CLUSTAL format seed alignment for MF_02003

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYI2_BACAN      -------------------------MKKVD------------VKESAVGREMRIRKQWNE
SYI2_BACHK      -------------------------MKKVD------------VKESAVGRETRIRKQWNE
SYI2_BACCZ      -------------------------MKKVD------------VKESAVGRETRIRKQWNE
SYI2_BACC1      -------------------------MKKVD------------VKESAVGRETRIRKQWNE
SYI2_BACCR      -------------------------MEKVD------------VKESAVGREMRIRKQWNE
SYI2_OCEIH      --------------------------------------------MDHAQRERSMRAHWKE
SYI2_STAAU      ------------------------------------------MTKKYLNTQNEISAFWNT
SYI_CLOAB       ------------------------MYKKVD------------SSKSFVDIERDVLKLWHE
SYI_CLOTE       ------------------------MYKKID------------GSKSFVQMEREVLDFWNK
SYI_CLOPE       ------------------------MYKKVE------------LPKGFVGVEKEVADLWKE
SYI_THEAC       --------------------MQSLRFRQID------------PGMTLREIDSEILKYWKD
SYI_THEVO       --------------------MQAQRYRLIE------------QGNTIMDIDNEILRYWND
SYI_PICTO       --------------------MKATLYENIN------------VNKSMIDINNEILNYWKE
SYI_EHRRG       --------MCIVKTLHLITHVMKEYNSQFT------------EGSDFSLIEEQILEFWKE
SYI_EHRRW       --------MCIVKTLHLITHVMKEYNSQFT------------EGSDFSLIEEQILEFWKE
SYI_EHRCJ       --------MCIVKYLSLIINTMTEHYSQLT------------GEPDFPSIEENVLKFWQE
SYI_ANAMM       ----------------------MNYYPEVK------------GNPEFSAIEKEILQYWNS
SYI_RICCN       -------------------MTNTKYYPEVS------------SNADFAGLEREILKFWQD
SYI_RICFE       -------------------MTNTKYYPEVS------------SNADFAAIEREILKFWQD
SYI_RICPR       -------------------MTNTKYYPDVS------------ANVDFAAIEQEILKFWQN
SYI_RICTY       -------------------MTNTKYYPDVS------------ANVDFAAIEREILKFWQN
SYI_WOLPM       --------------------MKSKHYPDTV------------SSPDFLSLEKEIIKFWQE
SYI_WOLTR       --------------------MKPKHYPDTI------------SSPDFSSLEKEIIKFWQE
SYI_COREF       ----MTEA-------------VGGVYPLVD--------MT-GGSSRFPEMEENVLDFWKR
SYI_CORGL       ----MSEA-------------VGGVYPQVD--------LS-GGSSRFPEMEENVLSYWKK
SYI_CORDI       ----MSDA-------------VGGVYPRVD--------MS-GGTNVFPDMERQVLEYWKD
SYI_CORJK       ----MSEATP-----------AGGAYPRVD--------MSNGGSTAFPALEENVLKYWEK
SYI_MYCBO       ----MTDN----------------AYPKL-----------AGGAPDLPALELEVLDYWSR
SYI_MYCTU       ----MTDN----------------AYPKL-----------AGGAPDLPALELEVLDYWSR
SYI_MYCPA       ----MTDNLGFQADREAQPADSVQTYPKP-----------AGGAPDFPALELEVLDYWAR
SYI_MYCLE       ----MTNSAYPRTD----------LGADQ-----------RGGSPNFPALEAQVLDYWSN
SYI_NOCFA       ----MADDSNS-------------AYPRVD--------YGAGTGAAFPDLERRVLEAWAA
SYI_LEIXX       MVPRRSRQRPASSCRTAKTARREMPYPLPAPDGQEPEAQPVTPSPVFPEIEEDVLAFWDR
SYI_TROW8       ----MCDQGEVSSQ-------NSSDYKEQR----------PTPRPNLPKIEESVLAFWSS
SYI_TROWT       ----MCDQGEVSSQ-------NSSDYKEQR----------PTPRPNLPKIEESVLAFWSS
SYI_BIFLO       ----MSEN----------------VYPKANEGG---ETAHVAPNPSFPDMEETVLDYWDK
SYI2_PSEFL      ------------------------MSTEGS------------GPVRFPAMEDAVLERWEK
SYI_CHLAB       -----------------------MHTEGEG------------SKESLASREERILNFWKT
SYI_CHLCV       -----------------------MNTEGES------------SKESLANREERILDFWKT
SYI_CHLPN       ------------------------MTADEV------------GKNSFAKKEEQVLKFWKD
SYI_CHLMU       --------------------------MDNE------------DKVSFPAKEEKVLTFWKE
SYI_CHLTR       --------------------------MDNE------------DKISISAKEEKILSFWKE
SYI_PARUW       -------------------------MFEEV------------LQESFDEREKKVLKFWQE
SYI_BDEBA       ---------------MTNANTRSTPYSAVK------------PDVNLAKQEETILDFWDQ
SYI_BORBU       ------------------------MFKKVE------------NKANFPKIEEKILKFWND
SYI_BORBP       ------------------------MFKKVE------------NKANFPKIEEKILKFWND
SYI_TREDE       ------------------------MYKPVD------------PKVDFAKQEEDVLKFWEK
SYI_TREPA       ------------------------MYTPVD------------PKVDFVAQERRILAFWRE
SYI_DEHM1       ------------------------MFKAVN------------PRQNFPQMEEDILKLWQD
SYI_DEHMC       ------------------------MFKAVN------------PRQNFPQMEEEILKIWQD
SYI_THET2       ------------------------MFKEVG-------------EPNFPKLEEEVLAFWKR
SYI_THET8       ------------------------MFKEVG-------------EPNFPKLEEEVLAFWKR
SYI_DEIRA       --------------------MTKRTFAPVP------------TQPNFRQLEADILQKWKD
SYI_STRAW       --------------------MKPPQYRQVP------------AQVDLPALEHAVLDFWRE
SYI_STRCO       --------------------MTTPQYRQVP------------AQVDLPALEHAVLDFWRE
SYI_THEFY       -----------------MSKESTRPFPTLP------------AQIDLPAMEHEVLRRWEE
SYI_CUTAK       -----------MTDVNPVRSDNCRQYNNVP------------PQIDLPAMDHEIIDLWAR
SYI_BACFN       ---------------------MSKKFAEY-------------SQFDLSKVNKDVLKKWDE
SYI_BACFR       ---------------------MSKKFAEY-------------SQFDLSