G3XWH2_ASPNA          GLRADP-ATRFGRLAIQLGLPQTATPLDILEKLIAAKH-STPLPPTPIPASSAP---CKE
G7XLF0_ASPKW          GLRADP-ATRFGRLAIQIGLPQTATPLDILEKLIAAKH-ATPLPPTPVSASSAP---CKE
V5I5X3_BYSSN          GLRKNR-RERYARIALQLGLPVMSSPRDIMQKLIDTKN-GKPISPIPV--LDAP---VKQ
V5FWM0_BYSSN          GLRKNK-RDQYGRLALQLGLPATSTAREIVEKMIAAKE-GTPLPPVVVDSADAP---CKE
A0A1D8PQ75_CANAL      GLRGF--GNDHARIALHLGLDSQTPMKEIVDFLVANRNPKKFIPPVL--VPNEK-SPHKK
C4YSE5_CANAW          GLRGF--GNDHARIALHLGLDSQTPMKEIIDFLVANRNPKKFIPPVL--VPNEK-SPHKK
FDC1_CANDC            GLRGF--GNDHARIALHLGLDSQTPMKEIIDFLVANRNPKKYIPPVL--VPNDQ-SPHKK
C5E506_ZYGRC          GLRAF--GNDHARIAHHLGLSSDTGMKEIIDHLLEAKK-RKPIPPVK--VNRDS-APCKE
Q6BJQ8_DEBHA          GLRDAKKDNDHARIALHLGLDSQTPMTKIIDYLIEANT-KKPLPPVL--LEDASGAPCKK
FDC1_YEAST            GLRSKE-KGDHGRIAHHLGLDPKTTIKEIIDYLLECKE-KEPLPPIT--VPVSS-APCKT
J8TRN5_SACK1          GLRNKK-KGDHGRIAHHLGLDPKTTIKEIIDYLLECKN-KKPLPPSS--ISASS-APCKA
K0KNG7_WICCF          GLRQNK-ATDHARIAHHLNLPSNTHVKDIINFLLDAKN-KTPIPPHQ--VTKDQ-APIKE
R1EM06_BOTPV          SLRSSS-KGKYGRLARHLALPPDAGMKQILDKMLSAKG-AQPKPPQV--VATGS---CKE
K2RUE8_MACPH          SVRSPS-RGKYGRLARHLALPPNAGMKEILDKMLSAKG-APGKPPRV--VATGS---CKE
H3H3G9_PHYRM          SHRQPS-KGKYGRLARHLALPPDSGMKQILDKMLSAKE-AQPIPPRV--VATGT---CKE
A0A0A2J5F4_PENEN      SLRKSS-KDRYGRLARHLALPPTASMRDILDKMLSAST-IAPIPPNI--VSTGP---CKE
K9FG02_PEND2          SLRKSP-KDRYGRLARHLALPPTASMRDILDKMLSASA-MVPLPPNI--VSTGP---CKE
B6HRC8_PENRW          SLRKSP-KDRYGRLARHLALPPTASMRDILDKMLSAST-MAPIPPNI--VSTGP---CKE
E9ENN2_METRA          SLRKSP-KERYGRLARHLGLAPTASMRDILDKMLSASD-IPPIPPQI--IPTGP---CKE
FDC1_ASPNC            SLRKSS-ADRYGRLARHLALPPTASMREILDKMLSASD-MPPIPPTI--VPTGP---CKE
G3Y7U5_ASPNA          SLRKSS-ADRYGRLARHLALPPTASMREILDKMLSASD-MPPIPPTI--VPTGP---CKE
G7XVA2_ASPKW          SLRKSS-AGRYGRLARHLALPPTASMREILDKMLSASE-MPPIPPTI--VPTGP---CKE
Q0C7I7_ASPTN          SLRTSP-SDRYGRLARHLALPPTASMRDIMDKMLSAST-IPPIEPTI--VPTGP---CKE
B8NJ67_ASPFN          SLRKSK-RDRYGRLARHLALPPTASMKEILDKMLSASQ-LPPIDPKI--VETGP---VKD
Q2UP67_ASPOR          SLRKSK-RDRYGRLARHLALPPTASMKEILDKMLSASQ-LPPIDPKI--VETGP---VKD
M7THT1_BOTF1          SLRHDP-TQKYGRVARHLGLPPSAGMKEILDKMTSAAH-AKPIPPNI--VSSGP---VKE
G2XWX0_BOTF4          SLRHDP-TQKYGRVARHLGLPPSAGMKEILDKMTSAAH-ATPIPPNI--VSSGP---VKE
M3DF95_SPHMS          SLRSDP-SQKYGRVARHLALPPTATMKDILDKMLSAAH-AEPIPPNI--VESGP---VKE
F9FQB3_FUSOF          SLRSDP-KQRYGRLARHLGLPTDSSMKVILDKMIAAKT-TPPIPPTV--VETGP---CKE
N4TMS4_FUSC1          SLRSDP-KQRYGRLARHLGLPTDSSMKVILDKMIAAKT-TPPIPPTV--VETGP---CKE
N1RYW4_FUSC4          SLRSDP-KQRYGRLARHLGLPTDSSMKVILDKMIAAKT-TPPIPPTV--VETGP---CKE
A0A0D2YAR9_FUSO4      SLRSDP-KQRYGRLARHLGLPTDSSMKVILDKMLAAKT-TPPIPPTV--VETGP---CKE
S0E299_GIBF5          SLRSDP-KQRYGRLARHLGLPPDSSMKVILDKMISAKT-APPIPPTV--VETGP---CKE
W7MPM7_GIBM7          SLRSDP-EQRYGRLARHLGLPKDSSMKAILDKMIAAKT-TPPIPPTV--VETGP---CKE
T0K816_COLGC          SLRADP-SQRYGRLARHLGLPPTSGMKEILDKMVTAKT-ATPIPPVV--VESGS---CKE
L2G6I9_COLFN          SLRADP-SQRYGRLARHLGLPPTSSMKEILDKMVAAKT-ATPIPPVV--VESGS---CKE
H1VUR4_COLHI          SLRVDP-SQRFGRLARHLGLPPTASMKEILDKMVAAKT-AAPIPPVV--VDSGS---CKE
F0XL98_GROCL          SLRADP-AQRFGRLARHINLPPTASMKEILDKMGAAKS-TPPIPPKT--VPTGS---CKE
S3D5R7_OPHP1          SLRADP-AQRYGRLARHLNLPVTSSMKDVLDKMVAAKT-GKPIPPRT--VATGP---CKE
V2WJP2_MONRO          ALRKDP-RTRYGRIARHLALPPNASMKQILDKLIAAKA-MAPLPPRL--IADGP---CKE
G9MUK3_HYPVG          SLRQSK-AQRLGRIARHLALPPDSSASAIMEKLLSVES-QDLVNPVT--VESGP---VKE
G9P0U1_HYPAI          ALRQSK-TQRFGRIARHLAMPPDSSPAAIMEKLLSVDS-QNLVDPVV--VESGP---VKE
C7ZQ90_NECH7          SLRKSP-KYRFSRLARHLALPPDATMRDIMQKLQQAAH-LQAIPPTI--VSTGS---CKE
G9MXT8_HYPVG          SLRKTP-GEKYGRLARHMALPPTASMREIIDKMLSASS-LTPIEPVV--VPTGP---IKE
G9NLP8_HYPAI          SLRSSP-KERFGRLARHLALPPTASAKDILDKMLSANS-IPPIEPVI--VPTGP---VKE
G9NTM9_HYPAI          GIRKTP-GHQYSRLARHVALPPTASLHEIMDKMLSATH-IPPIEPEI--LATGP---CKE
S0E5U5_GIBF5          GFSSDS-KYPYRRLAEHLALPKDAGVTDVIDKMLSAKR-ERPLPPVH--VSTGP---CKE
W7LPC4_GIBM7          GFSSDP-EYPYRRLAQHLALPKDAGVTDVIDKMLSAKG-ERPLPPVH--VSTGP---CKE
F9F9A1_FUSOF          GLSSDP-KLPYRRLARHLALPSEAGVKDVIDKMLSAKG-EKPLPPVH--VSTGP---CKE
I1RL84_GIBZE          SLRKDD-KEKFGRVARNLGLPAAATWKDISDHFISWKT-AKPIPPNI--LPTGP---CKQ
K3VFV3_FUSPC          SLRKGN-KEKFGRVARNLGLPATATWKDISDHFISWKT-AKPIPPKI--LPTGP---CKQ
N4UU57_FUSC1          SLRPNE-KDRYGRIARSLGLEPTASWKEICHRWQSGKR-AKVLPPNV--LPTGP---CKD
N1S2F1_FUSC4          SLRPNE-KDRYGRIARSLGLEPTASWKEICHRWQSGKR-AKALPPNV--LPTGP---CKD
A0A0D2XFD3_FUSO4      SLRPSE-KDRYGRIARSLGLEPTASWKEICHRWQSGKR-AKVLPPNV--LPSGP---CKD
S0E1W4_GIBF5          SLRPNE-KDRYGRIARSLGLEPTASWKEICHRWQSGKR-TKVLPPNV--LPSGP---CKD
W7MB44_GIBM7          SLRPNE-KDRYGRIARSLGLEPTASWKEICDRWQSGKR-AKVLPPNV--LPSGP---CKD
A0A098DUR0_GIBZE      SLRNDS-KFRYGRIARSLGLPPDSNWKDILEKMRLATT-RDPLPPNI--LSTGQ---CKQ
W7MV59_GIBM7          SLRNDS-KFRYGRIARSLGLPPDSNWKDILEKMRLAIT-RDPLPPNV--LSTGQ---CKQ
K2RXK3_MACPH          SLRRDQ-RFRYGRIARSLGLPPDSNWKSILDKMRHASH-RDPSPANI--LPTGL---CKQ
J5JUI9_BEAB2          SLRSRE-KEKYGRIARSFGLPPDSSWKDILQRSQEAKN-RPPIPPRI--LSTGP---CKQ
E9F3A3_METRA          SLRSRE-EEKYGRIARSFGLPPDSSWKAILQRSQEAKR-RPPIPPRI--LPTGP---CKQ
F9FLW8_FUSOF          SLRKNK-KERYGRLARNLGLPSDASWKDISERTQAGKK-STPLKPNI--LSTGP---CKE
M2UK91_COCH5          GLRKNE-NERFGRVARNLGLPKDATWKQICDRSQEGKN-KAPIPPNV--VLTGP---CQQ
M2SNX0_COCSN          GLRKNE-NERFGRVARNLGLPKDATWKQICDRSQEGKN-KAPIPPNV--VPTGP---CQQ
A0A0A2KE66_PENEN      GVRSDR-ATRYARFAKSIGLPSNATGHEIIQKLLVCKR-ADPIPSVL--VDDAP---LKE
A0A0A2LGV1_PENIT      GVRHDS-ATRHARFAKSIGLPSNATGQDLIQKLIASKR-ADPIPSVR--VDDAP---LKE
A2QSX6_ASPNC          GLSRIP-GHRFGRIAKSLGLHSTATGEEIIDKIKKCKS-MLPLSPVEVTPDKAP---VKQ
T0LUE3_COLGC          GASSLP-GKRFIRIAKSLGLPSESSGRDIIYAINRAKK-RQPISPRE--FETGP---VKE
E9EE06_METAQ          GVSKIP-GKRYIRIAKSLGLPSDATAADIIEKLNHAKT-LPAIPSKE--VPSGP---VKE
B8N201_ASPFN          GYSKRP-GMQLCRLAKSLGLPSSATGHEIVQKINEAKT-KPPIPCRK--LESGP---VKD
Q2ULG1_ASPOR          GYSKRP-GMQLCRLAKSLGLPSSATGHEIVQKINEAKT-KPPIPCRK--LESGP---VKD
I4D2A6_DESAJ          GVSRQK-DLYLSRYALSIGLSPKATGKEIIEALIDGYS-RKPVDPIIV--SNAPC---KE
M1MID8_9CLOT          GVSRQK-DLYLSRYAISIGMKPNSTGKEILEALVEGYS-KNPVPPTIV--SNASC---KE
C7Q4D9_CATAD          GLSG-P-SHPHARIALALGQPADAPGQDIMEAIVAARD-KPGIPPQVVSADGAPC---KE
C7QBU0_CATAD          ALSG-P-EHRLARMALAVGLPATATGQQIVEVLADARA-KPGIPPVVVDKAGAPC---KE
A0A059VML0_STRA9      ALSAAP-GRPLARIGLSLGLDSTAGAREIVDALAAART-RAPLPPVLV--DSAPC---KQ
A0A059WBA5_STRA9      ALSSAP-GKPLARIALSLGLSADADAREIIDALATART-REPIQPTLV--DTAPC---KQ
A0A0A8EV26_9ACTN      ALSSDP-SRPYARVALSVGLRPEATGREVVEHLVAARH-RPGVPPVAVAAEAAPV---KA
B1MC75_MYCA9          TYSGNP-DNRAWRLARALGLSDDTTGDQIVDFLAGFRDTAGVAPVLV---ETGP---VHE
                                  * .  .     :    :                             : 

D6KD73_9ACTN          NVVTGDDVDLTRFPVPLLHEQDGGRYFGTYGFHVVRTPDGRWTSWSVSRTMLHGRT--TL
A0A059W017_STRA9      HVLRGDEVDLERFPIPLLHQQDGGRYFGTYGFHVVRTPDGRWTSWSISRSMLHGRT--TL
E4N6Q5_KITSK          NVLTGGQVDLERFPVPLLHAEDGGRYLGTYGFHIVRTPDGSWTSWSVARTMLRDAT--SL
G9Z048_9ENTR          NIWSGDDIDLTRLPVPLLHEKDGGRYIGTYGFHVVQSPDGRWDSWSIGRLMLVNGK--KL
FDC_PSEAE             NVWLGEQVDLTRFPVPLLHEQDGGRYFGTYGFHVVQTPDGSWDSWSVGRLMLVDRN--TL
A2R0P7_ASPNC          NILHGSQIDMTKWPIPRLHPLDGGNYLATYGFHILQSPDKAWTSWSISRTMHVANTPRTI
G3XWH2_ASPNA          NILHGSQIDMTKWPIPRLHPLDGGNYLATYGFHILQSPDKAWTSWSISRAMHVAKTPRTI
G7XLF0_ASPKW          NILHGSQIDMSKWPIPRLHPLDGGNYLATYGFHILQSPDKAWTSWSISRAMHIANTPRTI
V5I5X3_BYSSN          NILQGNQIDLTKWPIPLLHYLDGGNYLGTYGFHVVETLDKSWTSWSISRAMHIAGEPRSL
V5FWM0_BYSSN          NIIKGSNIDMTKWPIPRLHAFDGGNYLATYGFHIVQTPDKSWVSWSISRAMHLAGEPRSL
A0A1D8PQ75_CANAL      HHLTHEQIDLTKLPVPLLHHGDGGKFIQTYGMWVLQTPDKSWTNWSIARGMVHDSK--SI
C4YSE5_CANAW          HHLTHEQIDLTKLPVPLLHHGDGGKFIQTYGMWVLQTPDKSWTNWSIARGMVHDSK--SI
FDC1_CANDC            HHLTKEQIDLTKLPVPLLHHGDGGKFIQTYGMWVLQTPDKSWTNWSIARGMVHDSK--SI
C5E506_ZYGRC          NILKGDQINLEQLPAPYLHDEDGGKYLQTYGMFVLQTPDKSWTNWSIARAMIHDEK--HL
Q6BJQ8_DEBHA          NKISGDVIRLNALPAPTLHHGDGGKYIQTYGMFVLQTADKTWTNWSIARGMIYDDK--HL
FDC1_YEAST            HILSEEKIHLQSLPTPYLHVSDGGKYLQTYGMWILQTPDKKWTNWSIARGMVVDDK--HI
J8TRN5_SACK1          HVLSEEEIHLESLPTPYLHTSDGGNYLQTYGMWILQTPDKKWTNWSIARGMVVDDK--HI
K0KNG7_WICCF          NLIQGDEIDLTKIPVPFLHHGDGGKYIQTYGMFILETPDKSWTNWSIARGMVKSKN--EI
R1EM06_BOTPV          NKITGDDVDLTALPSPLIHKSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMVYDKR--HL
K2RUE8_MACPH          NIVLGDDIDLEALPSPQVHKGDGGKYIQTYGMHIVQSPDGKWTNWSIARAMISDKR--HL
H3H3G9_PHYRM          NKLVSDAIDLTALPVPLIHKDDGGKYIQTYGMHIVQSPDGKWTNWSIARAMIYDNK--HL
A0A0A2J5F4_PENEN      NFLEESQIDLTKLPAPLIHQADGGKYIQTYGMHIVQSPDGSWTNWSIARAMVSDDK--HL
K9FG02_PEND2          NFLEENQIDLTKLPAPLIHQADGGKYIQTYGMHIVQSPDGSWTNWSIARAMVSDDK--HL
B6HRC8_PENRW          NFLQESQIDLTKLPAPQIHQADGGKYIQTYGMHIVQSPDGSWTNWSIARAMVSDDK--HL
E9ENN2_METRA          NFLDESQIDLTKLPAPLIHQADGGKYIQTYGMHIVQSPDGSWTNWSIARAMVSDEK--HL
FDC1_ASPNC            NSLDDSEFDLTELPVPLIHKSDGGKYIQTYGMHIVQSPDGTWTNWSIARAMVHDKN--HL
G3Y7U5_ASPNA          NSLDDSEFDLTELPVPLIHKSDGGKYIQTYGMHIVQSPDGTWTNWSIARAMVHDKN--HL
G7XVA2_ASPKW          NSLNDSEFDLTELPVPLIHKSDGGKYIQTYGMHIVQSPDGTWTNWSIARAMVHDKN--HL
Q0C7I7_ASPTN          NHLEGSQIDLTKLPAPLVHQSDGGKYIQTYGMHVVRSPDGKWTNWSIARAMVLDKT--HL
B8NJ67_ASPFN          NSLEGDEIDLTALPVPMVHKSDGGKYLQTYGMHVVQSPDGKWTNWSIARAMVKDKN--HL
Q2UP67_ASPOR          NSLEGDEIDLTALPVPMVHKSDGGKYLQTYGMHVVQSPDGKWTNWSIARAMVKDKN--HL
M7THT1_BOTF1          NKLFGSEFDLDKLPSPWLHQADGGKYVQTYGMHIVQTPDKSWTNWSIARAMVHDKN--HL
G2XWX0_BOTF4          NKLFGSEFDLDKLPSPWLHQADGGKYVQTYGMHIVQTPDKSWTNWSIARAMVHDKN--HL
M3DF95_SPHMS          NKLVDGEFDLSTLPAPWLHQADGGKYIQTYGMHIVQSPDGKWTNWSIARAMVHDKN--HL
F9FQB3_FUSOF          HILTPDQFDLTKLPAPLLHQSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMVYDRN--HL
N4TMS4_FUSC1          HILTPDQFDLTKLPAPLLHQSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMVYDRN--HL
N1RYW4_FUSC4          HILTPDQFDLTKLPAPLLHQSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMVYDRN--HL
A0A0D2YAR9_FUSO4      HILTPDQFDLTKLPAPLLHQSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMIYDRN--HL
S0E299_GIBF5          HILTPDHFDLTKLPAPLLHQSDGGKYVQTYGMHIVQSPDGKWTNWSIARAMVYDRN--HL
W7MPM7_GIBM7          HILTPDQFDLTKLPAPLLHQSDGGKYVQTYGMFIVRSPDGKWANWSIARAMVYDRN--HL
T0K816_COLGC          FRLTPDQFDLTKLPAPMLHQSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMVHDKN--HL
L2G6I9_COLFN          FRLTPDQFDLTKLPAPMLHQSDGGKYIQTYGMHIVQSPDGKWTNWSIARAMVHDKN--HL
H1VUR4_COLHI          FKLTPDQFDLTKLPVPLLHQSDGGKYIQTYGMHVVQSPDGKWTNWSIARAMVHDRN--HL
F0XL98_GROCL          VKLTPDQFDLTTLPSPQLHKSDGGKYVQTYGMHIVQTPDGKWTNWSIARAMVHDRN--HL
S3D5R7_OPHP1          FKLTSDQFDLTTLPSPQLHQSDGGKYIQTYGMHVVQTPDGKWTNWSIARAMVDDRN--HL
V2WJP2_MONRO          NKIFGDDIDLTKLPAPLVHKSDGGKYIQTFGMHIVQSPDGKWTNWSIARAMVHDER--HL
G9MUK3_HYPVG          NSIEGDDIDLTAIPAPMVHETDGGKYIGTYGVNILASPDGQWVNWSINRAMIVGKR--TM
G9P0U1_HYPAI          NSIEGSDIDLNAIPAPMVHETDGGKYIGTFGVNILASPDGKWVNWSINRTMVVGKN--TM
C7ZQ90_NECH7          NSIEGDDIDLDSLPSPMLHQSDGGKYLQTMGMHIVRSPDGTWTNWSIARAMVCGKR--DL
G9MXT8_HYPVG          NSIEGDDIDLTALPVPLVHQSDGGRYIQTFGMHILRSPDGSWTNWSIARAMVSGKR--TL
G9NLP8_HYPAI          NSIEGENIDLEALPAPMVHQSDGGKYIQTYGMHVIQSPDGCWTNWSIARAMVSGKR--TL
G9NTM9_HYPAI          NSIEGDDIDLWSLPLPQIHQSDGGKYVQTFGVHILQNLDGSWTNWSISRAMVSDKN--KL
S0E5U5_GIBF5          NIIMGGDVDLTKLPAPLLNKADGGNYIQTLGINIIPHPTEPWTNWSIARAMVYDKT--RM
W7LPC4_GIBM7          NIVIGDDVDLTKLPAPLLNKADGGNYIQTLGINVIPHPTEPWTNWSIARAMVYDKT--RM
F9F9A1_FUSOF          KIIMGEDVDLTKLPAPLLNQADGGNYIQTLGINIVPHPTEPWTNWSIARAMVYDKT--RM
I1RL84_GIBZE          NKIFGSDVDLESLPVPYLHKGDGGKYLATYGIHVLQTPDKSWTNWSIFRGMVHNKN--HL
K3VFV3_FUSPC          NKIFGSNVDLESLPVPYLHEGDGGKYLATYGIHVLQTPDKSWTNWSIFRGMVHNKN--HL
N4UU57_FUSC1          NKIMGSKVDLTTLPVPFLHTGDGGKYIQTYGVHVLQMPDGSWTNWSIFRGMVYDKN--RI
N1S2F1_FUSC4          NKIIGSRVDLTTLPVPFLHTGDGGKYIQTYGVHVLQMPDGSWTNWSIFRGMVYDKN--RI
A0A0D2XFD3_FUSO4      NKIIGDKVDLTTLPVPFLHTGDGGKYIQTYGVHVLQMPDGSWTNWSIFRGMVYDKN--RI
S0E1W4_GIBF5          NRIMGDKVDLTTLPVPYLHTGDGGKYIQTYGVHVLQMPDGSWTNWSIFRGMVYDQN--RI
W7MB44_GIBM7          NKIMGDKVDLTTLPVPYLHTGDGGKYIQTYGVHVLQMPDGSWTNWSIFRGMVYDKN--RI
A0A098DUR0_GIBZE      NKIFGDDIDLTNLPVPLLHQGDGGKYLQTWGVHILETPDKSWTNWSVFRGMVHDKR--RL
W7MV59_GIBM7          NKIFGDDIDLTNLPVPLLHQGDGGKYLQTWGVHILETPDKSWTNWSVFRGMVHDKR--HL
K2RXK3_MACPH          NKIFGNDIDLTTLPVPLLHKDDGGKYLQTWGLHVLQTPDASWTNWSIFRGMVHDKR--RL
J5JUI9_BEAB2          HKIFGDDIDLHKLPAPKLHQGDAGKYLQTYGVHVLQSPDGKWTNWSIFRGMIHDSR--RL
E9F3A3_METRA          HKIFGDDIDLHKLPAPKLHQADAGKYLQTYGVHVLQSPDGKWTNWSIFRGMIHDSR--RL
F9FLW8_FUSOF          NKIFGDDIDLNNLPVPTLHKEDGGKYLQTYGIHILNTPDGSWSNWSIFRGMVYDAC--HL
M2UK91_COCH5          NQILGDAIDLDALPVPFLHQHDGGRFLQTYGIHMLQTPDGSWTNWSIFRAQLYDKR--HL
M2SNX0_COCSN          NQILGDAIDLEALPVPFLHQHDGGKFLQTYGVHMLQTPDGSWTNWSIFRAQVYDKR--HL
A0A0A2KE66_PENEN      HKIFGDDVDLLKLPIPQNHAKDGGKYFLTYGLHSVQTPDGKWVNWAITRCMVIGKR--QL
A0A0A2LGV1_PENIT      HKIFGDEIDLLKLPVPQNHASDGGRYLLTYGLHSVQTPDGKWVNWAITRCMVIGKR--QL
A2QSX6_ASPNC          YKLFGDDIDLNALPVPFHHDGDGGKYLQTFGMHIVRTPDGCWTNWSITRGMVHDKR--SL
T0LUE3_COLGC          HKIFGDDIDLERLPVPLFHEDDGGKYLQTFGMYIVQSPDGSWVNWSITRGMVNGKR--SL
E9EE06_METAQ          FKLVGDEIDLTALPMPFLHQHDGGKFIQTFGMYIVRSPDGSWVNWSITRAMLHGKR--TL
B8N201_ASPFN          HIIHGDDIDLTQLPVPLLHEHDGGKFIETMGMHVVQSPDGKWTNWSISRGMVHGKR--EL
Q2ULG1_ASPOR          HIIHGDDIDLTQLPVPLLHEHDGGKFIETMGMHVVQSPDGKWTNWSISRGMVHGKR--EL
I4D2A6_DESAJ          KILRGEEVDLYKLPVPFAHDGDGGRYINTWGTIIVQSPDKKWTNWSIARIMIFDKK--TM
M1MID8_9CLOT          NILLGEDVDLFKLPVPYAHDGDGGRYINTWGTIMVQSPDKKWINWSIARIMIKDKR--TM
C7Q4D9_CATAD          NILLGDDIDLFAFPTPLIHGNDGGRYIQTYGMNIAKTPDGSWTNWSINRMMIAGPN--TL
C7QBU0_CATAD          NILTGEDIDLFAFPTPLIHGNDGGRYIQTYGMNIAKTPDGSWTNWSINRMMIADRN--TL
A0A059VML0_STRA9      NILLGKDASLERFPTPLLHDGDGGPYVNTWGTIVARTPDGSFTNWSIARIMMVDDT--HM
A0A059WBA5_STRA9      NILLGHQATLDRFPTPLLHEGDGGPYVNTWGTIIARTPDGSFTNWSIARIMMIDGK--HM
A0A0A8EV26_9ACTN      NVLLGDEADLNRFPVPFVHEGDGNRYANTYGVIIAQTPDGSWTNWSIARIMMIDGK--HM
B1MC75_MYCA9          NIVRDRGELLDYLPIPHLHPGDGGPYVNTIGFFVLESPDRSWVNWAVARCMKLDGD--RM
                               :   * *  :  *.. :  * *          : .*:: *          :

D6KD73_9ACTN          VGPAMPQQHLGMIHRMWADRG--ERTPWAMVLGAPPAALAAAGMPLP-AEVDESGYVGAL
A0A059W017_STRA9      VGPAMAQQHLGMIHRSWQERG--EPTPWAMVLGAPPAALAAAGMPLP-AEVNEDGYVGAL
E4N6Q5_KITSK          VGPVMPQQHVGLVREQWLRRG--ERMPWAMVLGAPPAALAAAGMPLP-AGVSEDGYVGAL
G9Z048_9ENTR          TGPVIPTQHIGMIRAMWAKEG--KPTPWAFVLGGPPAAVAVAGMPLP-DFVSEPGYIGAL
FDC_PSEAE             AGPTIPTQHIGIIREQWRRLG--KPTPWAMALGAPPAALAAAGMPLP-EGVSEAGYVGAL
A2R0P7_ASPNC          VAPIMPGQHIAQVHQMWADQGA-KDTPWALVLGGPPAAAFVGGMPLP-AFVSEDGYIGAL
G3XWH2_ASPNA          VAPIMPGQHIAQVHQMWADQGA-KDTPWALVLGGPPAAAFVGGMPLP-AFVSEDGYIGAL
G7XLF0_ASPKW          TAPIMPGQHIAQVHKMWADQGA-KDTPWALVLGGPPAAAFVGGMPLP-AFVSEDGYIGAL
V5I5X3_BYSSN          TAPVMDGQHISHVRETWINSGA-QDTPWAFVLGGPPAATFVAGMPLP-AKVSEDGYIGAL
V5FWM0_BYSSN          TAPVLKGQHIHAVRQRWIDAGE-EETPWALVLGGPPAAAFVAGMPLP-YEVNEDGYVGAL
A0A1D8PQ75_CANAL      TGLVINPQHVKQVSDAWVAAGKGDKIPFALCFGVPPAAILVSSMPIP-DGATEAEYIGGL
C4YSE5_CANAW          TGLVINPQHVKQVSDAWVAAGKGDKIPFALCFGVPPAAILVSSMPIP-DGATEAEYIGGL
FDC1_CANDC            TGLVINPQHVKQVSDAWVAAGKGDKIPFALCFGVPPAAILVSSMPIP-DGATEAEYIGGL
C5E506_ZYGRC          TGLVMNPQHIRRVADQWKTVGKENAVPFALCFGVPPASILVSSMPIP-EGVSEADYIGSV
Q6BJQ8_DEBHA          TGLVMNPQHIRRVADTWAEIGMGDSVPFALCFGVPPASILVSSMPIP-DGATEADYIGAL
FDC1_YEAST            TGLVIKPQHIRQIADSWAAIGKANEIPFALCFGVPPAAILVSSMPIP-EGVSESDYVGAI
J8TRN5_SACK1          TGLVIKPQHIRQIADAWGAIGKGNKIPFALCFGVPPAAILVSSMPIP-EGVSESDYVGAI
K0KNG7_WICCF          SGLVINPQHIRVVAEEWAKIGKGDQIPFTLCFGVPPAAILVSSMPIP-EGISEQDYIGAI
R1EM06_BOTPV          VGLVIEPQHIWQIHQMWKKEGK--DVPWALAFGVPPAAIMASSMPLP-DGVTEAEYIGAM
K2RUE8_MACPH          AGLVIEPQHLWQIHQMWKKEGR--DIPWALAFGVPPAAIMASSMPLP-DGLTEAEYIGAM
H3H3G9_PHYRM          VGLVIEPQHIWQIHQMWKKEGK--DVPWALCFGVPPAAIMASSMPLP-DGLMESSYIGAL
A0A0A2J5F4_PENEN      TGLVIEPQHIWQIHQMWKKEGR--DVPWALAFGVPPAAIMASSMPIP-DGVTEAGYVGAM
K9FG02_PEND2          TGLVIEPQHLWQIHQMWKKEGC--DVPWALAFGVPPAAIMASSMPIP-DGVTEAGYVGAM
B6HRC8_PENRW          TGLVIEPQHIWQIHQMWKKEGR--DVPWALAFGVPPAAIMASSMPIP-DGVTEAGYVGAM
E9ENN2_METRA          TGLVLEPQHIWQIHQMWKKEGR--DVPWALAFGVPPAAIMASSMPIP-DGVTEADYVGAM
FDC1_ASPNC            TGLVIPPQHIWQIHQMWKKEGRS-DVPWALAFGVPPAAIMASSMPIP-DGVTEAGYVGAM
G3Y7U5_ASPNA          TGLVIPPQHIWQIHQMWKKEGRS-DVPWALAFGVPPAAIMASSMPIP-DGVTEAGYVGAM
G7XVA2_ASPKW          TGLVIPPQHIWQIHQMWKKDGRS-DVPWALAFGVPPAAIMASSMPIP-DGVTEAGYVGAM
Q0C7I7_ASPTN          TGPAVKPQHIWQIQQMWKKEGR--DVPWALAFGVPPAAIMASSMPIP-DGVSEGGYVGAM
B8NJ67_ASPFN          TGLVIEPQHIWQIHQMWKKEGK--DVPWALCFGVPPAAIMASSMPIP-DGVTEAGYVGAM
Q2UP67_ASPOR          TGLVIEPQHIWQIHQMWKKEGK--DVPWALCFGVPPAAIMASSMPIP-DGVTEAGYVGAM
M7THT1_BOTF1          AGLVIEPQHIWQIHQQWKKIGK--DVPWALAFGVPPAAIMAASMPIP-DGVTESGYIGAM
G2XWX0_BOTF4          AGLVIEPQHIWQIHQQWKKIGK--DVPWALAFGVPPAAIMAASMPIP-DGVTESGYIGAM
M3DF95_SPHMS          TGLVIEPQHIWQIHQQWKKVGK--DVPWALAFGVPPAAIMAASMPIP-DGVTEAGYIGAM
F9FQB3_FUSOF          AGLVIKPQHLYQIHEMWKKEGR--DMPWALAFGVPPAAIMASSMPLP-DGLSEAEYIGSL
N4TMS4_FUSC1          AGLVIKPQHLYQIHEMWKKEGR--DMPWALAFGVPPAAIMASSMPLP-DGLSEAEYIGSL
N1RYW4_FUSC4          AGLVIKPQHLYQIHEMWKKEGR--DMPWALAFGVPPAAIMASSMPLP-DGLSEAEYIGSL
A0A0D2YAR9_FUSO4      AGLVIKPQHLYQIHEMWKNEGR--DMPWALAFGVPPAAIMASSMPLP-DGLSEAEYIGSL
S0E299_GIBF5          AGLVIKPQHLYQIHEMWKKEGR--DMPWALAFGVPPAAIMASSMPLP-DGLSEAEYIGSL
W7MPM7_GIBM7          AGLVIKPQHLYQIHEMWKKEGR--DMPYALAFGVPPAAIMASSMPLP-DGLSEAEYIGSL
T0K816_COLGC          AGLIIEPQHIWQIHQMWKKEGK--DMPWALVFGVPPAAIMAASMPLP-GGLSEAEYIGSL
L2G6I9_COLFN          AGLIIEPQHIWQIHQMWKKEGK--DMPWALVFGVPPAAIMAASMPLP-GGLSEAEYIGSL
H1VUR4_COLHI          AGLIIEPQHIWQIHQMWKKEGK--DMPWALVFGVPPAAIMAASMPLP-GELSEAEYIGSL
F0XL98_GROCL          VGLVIPPQHIWKVQQEWKKIGK--DMPWALVFGVPPAAIMAASMPLP-DGLSEAEYIGSL
S3D5R7_OPHP1          VGLVHEPQHIWQVQQEWKKIGK--DMPWALAFGVPPAAIMAASMPLP-DGLSEAEYIGCL
V2WJP2_MONRO          VGLVIEPQHIWKIQQLWKKEGR--DCKWALVLGAPPSAIMAASMPIP-DGVSEAEYIGAF
G9MUK3_HYPVG          TGACYPPQHNWQIVNKWREIGQ--DAPWAFAFGVPPAAAMAAAMPIP-DGISEAAYVGAL
G9P0U1_HYPAI          TGACYPPQHNWQIVNKWREIGQ--DAPWAFVLGVPPAAAMVAAMPIP-DGISEAAYVGAL
C7ZQ90_NECH7          TGIVAGIQHIGKIWAQWKERGE--DVPWACAFGVPPAATLASSMPLP-DGLSEADFVGAL
G9MXT8_HYPVG          AGLVISPQHIKQIHDLWKKEGKT-EIPWALAFGVPPTAIMASSMPIP-DGVSEAGYVGAI
G9NLP8_HYPAI          AGLVISPQHIRKIQDQWRAIGQE-EIPWALAFGVPPTAIMASSMPIP-DGVSEAGYVGAI
G9NTM9_HYPAI          VSLAANPQHIRLIHDQWAKEGKK-EIPWALAFGVPPTAAMAASMPLP-EGVSDPGYVGAM
S0E5U5_GIBF5          VGLIMKPQHIARIFEEWKKTGN--DVPYAIALGAPPIATMAASMSLR-SGVSESEYVGAL
W7LPC4_GIBM7          VGLIMKPQHIARIFEQWKKTGK--DVPYAIALGAPPIATMAASMPLP-AGVSESEYVGAL
F9F9A1_FUSOF          VGLIMKPQHIARIFEQWKETGQ--DVPYAIALGAPPIATMAASMPLP-TGVSEAEYVGAL
I1RL84_GIBZE          TCLVGTGQHNAIIRDKWLAEGKT-EIPWALALGVPPIASIVAAMPVP-EGVSESEYIGAV
K3VFV3_FUSPC          ACLVGTGQHNSIIRDKWLAEGKT-EMPWALALGVPPIASIVAAMPVP-EGVSESEYIGAV
N4UU57_FUSC1          VCLVGGGQHNSMVRDAWLAAGKK-EVPWALAFGVPPAASLAAAMPVP-EGVSEAEYVGAL
N1S2F1_FUSC4          VCLVGGGQHNSMIRDAWLAAGKK-EVPWALAFGVPPAASLAAAMPVP-EGVSEAEYVGAL
A0A0D2XFD3_FUSO4      VCLVGSGQHNSMVRDAWLAAGKK-EVPWALAFGVPPAASLAAAMPVP-EGVSEAEYVGAL
S0E1W4_GIBF5          VCLVGGGQHNSMIRDAWLAAGRK-EVPWALAFGVPPAASLAAAMPVP-EGVSEAEYVGAL
W7MB44_GIBM7          VCLVGGGQHNSMIRDAWLAAGKT-EVPWALAFGIPPAASLAAAMPVP-EGVSEAEYVGAL
A0A098DUR0_GIBZE      SCLVIPGQHNSMIRDQWLKLGKD-EVPWALSLGAPPAATIAASIPIP-PGVSERDYVSSL
W7MV59_GIBM7          SCLVIPGQHNSMIRDQWFKVGKD-KVPWALSLGAPPAANIAASIPLP-PGVSEGDYVSSL
K2RXK3_MACPH          ACLVIPGQHNSMIREQWAREGKD-QIPWALVLGAPPAASIAASIPLP-SGVSEGDYVSAL
J5JUI9_BEAB2          VCLVGSGQHNSVIRDMWLKKGKT-EVSWALAFGVPPAASVVAACPVP-QGISEAEYVGAM
E9F3A3_METRA          VCLVGSGQHNSVIRDMWLKKGKT-EVSWALAFGVPPAASVVAACPVP-QGVSEAEYVGAM
F9FLW8_FUSOF          VCLVGTGQHGAIIRDKWKQQGKD-EIPWALALGVPPAASLAAALPVP-EGVSEGEYVGAL
M2UK91_COCH5          VALINPGQHNHMVMEMWRKLGKD--VPWALAFGVPPAATMAAACPLP-EGVSEAEYVGAM
M2SNX0_COCSN          VALINPGQHNHMVMEKWKKLGKD--VPWALAFGVPPAATMAAACPLP-EGVSEAEYVGAM
A0A0A2KE66_PENEN      TGLVDVKQDIGAIWAMWKAQGK--DTPWACALGVPPAAGVASGMPLP-KFVNEPDYVGAI
A0A0A2LGV1_PENIT      TGLVDVKQDIGAIWAMWKALGK--DTPWACALGVPPAAAVASGMPLP-KFVNEADYVGAI
A2QSX6_ASPNC          VGPVILKQDIGVIWQMWKERGQ--DMPWALCFGVPPAAIMAGGMPIP-KWTDEAGFVGVL
T0LUE3_COLGC          AGPTMSAQDIGVIRKMWQDRGE--DMPFSLCFGVPPAAIMVGGMPIP-KGVNESGFVGAL
E9EE06_METAQ          VGPVIPSQDIGVIREMWRQQGK--DMPFALCFGVPPAAIMVSGMPLP-KGVNESDYIGAL
B8N201_ASPFN          VGLVIPKQDIGTIFNLWKEKGE--DMPWAVCFGVPPAAIMVGGMPIP-KWTNEPEFIGAL
Q2ULG1_ASPOR          VGLVIPKQDIGTIFNLWKEKGE--DMPWAVCFGVPPAAIMVGGMPIP-KWTNEPEFIGAL
I4D2A6_DESAJ          VGMVAGGQHLGKIRKMWADLGE--EVPFALAFGTEPMIPLVAGSTLVSEGMNEADYISGY
M1MID8_9CLOT          VGMVAGGQHIGKVRKMWADIGK--NTPFAIAFGTEPMIPLVAGSTLVSEGNNEADYISGY
C7Q4D9_CATAD          GCLIPGPQHLGIIRAQWAAEGK--PLPIALALGVEPGLPFVGGMPLP-EGADESHFLGAL
C7QBU0_CATAD          ACLIPAPQHLGIIRAQWTQIGE--PMPIALAVGVEPGLPWVGGMPIP-EGMDETHYLGAL
A0A059VML0_STRA9      TGLVLHPQHIAQVWQQWADRGE--PMPFALVQGGEPALPFVSGMPLP-DGVEEAGYLGAL
A0A059WBA5_STRA9      TGLVVHPQHIAQVWQQWADRGE--PMPFALVQGGEPALPFISGMPLP-DGVEESGYLGAL
A0A0A8EV26_9ACTN      TGLVMHPQHIAQVWQQWADLGK--PMPYALVQGGDPAIPYVGGIPIG-DGVAESAYIGAL
B1MC75_MYCA9          VGMTAVMQHIGMLRREWDKIGT--SVPFALVLGADPITTLISGGPLAKFGASEGDIIGAI
                             *.   :   *   *       :   *  *     .. .:      :   :.  

D6KD73_9ACTN          TGSPVDVVRAETNDLYVPAHSEIVLEGYISPDETAPEGPMGEYHG----YAFA-ESKPQP
A0A059W017_STRA9      TGSPVEVVRTETNGLYVPANAEIVLEGYISPDETAPEGPMGEYHG----YTFA-ESKPQP
E4N6Q5_KITSK          AGAPVEVVRAETNDLLVPANSEIVLEGWVEVEELAAEGPMGEYHG----YAFP-EGKAQP
G9Z048_9ENTR          LGQPLEVITAQNGTLQVPANAEIVIEGELSINDTAQEGPMGEYHG----YQHN-KGKMQP
FDC_PSEAE             VGEPVEVVRTQTNGLWVPANTEIVLEGEISLDETALEGPMGEYHG----YSFP-IGKPQP
A2R0P7_ASPNC          CGEAMDVVKCETNDLYVPANAEIVLEGRISTTEKVGEGPMGEYHG----YMFQDKAVPEP
G3XWH2_ASPNA          CGEAMDVVKCETNELYVPANAEIVLEGRISTTEKVGEGPMGEYHG----YMFQDKAVPEP
G7XLF0_ASPKW          CGEAMEVVKCETNDLYVPANAEIVLEGRISTTEKVGEGPMGEYHG----YMFSDNAVPEP
V5I5X3_BYSSN          CGSPIEVVKCETNDLYVPANSELVIEGRISTSKSALEGPMGEYHG----YLFQDEPMNEP
V5FWM0_BYSSN          SGSPLEVVKCETNDLFVPANSEIILEGRISNSKTVPEGPMGEYHG----YAFKDKPVMKP
A0A1D8PQ75_CANAL      CNQAVPVVKCETNDLEVPADCEMVFEGYLDRDTLVNEGPFGEMHG----YCFPQDHHTQP
C4YSE5_CANAW          CNQAVPVVKCETNDLEVPADCEMVFEGYLDRDTLVTEGPFGEMHG----YCFPQDHHTQP
FDC1_CANDC            CNQAVPVVKCETNDLEVPADCEMVFEGYLDRDTLVREGPFGEMHG----YCFPKDHHTQP
C5E506_ZYGRC          VGEPIQVVQAETNQLEVPAESEIVLEGTLNLDHMVPEGPFGEMHG----YVFPGTGHPCP
Q6BJQ8_DEBHA          VGEPLSVVKCETNDLHVPADSEMVFEGTLNLNKMVEEGPFGEMHG----YCFPGHGHPCP
FDC1_YEAST            LGESVPVVKCETNDLMVPATSEMVFEGTLSLTDTHLEGPFGEMHG----YVFKSQGHPCP
J8TRN5_SACK1          LGKPVPVVKCETNDLMVPATSEIVFEGTLSLTDTHAEGPFGEMHG----YVFGGQGHPCP
K0KNG7_WICCF          LGESLPVIKAETNDILVPATSEIVLEGTLNLNDLSPEGPFGEMHG----YVFKGHSHPGP
R1EM06_BOTPV          TGTALDVVKCETNDLLVPANSEIVLEGTLSITETAPEGPFGEMHG----YVFPGDAHLCP
K2RUE8_MACPH          TGTALDVVKCETNDLLVPANSEIVFEGELSVSKTATEGPFGEMHG----YVFPGIPHNNP
H3H3G9_PHYRM          TGHAIDVVKCETNDLLVPANSEIVLEGTLSATETAPEGPFGEMHG----YVFPGDSHQCP
A0A0A2J5F4_PENEN      TGSALDLVKCDTNDLYVPATSEIVFEGTLSITDKGPEGPFGEMHG----YVFPGDTHLWP
K9FG02_PEND2          TGSALDLVKCDTNDLYVPATSEIVFEGTLSITDKGPEGPFGEMHG----YVFPGDTHLWP
B6HRC8_PENRW          TGSALDLVKCDTNSLYVPATSEIVFEGTLSITDKGPEGPFGEMHG----YVFPGDTHLWP
E9ENN2_METRA          TGSALQLVKCDTNNLLVPATSEIVFEGTLSITEQGVEGPFGEMHG----YVFPHDTHVGP
FDC1_ASPNC            TGSSLELVKCDTNDLYVPATSEIVLEGTLSISETGPEGPFGEMHG----YIFPGDTHLGA
G3Y7U5_ASPNA          TGSSLELVKCDTNDLYVPATSEIVLEGTLSISETGPEGPFGEMHG----YIFPGDTHLGA
G7XVA2_ASPKW          TGSSLELVKCDTNDLYVPATSEIVLEGTLSISETGPEGPFGEMHG----YIFPGDAHLGA
Q0C7I7_ASPTN          TGSSLELVKCDTNDLYVPATSEIVFEGTLSITETGPEGPFGEMHG----YVFPGDVHVGA
B8NJ67_ASPFN          TGRALELVKCDTNHLYVPANAEIVLEGTLSITETADEGPFGEMHG----YVFPGDSHKCP
Q2UP67_ASPOR          TGRALELVKCDTNHLYVPANAEIVLEGTLSITETADEGPFGEMHG----YVFPGDSHKCP
M7THT1_BOTF1          TGSALDVVKCETNDLYVPANAEIVFEGTLSITETAPEGPFGEMHG----YVFPGDTHEWP
G2XWX0_BOTF4          TGSALDVVKCETNDLYVPANAEIVFEGTLSITETAPEGPFGEMHG----YVFPGDTHEWP
M3DF95_SPHMS          TGSALDVVKCETNGMYVPANAEIVLEGTLSITETAPEGPFGEMHG----YVFPGDTHPWP
F9FQB3_FUSOF          VGSSLDVIKCETNGLYVPANSEIVFEGTCSITETAPEGPFGEMHGHSS-YVFPGDAHPWP
N4TMS4_FUSC1          VGSSLDVIKCETNGLYVPANSEIVFEGTCSITETAPEGPFGEMHG----YVFPGDAHPWP
N1RYW4_FUSC4          VGSSLDVIKCETNGLYVPANSEIVFEGTCSITETAPEGPFGEMHG----YVFPGDAHPWP
A0A0D2YAR9_FUSO4      VGSSLDVIKCETNGLYVPANSEIVFEGTCSITETAPEGPFGEMHG----YVFPGDAHPWP
S0E299_GIBF5          VGSSLDVVKCETNGLYVPANSEIVFEGTCSITDTAPEGPFGEMHG----YVFPGDAHPWP
W7MPM7_GIBM7          VGSSLDVVKCETNGLYVPANSEIVFEGTCSITERVPEGPFGEMHG----YVFPGDAHQWP
T0K816_COLGC          GGAALEVVKCDTNGLYVPANSEIVFEGVCSATETAPEGPFGEMHG----YVFPGEARPQP
L2G6I9_COLFN          GGAALEVVKCDTNDLYVPANSEIVFEGVCSATETAPEGPFGEMHG----YVFPGEARPQP
H1VUR4_COLHI          VGAPLEVVKCDTNGLHVPANSEIVFEGVCSATETAPEGPFGEMHG----YVFPGEARPQP
F0XL98_GROCL          VGTALEVTKCDTNDLLVPANSEIVFEGFMSSTETAPEGPFGEMHG----YVFPGDAHPQP
S3D5R7_OPHP1          VGSPIDVVKCDTNDLLVPANSEIVFEGFCSSTETSGEGPFGEMHG----YVFPGDVHQMP
V2WJP2_MONRO          TGTALDVVKCETNDLLVPATAEIVMEGTLSITETGPEGPYGEMHG----YVFPGRGIRSP
G9MUK3_HYPVG          TGEPLKLVKCDTNNLYVPANAEIVFEGTISITEQVPEGPYSEMHG----VNFPGDSRMMP
G9P0U1_HYPAI          SGEPLKLVKCDTNDLYVPANAEIVFEGTISITEQVPEGPYSEMHG----VNFPGDSKMMP
C7ZQ90_NECH7          TGSSMPLVKCDTNDLYVPADSEIVLEGTISTTETRPEGPFGEMHG----YVFPGDRHEWP
G9MXT8_HYPVG          AGEPIKLVKCDTNDLMVPANSEIVLEGTLSVTEMQPEGPFGEMHG----YTFPGESHPGP
G9NLP8_HYPAI          AGEPIKLVKCDTNNLYVPANSEIVLEGTLSTTKMAPEGPFGEMHG----YVYPGESHPGP
G9NTM9_HYPAI          SGEAMKMVKCDTNDILVPANSEIVFEGTLSIEETAKEGPFGEMHG----YTFPGKSIIGN
S0E5U5_GIBF5          CGSPLELVKCETNNMYVPATSEIVLEGTISITDTAKEGPFGEMHG----YSFLDENSQQP
W7LPC4_GIBM7          CGSPLELVKCETNDMYVPATSEIVLEGTISITDTAKEGPFGEMHG----YSFLDENSQQP
F9F9A1_FUSOF          CGTPLELVKCETNDIYVPANSEIVLEGTISITDTAKEGPFGEMHG----YSFLDEGSMQP
I1RL84_GIBZE          TGKPLDMVKCEMNDLLVPASSEIVLEGTMSLVEKGKEGPFGDYLA----LVFDGEGGKGP
K3VFV3_FUSPC          TGKPLDMVKCEMNDLLVPASSEIVLEGTMSLVEKGTEGPFGDYLA----LVFDGEGGKGP
N4UU57_FUSC1          VGKPLDLVKCELNNLLVPANSEIVFEGTLSLTDKAHEGPFEDYLG----VIFEGDQRMQP
N1S2F1_FUSC4          VGKPLDLVKCELNNLLVPANSEIVFEGTLSLTDKAYEGPFEDYLG----VIFEGDQSMQP
A0A0D2XFD3_FUSO4      VGKPLDLVKCELNNLLVPANSEIVFEGTLSLTDKAHEGPFEDYLG----VIFEGDQRMQP
S0E1W4_GIBF5          VGKPLDLVKCELNNLLVPANSEIVFEGTLSLTDKAYEGPFEDYMG----VIFEGDRRMQP
W7MB44_GIBM7          VGKPLDLVKCELNDLLVPANSEIVFEGTFSLTDKAYEGPFEDYMG----VIFEGDQRMQP
A0A098DUR0_GIBZE      AGKPLDMVKCELSDLLVPANSEIILEGTFSLKDKALEGPFEDYIG----MHFEGEAGNQP
W7MV59_GIBM7          TGKPLEMVKCELSDLIVPANSEIILEGTFSLKDKALEGPFEDYIG----MHFEGEAGNQP
K2RXK3_MACPH          TGKSLDMVKCELSNLLVPASSEIVLEGTFSLKDKGIEGPFEDYIG----LHVEGESGQQP
J5JUI9_BEAB2          VGQPLDVVKCELSDLLVPANSEIVMEGTFSFRDKAPEGPFEDYLG----LHFSGDQHMQP
E9F3A3_METRA          VGQPLDVVKCELSDLLVPANSEIVMEGTFSFKDKAPEGPFEDYLG----LHFSDDQHMQP
F9FLW8_FUSOF          VGKPLDLVKCETNDVLVPANSEIVFEGKMLLKETGQEGPFGDYMG----LIFENEGHPMP
M2UK91_COCH5          LGRPLDLVKCQTNDLLVPANSEIVLEGTLSTTKMGDEGPFGDYLA----HQFDDERRPGS
M2SNX0_COCSN          LGRPLDLVKCQTNDLLVPANSEIVLEGTLSTTKMGDEGPFGDYLA----HQFDDERRPGS
A0A0A2KE66_PENEN      TGTPMEVIKCETNDLVVPAQSEVVLEGVISATETAIEGPMGEYHG----FLFPTKQSAQP
A0A0A2LGV1_PENIT      TGAPMEVIKCETNDLVVPAQSEVVLEGIISATETAIEGPMGEYHG----LLFPHKKSPQP
A2QSX6_ASPNC          SGKPVKVVKCETNDLYVPMNAEFVLEGVVSTTEVGPEGPMAEYHG----MIFPGEAKNKS
T0LUE3_COLGC          LGQPVDVVKSETNDIWVPRDAEIVLEGVVSRTETADEGPFVEYHG----HVFPGSGKPCP
E9EE06_METAQ          TGSAVQVTRSETSDILVPANAELVFEGVVSSTETAPEGPMAEYHG----LIFPGESHEKP
B8N201_ASPFN          TDAPVDIVKCETNDLWVPANAEIVLEGVVSISETAPEGPMVEYNG----LVFPGHKTQCP
Q2ULG1_ASPOR          TDAPVDIVKCETNDLWVPANAEIVLEGVVSISETAPEGPMVEYNG----LVFPGHKTQCP
I4D2A6_DESAJ          YGEPIELIKAETNDILVPANSEIVLEGILSTSETAMEGPMGEYSG----YLIKQSKSEKP
M1MID8_9CLOT          YGEPIELIKAETNDILVPANSEIILEGTLSSSETEMEGPMGEYSG----YLIKNSKSEKP
C7Q4D9_CATAD          FGEGLEVVPAETVDLMVPATAEIVIEGHIAFDETVMEGPMNEYPG----YNAIE-QSLKP
C7QBU0_CATAD          FGEGIELVPAESVDLLVPATAEIVVEGYISLDETVMEGPFNEFPG----YIATD-ATPKQ
A0A059VML0_STRA9      LGEPLELVQCETVDLQVPASAEIVIEGHLSVERTGLEGPMGEFAG----YRPNE-TSLQP
A0A059WBA5_STRA9      LGEPLELVQCETVDLQVPASAEIVIEGHLSVERTGVEGPMGEFSG----YRPNE-TSLQP
A0A0A8EV26_9ACTN      IGRPLEVVKAELSDLMVPAGAEIVIEGHLSVQRDGVEGPFGEFAG----YIPRE-TSLQP
B1MC75_MYCA9          RGEPLEVVECVTSSLRVPAHAEIVIEGYIDLTESADEGPMAEYHGYIDKAKNTTGAPDFG
                       .  : :       : **   *.:.**         ***  :  .               

D6KD73_9ACTN          VFHVEAVTYRDRPILPVCVAGLPP---EENHTIWGTMISATGLDLLRAAGLP---VSLAW
A0A059W017_STRA9      VFHVEAVTHRSDPILPICVAGLPP---EENHTIWGTMISASALDQLRADGLP---VDLAW
E4N6Q5_KITSK          VFHVEAVTFRDDPVLPVCAAGLPP---EENHTVWGTMISAAALDVLRRAGLP---VDFAW
G9Z048_9ENTR          VFHVKAVMFRNNPILPVCVAGLPP---EENHTIWGTMISAQVLDALQNAGLP---VDMAW
FDC_PSEAE             LFHVHALSFRDQPILPICVAGTPP---EENHTIWGTMISAQLLDVAQNAGLP---VDMVW
A2R0P7_ASPNC          RIEVDCVTYRRDPVVPICVAGLAP---DETHTVWGAAISAEILDALRGAELP---VKMAW
G3XWH2_ASPNA          RIEVDCVTYRRDPVVPICVAGLAP---DETHTVWGAAISAEILDALRGVELP---VKMAW
G7XLF0_ASPKW          KIEVDCVTYRRDPVVPICVAGLAP---DETHTVWGAAISAEILDALRQAELP---VKMAW
V5I5X3_BYSSN          LFQIDCVTHRNNPIVPISVAGTAT---DETHTVWGISIAAEIMDVLEKNGFP---VDFVW
V5FWM0_BYSSN          LFHVDCVTYRNDPVVPICVAGMPP---DETHTVWGPSISAELLSALRKAGFP---VDFVW
A0A1D8PQ75_CANAL      LYRVNHISYRDEAIMPISNPGLCT---DETHTLIGGLVSAETKYLISQHPVLSKIVEDVF
C4YSE5_CANAW          LYRVNHISYRDEAIMPISNPGLCT---DETHTLIGGLVSAETKYLISQHLVLSKIVEDVF
FDC1_CANDC            LYRVNHISYRDQAIMPISNPGLCT---DETHTLIGGLVSAETKYLISQHPVLSKIVEDVF
C5E506_ZYGRC          TYTVETISYRNNAILPVSNPGLCT---DETHTLIGSLVAAEAKQICLNHPVLSKIVMDAF
Q6BJQ8_DEBHA          LYTVDTITYRDDAILPVSNPGLCT---DETHTLIGGLVSAECKQMALEHPKLKSVIMEAF
FDC1_YEAST            LYTVKAMSYRDNAILPVSNPGLCT---DETHTLIGSLVATEAKELAIESGLP---ILDAF
J8TRN5_SACK1          LYTVKAMTHRDNAILPVSNPGLCT---DETHTLIGSLVATEAKELAIKSGLP---VLDAF
K0KNG7_WICCF          TYKINSISYRNNSIMPISNPGLAT---DETHTLIGTLVAAEAKQIAIENDLP---IIDVF
R1EM06_BOTPV          KYHVDCITHRNDAILPVSACGRLT---DETHTMIGSLAAAEIRQLCQDAGLP---ITDAF
K2RUE8_MACPH          LFRVDCITHRNDAILPVSSCGRLT---DETHTMIGSLAAAEIRHLCQSAGLP---ITDAF
H3H3G9_PHYRM          KYRVNCITHRNDAILPVSACGRLT---DETHTMIGPLAAAEIGYLCKQHGLP---IIDAH
A0A0A2J5F4_PENEN      KYKVNRITHRNNAIMPMSSCGRLT---DETHTMIGSLAAAEIRKICQQAGLP---VTDAF
K9FG02_PEND2          KYKVNRITYRNNAIMPMSSCGRLT---DETHTMIGSLAAAEIRKICQQAGLP---VTDAF
B6HRC8_PENRW          KYKVNRITYRNNPIMPMSSCGRLT---DETHTMIGSLAAAEIRKVCQQAGLP---VTDAF
E9ENN2_METRA          KYHVKRITYRNNPILPMSSCGRLT---DETHTLIGSLAAAEIRKICQQKGLP---VTDAF
FDC1_ASPNC            KYKVNRITYRNNAIMPMSSCGRLT---DETHTMIGSLAAAEIRKLCQQNDLP---ITDAF
G3Y7U5_ASPNA          KYKVNRITYRNNAIMPMSSCGRLT---DETHTMIGSLAAAEIRKLCQQNDLP---ITDAF
G7XVA2_ASPKW          KYKVNRITYRNNAILPMSSCGRLT---DETHTMIGSLAAAEIRKLCQQNDLP---ITDAF
Q0C7I7_ASPTN          KYTVNRITYRNNPILPMSACGRLT---DETQTMVGALAAAEIRKISQQHGLP---VTDVF
B8NJ67_ASPFN          VYKVNKITYRTDAILPMSACGRLT---DETHTMIGSLAAAEIRKICQLAGLP---ITDTF
Q2UP67_ASPOR          VYKVNKITYRTDAILPMSACGRLT---DETHTMIGSLAAAEIRKICQLAGLP---ITDTF
M7THT1_BOTF1          KYKVNAITYRNNPIMPVSNCGRIT---DETHTLIGSLAAAEIRRLCQDAGLP---ITDAF
G2XWX0_BOTF4          KYKVNAITYRNNPIMPVSNCGRIT---DETHTLIGSLAAAEIRRLCQDAGLP---ITDAF
M3DF95_SPHMS          KYKVDAITYRNGAILPVSNCGRIT---DETHTLIGPLAAAQIRQLCQDAGLP---ITDAF
F9FQB3_FUSOF          KYTVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGLP---IKEAF
N4TMS4_FUSC1          KYTVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGLP---IKEAF
N1RYW4_FUSC4          KYTVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGLP---IKEAF
A0A0D2YAR9_FUSO4      KYTVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGLP---IKEAF
S0E299_GIBF5          KYTVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGFP---IKEAF
W7MPM7_GIBM7          KYTVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGFP---IKEAF
T0K816_COLGC          KYRVDRITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGVP---IKEAF
L2G6I9_COLFN          KYRVDRITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSKGVP---IKEAF
H1VUR4_COLHI          IYRVDLITHRKDAILPVSNCGRLT---DETHTMIGPLAAAEIGFLLKSRGVP---IKEAF
F0XL98_GROCL          LYTVNMITHRKDAILPVSNCGRLT---DETHTMIGPLVAVEINVMLKAAGLP---ITDAY
S3D5R7_OPHP1          KFTVNLITHRKDAILPISNCGRLT---DETHTMIGPLAAAEIGFLLRSAGLP---IKEAS
V2WJP2_MONRO          LYHVDCITHRDNAILPLSATGRLT---DETHTLCGALVAPEIAQLCRDNGLP---VKDAS
G9MUK3_HYPVG          LFKVNKITYRNNAILPLSATGRLT---DETQSLGGLLSAAEVLKLCRVSGLP---ILQAS
G9P0U1_HYPAI          LFKVNKITYRNNAILPLSATGRLT---DETQSIGGLLTAAEILKLCRASDLP---ILQAS
C7ZQ90_NECH7          KFTVNKITYRDDAILPISACGRLT---DETQTMIGPLASAEVLKLCQEAGLP---ITAAF
G9MXT8_HYPVG          KYTVNKITYRNNAILPMSSCGRLT---DETQTMIGVLAAAEIRQLCQDTGLP---ITDAF
G9NLP8_HYPAI          VYTVNKITYRNNAILPMSACGRLT---DETQTMIGTLAAAEIRQLCQDAGLP---ITDAF
G9NTM9_HYPAI          VHKINKITYRNNAILPISSCGRMT---DETHTMLGVLAAARIRQVCQDAGLP---IIQAS
S0E5U5_GIBF5          LYTVKAITYRNNPILPVCVPGRANLGPDETHTMIGTLASAEIRHLLQQHGLP---VTQVF
W7LPC4_GIBM7          LYTVKAITHRNNPILPVCVPGRANLGPDETQTMIGTLASAEIRHLLQQHNLP---VTQVF
F9F9A1_FUSOF          LYTVKAITHRKNPILPVCVPGRANLGPDETQTMIGTLASAEIRQLLQDHGIP---VTQVF
I1RL84_GIBZE          LFRVDAITYRDNAILPISCPGNII---DESHTT-AQLAAPEVLLLCQEHGLP---IKEAF
K3VFV3_FUSPC          LFRVDAITYRDNAILPISCPGNII---DESHTT-AQLAAPEVLLLCREHGLP---IKEAF
N4UU57_FUSC1          LFTVDAITYRNDAIMPVSVPGRIT---DESHTT-AALASAELLELLQREGLP---IKEAN
N1S2F1_FUSC4          LFTVDAITYRNDAIMPVSVPGRIT---DESHTT-AALASAELLELLQREGLP---IKEAN
A0A0D2XFD3_FUSO4      LFTVDAITYRNDAIMPVSVPGRIT---DESHTT-AALASAELLELLQREGLP---IKEAN
S0E1W4_GIBF5          LFTVDAITYRNDAIMPVSVPGRIT---DESHTT-AALASAELLELLQREGLP---IKEAN
W7MB44_GIBM7          LFTVDAITYRNDAIMPVSVPGRIT---DESHTT-AALASAELLELLQREGLP---IKEAN
A0A098DUR0_GIBZE      LFTVDAITYRDGAILPVSVPGRLT---DESHTT-ASMASVQLLEALQQHDLP---IKDAV
W7MV59_GIBM7          LFTVDAITYRDGAILPVSVPGRLT---DESHTT-ASMASVQLLEVLQQHDLP---IKDAV
K2RXK3_MACPH          LFTVNAITHRHNAILPVSVPGRIT---DESHTT-ASMASVQLLELLQEHNIP---VKDAF
J5JUI9_BEAB2          LFTVNAITYRDDAILPVSVPGKIT---DESHVT-ASMASEELLQLLRQHGFP---VIDAF
E9F3A3_METRA          LFTVNAITYRDGAILPVSVPGKIT---DESHVT-ASMASEELLELLQQHGYP---VIDAF
F9FLW8_FUSOF          LFRVEAITYRNDPILPISVPGRIT---DESHTT-AALAAAELLTLCKARGLP---IQDAC
M2UK91_COCH5          LLKVDAITYRDDAILPISVPGRIV---DESHTT-ASLASAEMVTLCQSHGLP---IIDAY
M2SNX0_COCSN          LLKVDRITYRDDAILPVSVPGRIV---DESHTT-ASLASAEMVTLCQSHGLP---IIDAY
A0A0A2KE66_PENEN      VMTVNAITYRSNPIVPISVAGRAP---DETHTVWALSICAEVLDLLQQADLP---ITKAW
A0A0A2LGV1_PENIT      VMTVNAITYRSNPIVPISVAGRAP---DETHTVWAMSICAEILDLLQQADLP---ITKAW
A2QSX6_ASPNC          LFKVNAITYRHDPILPLCVAGRAT---EENHTVWGIMQAAEVLNVCQAAGLP---IKMVW
T0LUE3_COLGC          VFNIDAITYRDDPILPICVAGRAT---EESETVWALTQAAEVLNICEAAELP---IEMVW
E9EE06_METAQ          LFRVDAITYRKDPIVPVCVAGRAV---EENHTVWGVTQAAEVLSVCQAAGLP---IKMVW
B8N201_ASPFN          IFKVNTITYRHDPILPICVAGRAP---DENSTIWCTMQAAEVLNICQKAGLP---INMVW
Q2ULG1_ASPOR          IFKVNTITYRHDPILPICVAGRAP---DENSTIWCTMQAAEVLNICQKAGLP---INMVW
I4D2A6_DESAJ          IYHVTAMTYRDNPIYPIVVAGAPI---DDDHPVMGIGACAEILSALRKHEIP---ATMAW
M1MID8_9CLOT          IYNVTAMTYRNKPIYPIVVAGAPI---DDDHPVMGIGACAEILNSLRKHKIP---VTMVW
C7Q4D9_CATAD          VFHVSAITHRNGAILPVVAAGPPV---EEDHTVTGTMHAAEILYQLRKAGLP---VTSTW
C7QBU0_CATAD          VFHVTAITHRDGAIQPIVAAGPPV---EENHTIIGTTSAAEILYLLREADLP---ISSAW
A0A059VML0_STRA9      VYTIEAITHRDNPIWPTVVEGEPV---DEYHTATGLTLAAEALTALRAATLP---VTSAW
A0A059WBA5_STRA9      VYTIEAITHRDDPIWPTVVEGEPV---DEYHTATGLTLAAEALAHLRAAGLP---ITTAW
A0A0A8EV26_9ACTN      VYTVEAITHRDAPIWPLVAEGKPT---DDFHTVTGIGEAAGALDAIREAGLP---AASAW
B1MC75_MYCA9          VYHITAVTHRNDAIYPSTCAGKPV---DEDHTITGPGVAAASLNALRAASLP---VEKAW
                         :  : .*  .: *    *      ::         .                   . 

D6KD73_9ACTN          CSYEAATCWIVVAVDIRRLAET-RMTERELADAVAEALFGS----HTGWLVPKVLLVADD
A0A059W017_STRA9      CSYEAATCWIVVSVDIRRLAET-GMDERQLADAVAASLFGS----HAGWLVPKVLLVADD
E4N6Q5_KITSK          CSYEAATCWIVVAVERARRAEL-ALADDELAELIGETLFAS----HAGWLVPKVIVVDDD
G9Z048_9ENTR          CSYEAATCWTVVSVDVAKLADE-DGDARTFANRVAEVYFRS----HAGYLVPKLILVGND
FDC_PSEAE             CSYEAATCWAVLSIDVQRLAAL-GTDAAAFAARVAETVFGS----HAGHLVPKLILVGND
A2R0P7_ASPNC          MPYEAQCCWVVVSVDVERLGRM-GIKKEELSRRVGEVVFGT----HAGWEAPKVFVVGDD
G3XWH2_ASPNA          MLYEAQCCWVVVSVDVERLGRM-GMKKDELSRRVGEVVFGT----HAGWEAPKVFVVGDD
G7XLF0_ASPKW          MPYEAQCCWVVVSVDVERLGRM-GMKKEELSKRVGEVVFGT----HAGWEAPKVFVVGDD
V5I5X3_BYSSN          MPFEAQSCWIVVSIDIEKLASL-AVEAKELCRRAGDIIFKT----HAGWEAPKVLLVGDD
V5FWM0_BYSSN          LPFEALCIWIFVSIDIKKLARM-NISPEELCRRAGELIFST----HAGWEIPKVFLVGDD
A0A1D8PQ75_CANAL      TPYEAQALWLAVKINIQELIKL-QTNAKELSNLVGDFLFKSKECYKVCSILHEVILVGDD
C4YSE5_CANAW          TPYEAQALWLAVKINIQELIKL-KTNAKELSNLVGDFLFKSKECYKVCSILHEVILVGDD
FDC1_CANDC            TPYEAQALWLAVKINTHELVKL-KTNAKELSNLVGDFLFRSKECYKVCSILHEIILVGDD
C5E506_ZYGRC          MPYESQVLWLAFKINVKELVKL-NTDSKSLADLFAKEIYGN----KVGMTTQEIILVGDD
Q6BJQ8_DEBHA          TPHEGVALWLALKVNTKELAKL-NTNSEDFCKLIGDYYYSS----KPGFILQEIVLVGDD
FDC1_YEAST            MPYEAQALWLILKVDLKGLQAL-KTTPEEFCKKVGDIYFRT----KVGFIVHEIILVADD
J8TRN5_SACK1          TPYEAQALWLVLKVDLKRLQAL-KTTPEEFSKKVGDIYFRT----KVGFIIHEIVLVADD
K0KNG7_WICCF          SPYESQALWLVMKIDLKKLQSL-NTTPEEFSNKIGEIFFNT----KVAFIMHEIILVGDD
R1EM06_BOTPV          APFESQVTWVALKVDTAALRAL-QTDSKVFSKRVGDLVFNH----KAGYTIHRLVLVGDD
K2RUE8_MACPH          APFESQVTWAALRVDTAALRAM-QTDSKTFSKRVGDLVFNH----KAGYTIHRIVLVGDD
H3H3G9_PHYRM          SPLVSQVTWVVLKVDTAKLRAM-DTDSETFRKQVGDLVFNE----KAGYTIHRLVLVGDD
A0A0A2J5F4_PENEN      APFESQVTWVALRIDTAKLREM-KTTPKQFSKRVGDLIFNC----KAGYTIHRLVLCGDD
K9FG02_PEND2          APFESQVTWVALRIDTAKLRDM-KTTPKEFPKKVGDLIFNC----KAGYTIHRLVLCGDD
B6HRC8_PENRW          APFESQVTWVALRIDTAKLREM-KTTPKEFSKKVGDLVFNC----KPGYTIHRLVLCGDD
E9ENN2_METRA          APFESQVTWVALRIDTARLREM-KTTPAEFRKKVGDVVFSH----KAGVTIHRLVLVGDD
FDC1_ASPNC            APFESQVTWVALRVDTEKLRAM-KTTSEGFRKRVGDVVFNH----KAGYTIHRLVLVGDD
G3Y7U5_ASPNA          APFESQVTWVALRVDTEKLRAM-KTTSEGFRKRVGDVVFNH----KAGYTIHRLVLVGDD
G7XVA2_ASPKW          APFESQVTWVALRVDTEKLRAM-KTTSEEFRKRVGDVVFNH----KAGYTIHRLVLVGDD
Q0C7I7_ASPTN          SPFESQVIWLALRIDTAALRKM-KTTSQEFRKRVGDIVFSQ----KPGWGFHRLILVGDD
B8NJ67_ASPFN          SPFEAQVTWVALKVDTAKLRQM-KLAPKELQKWVGDVVFNH----KAGYTIHRLVLVGDD
Q2UP67_ASPOR          SPFEAQVTWVALKVDTAKLRQM-KLAPKELQKWVGDVVFNH----KAGYTIHRLVLVGDD
M7THT1_BOTF1          APFESQVTWVALKVDILKLKEM-NITPEAFRQKIGDLIFYH----KAGYTIHRLILCGPD
G2XWX0_BOTF4          APFESQVTWVALKVDILKLKEM-NITPEAFRQKIGDLIFYH----KAGYTIHRLILCGPD
M3DF95_SPHMS          APFHTQVTWVALKVDIEKLGKM-NTTPEAFRKQVGDLVFNH----KAGYTIHRLVLCGSD
F9FQB3_FUSOF          SPFESQVTWVALQVDTEKLREM-KTTSEKFCREIGDIIFNH----KVGYTIHRLVIVGDD
N4TMS4_FUSC1          SPFESQVTWVALQVDTEKLREM-KTTSEKFCREIGDIIFNH----KVGYTIHRLVIVGDD
N1RYW4_FUSC4          SPFESQVTWVALQVDTEKLRGM-KTTSEKFCREIGDIIFNH----KVGYTIHRLVIVGDD
A0A0D2YAR9_FUSO4      SPFESQVTWVALQVDTQKLREM-KTTSDKFCREIGDIIFNH----KVGYTIHRLVIVGDD
S0E299_GIBF5          SPFESQVTWVALQVDTQKLREM-KTTSEKFCREIGDIIFNH----KVGYTIHRLVIVGDD
W7MPM7_GIBM7          SPFESQVTWVALQVDTQKLREM-KATSEKFCREIGDIIFNH----KVGYTIHRLVIVGDD
T0K816_COLGC          SPFESQVTWVALQVDTEKLRAM-ETNAKDFCRTIGDIVFND----KVGYTIHRLVIVGED
L2G6I9_COLFN          SPFESQVTWVALQVDTEKLRAM-ETNAKDFCRTIGDIVFNE----KVGYTIHRLVIVGED
H1VUR4_COLHI          SPFESQVTWVVLQVDTEKLRAS-QTNPKDFCRMVGDIVFND----KVGYTIHRLVLVGED
F0XL98_GROCL          TPFESQVTWCAVKVDTAKLREL-KTTPKEFCRKIGDLIFNT----KVGSTIHRIAVVGDD
S3D5R7_OPHP1          SPFESQVTWVVLQVDTAKLREM-KTTSEAFCRKIGDLVFGH----KVGATIHRLVIIGDD
V2WJP2_MONRO          TVLQSTVTWVALQLDGARLRSM-KTNGRDLAKRIGDLVFNH----KAGYIIHRVILVGDD
G9MUK3_HYPVG          SPLVSQCTWVAVQVDGARLRAM-KITPKELAELVANIVFKS----KAGVPFHRLLLVGED
G9P0U1_HYPAI          SPLISQCTWVALQVDGARLRAM-KTTPKELAELVANVVFNS----KAGVPFHRILLVGED
C7ZQ90_NECH7          APFAGQGIWITLQVDTAELQSM-NTSPKAFMKTVGDLVFHH----KTGFFFHRLILVGPD
G9MXT8_HYPVG          APFVGQATWVALKVDTARLRAM-NTTSKAFSEQVGNLIFRS----KPGFTIHRLILVGDD
G9NLP8_HYPAI          APFVGQATWVALKVDTKRLRAM-KTNGKAFAKRVGDVVFTQ----KPGFTIHRLILVGDD
G9NTM9_HYPAI          CPWFAHATWTVLKVDTTKLRAL-KTSGKEFAKKVGDLVFNV----KPGFAMHRLILVGED
S0E5U5_GIBF5          ALFETQVIWAAVQVDRKKLAEM-KTNAKDLCTKIGDLVFHN----KCGMQIHRLLVVGED
W7LPC4_GIBM7          ALFETQVIWAAVQVDRKKLAEM-KTNAKDFCTKIGDLVFRT----KCGMQIHRLLVVGED
F9F9A1_FUSOF          ALFETQVIWAAIQVNRKKLAEL-NTNARDFCTKLGDLVFRN----KCGMQIHRLLVVGED
I1RL84_GIBZE          APVETLATWCVLQVDTERLRIL-QTTSEEFSKRLGGILFKS----KSTMLINRVLLIGDD
K3VFV3_FUSPC          APVETLATWCVLQVDTEKLRTL-KTTSEEFCRRLGDTLFKS----KSTMLINRVLLIGDD
N4UU57_FUSC1          CPLETYATWCALQVDTEKLGDM-KTSSAELCRRIGDLAFKD----KSCMLVNRIILIGDD
N1S2F1_FUSC4          CPLETYATWCVLQVDTEKLGDM-KTSSAELCRRIGDLAFKD----KSCMLVNRIILIGDD
A0A0D2XFD3_FUSO4      CPLETYATWCALQVDTEKLGDM-KTSSAELCRRIGEIAFKD----KSCMLVNRIILIGDD
S0E1W4_GIBF5          CPLETYATWCALQVDTEKLGDM-ETGSAELCKRIGDLAFKD----KSCLLINRIILVGDD
W7MB44_GIBM7          CPLETYATWCALQVDAEKLGDL-KTSSAELCERIGDLAFKD----KSCMLVNRIILVGDD
A0A098DUR0_GIBZE      APLETLATWCILQVDSKKLAEM-KTNPDELCTTIGNIAFNS----KATMLINRILLIGDD
W7MV59_GIBM7          APLETLATWCILQVDSKKLAEM-KTNPDELCTTIGNIAFNS----KATMLINRILLIGDD
K2RXK3_MACPH          APFQTIATWCVLQVDIEKLGEM-KTNPNELCTRIGNLAFNS----KATMLMNRILLVGDD
J5JUI9_BEAB2          APLETYATWCALKVDVKKLAEL-RTTSKEFCNKIGNLVFND----KSAMLMNRIMLFGHD
E9F3A3_METRA          APLETYATWCALKVDVKKLAEM-RTTPEEFCNKIGNLAFND----KSSMLMNRIMLFGHD
F9FLW8_FUSOF          ASLETHGTWCALKVDIQGLALM-KTSSKDFCEEIGRVAFND----KSAFFMTRILLIGDG
M2UK91_COCH5          CPLETMGTWCALQVSLPQLALL-KTDAESFSRQIGNLVFSS----KASMLINRVFLIGDD
M2SNX0_COCSN          CPLETMGTWCALQVSLPQLALL-HTDAASFSQQIGNLVFSS----KASMLINRVFLIGDD
A0A0A2KE66_PENEN      CPFESQAIWYVVQVDRKRLVEM-KTTPEKFCRQIGEIIFTS----KPGRFVPKIYVVGDN
A0A0A2LGV1_PENIT      CPFESQAIWYVVQVDRKKLVEI-KTTPETFCRQIGEIVFTS----KPGRFVPKIFVVGDD
A2QSX6_ASPNC          CPFESHCLWFVLQVDRQRLRAL-NTNIQDFSKQVGHTVFGS----KPGWYIPKLYLVGED
T0LUE3_COLGC          SPFESHCLWFVLQVNWSKLRAL-QTNMKDFCEKVGHTVFST----KPGFYIPKIYLVGED
E9EE06_METAQ          NPFESHCLWFVLQVDGPKLRAL-NTDMSTFGNKVGHAVFAS----KPGSYIPKLYLVGED
B8N201_ASPFN          CPFESHCLWFVLQVNHSKLVDM-GTNMEEFCRKLGHVVFGS----KPGWFIPKIFLVNDY
Q2ULG1_ASPOR          CPFESHCLWFVLQVNHSKLVDM-GTNMEEFCRKLGHVVFGS----KPGWFIPKIFLVNDY
I4D2A6_DESAJ          MPFESACTWLVITIPKNWKEML-NCNMNELMKKIGDAVYSC----KGSFLSPKIIVVNDD
M1MID8_9CLOT          MPFEVACTWLVITIPKKWREIL-KCNTKEFMKKIGDAVYAC----KGSFLSPKIIVVNDD
C7Q4D9_CATAD          FSYESAMHWLIVAVRSDWHESL-PISSAELTQRVGEVVFQG----KAGFGVPKVLLVEDD
C7QBU0_CATAD          YNYEAAVHWLTLAVRQDWHTAT-GLSSTDLVQKIADIIFTG----KPSVNAPKILLVEDD
A0A059VML0_STRA9      EPFDGASHILVVSVATDWRDNLPGLSTGDLTQRITDVLATQ----RFEYLVPRIFVLDDD
A0A059WBA5_STRA9      EPFEGACHILVVSVAAHWRTTLPGVSTGELTQRITEVIAAQ----RFEPLVPRIFVLDDD
A0A0A8EV26_9ACTN      APLSAASHWLVVTAPGNWRELLPGVSEEQYARRVGEAVFGT----KFGSCLPQVFLLDDD
B1MC75_MYCA9          MVPESASHVLAVTVSDGWSGEF--PDANELCRKIGNAVKTMD---HSAYWVQRILVTDND
                                 .                                 :      .: :    

D6KD73_9ACTN          IDITDIDQVVWAMATRSHPATG-HYVY-PEAPGIPMVPYLTEEEV-----RTGRGGKSVL
A0A059W017_STRA9      IDITEIDQVVWALATRYHPGTG-EYTY-PDAPGIPMVPYLTAAEV-----RSGRGGKSVV
E4N6Q5_KITSK          IDVTDVSQVVWALATRHHPQTG-TRLY-PETPGIPMVPYLTAAEA-----KAGRGGKSVT
G9Z048_9ENTR          IDITRIEEVVWALATRAHPQHD-FIAY-PQIPGFPMVPYLTSEDI-----SRGKGGNMII
FDC_PSEAE             IDVTEIDQVVWALATRAHPLHD-HFAF-PQIRDFPMVPYLDAEDK-----ARGSGGRLVI
A2R0P7_ASPNC          VDVTDIGQFVWALATRYRPGAD-ELVF-EEADGLPMIPYMTRASR-REVPNPGKGGKSVV
G3XWH2_ASPNA          VDVTDIGQFVWALATRYRPGAD-ELVF-EEADGLPMIPYMTRASR-REVPNPGKGGKSVV
G7XLF0_ASPKW          VDVTDIGQFVWALATRYRPGAD-ELVF-EEANGLPMIPYMTRASR-SEVPNPGKGGKSVV
V5I5X3_BYSSN          VDITDISQVVWALATRYRPGSD-EHVF-GDIEGIPMLPYMTRAKKNKQIKNPGIGGRSVM
V5FWM0_BYSSN          VDITDINQVLWALSTRYRPGAD-EYLF-GDATGLPLLPYMMRAKR-KEVPDPGRGGKSVV
A0A1D8PQ75_CANAL      IDIFDFKQLIWAYTTRHTPVQD-QVYF-DDVKPFPLAPFISQGPL----IKTRQGGKCVT
C4YSE5_CANAW          IDIFDFKQLIWAYTTRHTPVQD-QVYF-DDVKPFPLAPFISQGPL----IKTRQGGKCVT
FDC1_CANDC            IDIFDFKQLIWAYTTRHTPVQD-QLYF-DDVKPFALAPFASQGPL----IKTRQGGKCVT
C5E506_ZYGRC          IDIFNFKKLMWAYVTRHTPGDD-QYFY-DEFVAFPLAPFISQGPR----IKTKRGGNCVT
Q6BJQ8_DEBHA          VDIFDFRKLFWAYATRHTPGDD-QYMF-NDYRAFPLAPFIGQGPR----IKTLKGGNCVT
FDC1_YEAST            IDIFNFKEVIWAYVTRHTPVAD-QMAF-DDVTSFPLAPFVSQSSR----SKTMKGGKCVT
J8TRN5_SACK1          IDIFNFKEVFWAYVTRHTPVAD-QTAF-DDVTSFPLAPFVSQSPR----SKTMKGGKCVT
K0KNG7_WICCF          IDIFDFKQVIWAYTTRHTPGDD-QYYF-PNVKSFALAPFVSQSER----IKTLKGGKFVT
R1EM06_BOTPV          VDVYDGRDVLWAFSTRCRPGDD-ETFF-PDVRAFPLIPYNGHGG-----HSPVKGGKVVS
K2RUE8_MACPH          IDVYDGRDVLWAFSTRCRPFDD-ETLF-PDVRAFPLIPYNGHGA-----HSPVRGGKVVS
H3H3G9_PHYRM          IDVFDEADVMWAFSTRCRPDDD-ETFY-PDVRAFPLIPYNSHGG-----HSPVQGGKVVS
A0A0A2J5F4_PENEN      IDVYNGKDVMWAFSTRCRPGLD-EIFF-EDVRGFPLIPYMSHGN-----GSPVQGGKVVS
K9FG02_PEND2          IDVYNGKDVMWAFSTRCRPGLD-EIFF-EDVRGFPLIPYMSHGN-----GSPVQGGKVVS
B6HRC8_PENRW          IDVYNGKDVMWAFSTRCRPNLD-EIFY-EDVRGFPLIPYMSHGN-----GSPVQGGKVVS
E9ENN2_METRA          IDVYQGKDVMWAFSTRCRPNMD-ETFF-EDVAGFALIPYMSHGN-----GPPARGGKAVS
FDC1_ASPNC            IDVYEGKDVLWAFSTRCRPGMD-ETLF-EDVRGFPLIPYMGHGN-----GPAHRGGKVVS
G3Y7U5_ASPNA          IDVYEGKDVLWAFSTRCRPGMD-ETLF-EDVRGFPLIPYMGHGN-----GPAHRGGKVVS
G7XVA2_ASPKW          IDVYEGKDVLWAFSTRCRPGMD-ETLF-EDVRGFPLIPYMGHGN-----GPAHRGGKIVS
Q0C7I7_ASPTN          IDVYDSKDVMWAFSTRCRPGTD-ETFY-EDVPGFPLIPFMSRGN-----GSPTTGGKVVS
B8NJ67_ASPFN          IDPYEWKDVMWAFATRCRPNAD-EMFF-EDVRGFPLIPYMGHGT-----GSPTKGGKVVS
Q2UP67_ASPOR          IDPYEWKDVMWAFATRCRPNAD-EMFF-EDVRGFPLIPYMGHGT-----GSPTKGGKVVS
M7THT1_BOTF1          IDVYDFKDVMFAFSTRCRPNHD-ETFF-EECRGFPLIPYMSHGT-----SSPVQGGKVIS
G2XWX0_BOTF4          IDVYDFKDVMFAFSTRCRPNHD-ETFF-EECRGFPLIHYMSHGT-----SSPVQGGKVIS
M3DF95_SPHMS          IDVYEWDDIAFAFSTRCRPNKD-ETFY-EDCQGFPLIPYMSHGT-----GSPIKGGKVIS
F9FQB3_FUSOF          INVYDFKDVIWAFCTRCRPGMD-EYFF-EDVAGFPLIPYMSHGN-----GAPNRGGKVVS
N4TMS4_FUSC1          INVYDFKDVIWAFCTRCRPGMD-EYFF-EDVAGFPLIPYMSHGN-----GAPNRGGKVVS
N1RYW4_FUSC4          INVYDFKDVIWAFCTRCRPGMD-EYFF-EDVAGFPLIPYMSHGN-----GAPNRGGKVVS
A0A0D2YAR9_FUSO4      INVYDFKDVIWAFCTRCRPGMD-EYFF-EDVAGFPLIPYMSHGN-----GAPNRGGKVVS
S0E299_GIBF5          INVYDFKDVIWAFCTRCRPGMD-EYVF-EDVAGFPLIPYMSHGN-----GAPNRGGKVVS
W7MPM7_GIBM7          INVYDFKDVIWAFCTRCRPGMD-EYFF-EDVAGFPLIPYMSHGN-----GAPNRGGKVVS
T0K816_COLGC          IDVYNFKDVIWAFCTRCRPGLD-EYHF-QEVRGFPLIPYMSHGN-----GDKHTGGKVVS
L2G6I9_COLFN          IDVYNFKDVIWAFCTRCRPGLD-EYHF-EEVRGFPLIPYMSHGN-----GDKHTGGKVVS
H1VUR4_COLHI          IDVYNFKDVIWAFCTRCRPGLD-EYHF-ENVRGFPLIPYMSHGN-----GDKRMGGKVVS
F0XL98_GROCL          IDIFNFKDVIWAFCTRCRPGMD-EYLF-EDVPGFPLIPYMSHGN-----GPANRGGKVVS
S3D5R7_OPHP1          IDAYDFKDIIWAFSTRCRPGMD-EYHF-EDCVGFPLIPYMSHGN-----GPKGRGGKVVS
V2WJP2_MONRO          IDVYDDRDVMWAFSTRCRPGMD-EVFF-DDVRGFPLIPYMTHGN-----GSPVRGGKVVS
G9MUK3_HYPVG          IDIHDDADIMWAFSTRCRPGLD-EYLY-EDVKGFALIPYMAHGN-----GNPTKGGKIVC
G9P0U1_HYPAI          IDVHDDADIMWAFSTRCRPGLD-EYPY-EDVKGFALIPYMGHGN-----GNPIKGGKLVC
C7ZQ90_NECH7          IDIYNDKDILWAYSTRCRPGMD-ELLY-DDVPGFFLIPFMGRGH-----GPHHEGGKVVC
G9MXT8_HYPVG          IDVYDDKDVMWAFTTRCRPGTD-EVFF-EDVVGFLLIPYMGHGN-----GDANKGGKVVS
G9NLP8_HYPAI          IDVYDDKDVMWAFTTRCRPGTD-EVFF-DDVVGFQLIPYMSHGN-----AEAIKGGKVVS
G9NTM9_HYPAI          IDIYNDKDVLWAFTTRCRPNLD-EVFF-EEVLGFRLIPFMGHGN-----GDPIKGGKVVS
S0E5U5_GIBF5          INPFDMHDVTWAFATRCRPTMD-EFHF-EDVPAYPLVPYMSHGP-----GTKLTGGKVVA
W7LPC4_GIBM7          INPFDMNDVTWAFATRCRPAMD-EFHF-EDVPAYPLVPYMSHGP-----GTKLTGGKVVA
F9F9A1_FUSOF          INPFDMNDVTWAFATRCRPSMD-EFHF-EDVPAYPLVPYMSHGP-----GTKLTGGKVVA
I1RL84_GIBZE          VDIYDWDKVMWAFTTRCRPGHD-TYHF-EDVPSHPLTPYMTQIP-----GTPRRGGKVIS
K3VFV3_FUSPC          VDIYDWDKVMWAFTTRCRPGHD-TYHF-EDVPSHPLTPYMTQIP-----VTPRRGGKVIS
N4UU57_FUSC1          IDVFNWNDVMWALVTRCRPGKD-ETLF-EEVRGHPITPYMSHGPH----GNPTQGGKIVS
N1S2F1_FUSC4          IDVFNWNDVMWALVTRCRPGKD-ETLF-EEVRGHPITPYMSHGPH----GNPTQGGKVVS
A0A0D2XFD3_FUSO4      IDVFNWNDVMWALVTRCRPGKD-ETLF-EEVRGHPITPYMSHGPH----GDPTQGGKIVS
S0E1W4_GIBF5          VDVFDWNDIMWALVTRCRPGKD-ETLF-EEVRGHPITPYMSHGPH----GNPTKGGKVIS
W7MB44_GIBM7          VDVFDWNDVMWAVVTRCRPGKD-EILF-EEVRGHPITPYMSHGPH----GNPTQGGKVIS
A0A098DUR0_GIBZE      VDIHDWADVIWAYTSRCRPGID-EYVF-DEVMGLPLTPYRKYGR-----GSSVKGGKMVC
W7MV59_GIBM7          VDIHDWADVIWAYTSRCRPGID-EYVF-DEVMGLPLTPYRKYGR-----GSSVKGGKMVS
K2RXK3_MACPH          VDIHNWDDVIWAYTSRCRPGLD-EYVF-DDVRGLPLIPYLKYGR-----ESAAKGGKMVS
J5JUI9_BEAB2          VNVRDFKDIMWALATRCRPGQD-EYLF-EDIPVLPLTPYMSHGR-----GNPTRGGKVVS
E9F3A3_METRA          VDVGNFRDIMWALATRCRPGQD-EYVF-DDIPVLPLTPYMSHGR-----GNPTRGGKVVS
F9FLW8_FUSOF          VDVYDFKDVIWAWVTRSRPGQD-DYAF-EDVPGLVLIPYMSNGR-----GHRRRGGKMVS
M2UK91_COCH5          IDVYNFKDIIWALSTRARPGFD-DFPF-EDVRGLPIMPYMSHGR-----GDRKRGGKMVT
M2SNX0_COCSN          IDVYNFKDIIWALSTRARPGLD-DFPF-EDVRGLPIMPYMSHGR-----GDRKRGGKMVT
A0A0A2KE66_PENEN      IEPSDLHDVVWAEATKSQPQAS-DFFFVGNYPTYDLVPYATHGFN----PREPK-AKVVR
A0A0A2LGV1_PENIT      IDPSDLREVVWAEATKSQPQAS-DFFFVGNYPTYDLVPYATHGFN----PREPK-AKVVK
A2QSX6_ASPNC          IDPTDLRDVIWAESTRCQPLTN-EFFF-EEYGNIPLIPYVGYGIK----PEHGNHPKVVR
T0LUE3_COLGC          IDPTNLNELIWAEATRCQPGTN-EFFF-DAYGNIPLIPYVSHGIK-----ERKNHVKVVR
E9EE06_METAQ          VDPTSIQDLIWAEATRCQPGVN-EFYF-DQYPVFPLIPYFTHGVK----PEGGKYKKVLR
B8N201_ASPFN          IDPTNLPDVIWAEATRCEPGRH-EFIF-NEYSNIPLIPYVTHGLP----SKTGMNGKVVK
Q2ULG1_ASPOR          IDPTNLPDVIWAEATRCEPGRH-EFIF-NEYSNIPLIPYVTHGLP----SKTGMNGKVVK
I4D2A6_DESAJ          IDPTDTSQVVWAFASRNHQSK--EIYFRPESRVIGLITYLDEEEK-----KVFKTTACIY
M1MID8_9CLOT          IDPTDTNQVIWAFGTRNHQSK--EIYFRPDSRVIGLIPYLDSEEK-----KVFKTTACIF
C7Q4D9_CATAD          IDITDNDDVVWAFATRTHPEH--GEVHFPAEPHVQLSVYLSEVEA-----HSYRAGKVLY
C7QBU0_CATAD          VDITDLEQVVWAFATRSHPDVNRGEFHFPPKVSDQLAVYLSPEEA-----HTFMAGKVIY
A0A059VML0_STRA9      VDASDTAELMWALATRVHPTS--RRIVRE-GKILPLLSVYAPEER-----HAWQGPKVTY
A0A059WBA5_STRA9      VDASDIGELMWALATRVHPTE--RRIVRT-GKILSLLSCYTFDQR-----HAWTGDKVTY
A0A0A8EV26_9ACTN      FDPTDDADLLWALATRVHPDG--RVVRFEDGPVLPLLTCYTPQER-----HAARATKVVH
B1MC75_MYCA9          IDPTSPSDLWWAYATRCRPGDD--SIILEDVPIMALSPIVNTREE----RTKTRGRVEVL
                      .:     .. :*  ::                   :                        

D6KD73_9ACTN          SCLLPEQFD-GVTRGVTASFENSFPEDVRRRVTGNWA-GYGFPATPPRLHRP
A0A059W017_STRA9      SCLLPEHFA-GRTHGVTTDFRHAYPRALQQKVLDTWT-DYGFAAPGGPVR--
E4N6Q5_KITSK          NCLLPQGF-----RGRTASFTGSFPAELRQRVLDDWT-AYGFPAA-------
G9Z048_9ENTR          NCLFPEQFA-GKMRATTASFAHSYPESLKTRILERWR-EYGFIDQ-------
FDC_PSEAE             NCLYPEQFA-GQMRAATASFRHAYPTALRRRVEERWS-DYGFGDA-------
A2R0P7_ASPNC          NLLLPSEFE-GKRPWVPGSFEGLYSEELKQKVLGRWG-ELFEKK--------
G3XWH2_ASPNA          NLLLPSEFE-GKRPWVPGSFEGLYSEELKQRVLGRWG-ELFEKK--------
G7XLF0_ASPKW          NLLLPSEFE-GKRPWVPGSFEGLYSEELKQKVSGRWG-ELFGKKW-------
V5I5X3_BYSSN          NLLLPPEFE-GKRDWVQSSFACAFPEELTEIVIKKWK-NWFPE---------
V5FWM0_BYSSN          NLLLPEEFD-GERDWLPSSFEASYPENTREEVLEKWE-RYGYSKEE------
A0A1D8PQ75_CANAL      SCIFPKQFTDPDFKFVTCNFN-GYPEEVKNKVFQNWE-KYYK----------
C4YSE5_CANAW          SCIFPKQFTDPDFKFVTCNFN-GYPEEVKNKVFQNWE-KYYK----------
FDC1_CANDC            TCIFPKQFTDPDFEFVTCNFN-GYPEEVKNKISQNWD-KYYK----------
C5E506_ZYGRC          DCLFPIQYRDPNFRFVTCDFD-SYDSAIRDKINQNWS-NYGYQ---------
Q6BJQ8_DEBHA          DCLFPKQYEPEGVDFVTCDFD-GYDEAIKEKVRKNWS-AYGYK---------
FDC1_YEAST            NCIFRQQYE-RSFDYITCNFEKGYPKGLVDKVNENWK-RYGYK---------
J8TRN5_SACK1          NCIFRQQYE-RDFDYVTCSFEKGYSKELVDRINENWR-EYGYK---------
K0KNG7_WICCF          NCIFPKQYK-QDIDFTTCNFD-GYDEEIKNKVLTNWE-SYGYEKLE------
R1EM06_BOTPV          DALLPAEYT-TGRTWEAASFEESYPDDVKRKVVADWE-AMGFESPQD-----
K2RUE8_MACPH          DALLPVEYT-KGRTWEAASFKESYPEDVKQKVLADWQ-AMGFESRS------
H3H3G9_PHYRM          DALLPIEYT-KGRDWVAASFKESYPEDVKNKVLSEWK-SMGFETSDK-----
A0A0A2J5F4_PENEN      DALLPCEYT-TGKDWEAADFESSYPEELKQKVLANWT-KMGFREE-------
K9FG02_PEND2          DALLPCEYT-TGKNWEAADFESSYPEDLKQKVLANWT-KMGFRE--------
B6HRC8_PENRW          DALLPCEYT-TGRDWVAADFENSYPEELKQKVLANWT-KMGFREE-------
E9ENN2_METRA          DALLPCEYT-TGRDWQAADFENSYPEPLKQKILASWT-ELGFQDD-------
FDC1_ASPNC            DALMPTEYT-TGRNWEAADFNQSYPEDLKQKVLDNWT-KMGFSN--------
G3Y7U5_ASPNA          DALMPTEYT-TGRNWEAADFNQSYPEDLKQKVLDNWT-KMGFSN--------
G7XVA2_ASPKW          DALMPTEYT-TGRNWEAADFNQSYPEDLKQKILDNWT-KMGFSN--------
Q0C7I7_ASPTN          DALMPKEYT-TGKDWEAADFKNSFPEDVQRKVEENWT-AMGFSTV-------
B8NJ67_ASPFN          DALMPTEYT-TGADWEAADFEHSYPEEIKAKVRANWE-ALGFRKQD------
Q2UP67_ASPOR          DALMPTEYT-TGADWEAADFEHSYPEEIKAKVRANWE-ALGFRKQD------
M7THT1_BOTF1          DALMPTEYE-GSQNWQQASFKHSYPETLQKHINAKWMNSWGFPDN-------
G2XWX0_BOTF4          DALMPTEYE-GSQNWQQASFKHSYPETLQKHINAKWMNSWGFPDN-------
M3DF95_SPHMS          DALMPSEYR-GQQDWQQASFKHSYPESLQKSVIERWA-SWGF----------
F9FQB3_FUSOF          DSLLPVEYT-TGKNWEAADFENSFPEEIKDRVCSRWQ-TLGFSSAK------
N4TMS4_FUSC1          DSLLPVEYT-IGKNWEAADFENSFPEEIKDRVCSRWQ-TLGFSSAK------
N1RYW4_FUSC4          DSLLPVEYT-TGKNWEAADFENSFPEEVKDRVCSRWQ-TLGFSSAK------
A0A0D2YAR9_FUSO4      DSLLPVEYT-TGKNWEAADFENSFPEEIKDRVCSRWQ-TLGFSSAK------
S0E299_GIBF5          DCLLPVEYT-TGKNWEAADFENSFPEEIKDRVCNRWQ-ALGFNSAK------
W7MPM7_GIBM7          DSLLPVEYT-TGKNWEAADFENSFPEEIKDRVCSRWQ-ALGFNSPK------
T0K816_COLGC          DCLMPTEYT-TGRDWEAADFKESFPAEVQEKVLQKWE-AMGFTEKR------
L2G6I9_COLFN          DCLMPTEYT-TGRDWEAADFKESFSAEVQKKVLQKWE-AMGFSERK------
H1VUR4_COLHI          DCLMPTEYT-TSRDWEAASFKESFPAEVQEKVLQRWE-SFGFTPRE------
F0XL98_GROCL          DCLLPKEYT-TGKNWEAASFKESIPESVQAKVLGNWK-AWGF----------
S3D5R7_OPHP1          DALLPVEYT-TGKDWEAADFKNSYPAALQQKVLANWK-ALGF----------
V2WJP2_MONRO          DALLTCEYS-TGRTWEATDFEHSYTDEVKAKVLLNWE-KDGFD---------
G9MUK3_HYPVG          DALFPVEYT-TGRNWINTSFRQGYPKPLQDKVLACWE-KRGFSKLD------
G9P0U1_HYPAI          DALFPVEYT-TGRNWVNTSFREGYPKSLQDTILASWE-KRGFSKLD------
C7ZQ90_NECH7          SALLPSEYT-SGQDWEAADFEHSYPKSVKERVLKNWD-QMGFDKLN------
G9MXT8_HYPVG          DALLPVEYT-TGKNWENADFKNAYPKEVQDKVLKDWE-TLGFRKLE------
G9NLP8_HYPAI          DALLTAEYT-TGKDWESADFKNSYPKSIQDKVLNSWE-RLGFKKLD------
G9NTM9_HYPAI          DALLPVEYT-TGQNWETCNFKNAYPKSVQDQVLKDWE-SFGFAKLQE-----
S0E5U5_GIBF5          NCLLPEEYE-GKQGWVTCDFENGYPEDIKKRVLSRRQ-DFGI----------
W7LPC4_GIBM7          NCLLPEEYE-GKQGWVTCDFENGYPEDVKKRILSRRQ-DFGI----------
F9F9A1_FUSOF          NCLLPEEYT-GKQGWVTCDFESGYPEEVKKRVLSRRE-EFGL----------
I1RL84_GIBZE          DCLLRSEYD-RPRDFKAVDFETSYPSHIKTKVLNNWG-AMGFS---------
K3VFV3_FUSPC          DCLLRSEYD-RPRDFKAVDFETSYPSHIKTKVLNNWA-AMGFS---------
N4UU57_FUSC1          DCLMPIEYQ-GKKNFRECSFNKSYPDDIKNKVQARWK-DMGFTVQL------
N1S2F1_FUSC4          DCLMPIEYQ-GKKNFRECSFNKSYPDDIKNKVQAGWK-DMGFTVLS------
A0A0D2XFD3_FUSO4      DCLMPIEYQ-GKKNFRECSFNKSYPDDIKNKVQAGWK-DMGFTVHL------
S0E1W4_GIBF5          DCLMPIEYQ-GKRNFRECSFVKSYPEDIKSKVRAGWE-GMGFTVQS------
W7MB44_GIBM7          DCLMPIEYQ-GKRNFRECSFNKSYPEEIKNKVRAGWE-GMGFTVQS------
A0A098DUR0_GIBZE      NCLLVMEYD-GGRIFRSVDFRSSYPPELQKKIERRWT-EMGFDAV-------
W7MV59_GIBM7          NCLLAMEYD-GGRIFRSVDFRSSYPPELQEKIEGRWT-EMGFDAV-------
K2RXK3_MACPH          NCLLAMEYD-GVRNFRSVDFRSSYPHELQEKVQAEWT-QMGFDAED------
J5JUI9_BEAB2          DCLFPMEYE-GKTSFRGCEFERSYPEEVKERVRSNWT-VMGFAEVESPSKST
E9F3A3_METRA          DCLFPMEYE-GKTSFRACDFERSYPEEIKERVRSNWT-AMGFDKVESPSKPT
F9FLW8_FUSOF          DCLLPTEYE-GRRGFQSVDFQHSYPEDLQARVRSNWT-DMGFDQV-------
M2UK91_COCH5          NCLLPAEYE-GRRNWIPVDFESSYPDTVKEKVKEIWK-TTAIGE--------
M2SNX0_COCSN          NCLLPAEYE-GRRNWIPVDFESSYPEVVKEKVREIWE-TTAIGE--------
A0A0A2KE66_PENEN      LCMLPEEFETLDRPWIEASFRGSYPEEIKKKVLDNWQ-AYGYEENPVNL---
A0A0A2LGV1_PENIT      LCMLPAEFETLDLPWVEASFRGSYPEEVKKKVLDNWH-AYGYEEHPVNI---
A2QSX6_ASPNC          CCMFPCEFVDEKLCWKEGSFRGSYPSHIQNKVTRKWK-AYGFDSE-------
T0LUE3_COLGC          CCMFPAEFMDSNLSWKHGSFRGSYSKAIQDMVDGQWA-EYGF----------
E9EE06_METAQ          CCMFPSEFTNAPRTWEQGSFRASYPQEVQDKVNAQWK-SYGFE---------
B8N201_ASPFN          CCMLPNEFTEKTLQWKEGSFQGAYPEDVKKKVLDNWT-AYGFQPL-------
Q2ULG1_ASPOR          CCMLPNEFTEKTLPWKEGSFQGAYPEDVKKKVLDNWT-AYGFQPL-------
I4D2A6_DESAJ          NCLLPEDMKYEDYPITS-SFKGVFPKRVQESAMDKLIKAGFLE---------
M1MID8_9CLOT          NCLWPEDLEYADYHITS-SYKGAFPKEVQENALDKLIKAGFLE---------
C7Q4D9_CATAD          NCLLADLFDEKQRPVKG-SFVNGWPKEIQDKVLEKWETYGYR----------
C7QBU0_CATAD          NCLLADLFPEGARPIKG-SFENGWPAEIQQRVLENWQAYGYR----------
A0A059VML0_STRA9      DALVPSAEEG--REPRS-SFRFIFPREVQQRVLEHWNG--------------
A0A059WBA5_STRA9      DALLPAVEEG--REPRS-SFSHLFPKEVQQKVLQNWPN--------------
A0A0A8EV26_9ACTN      EALLSAPGE---REPQS-TFADAYPAEVRAKVRARYPN--------------
B1MC75_MYCA9          NCLIPPYAD--DLSVTSAALRQAYPHDAIAFAERTYLGE-------------
                        :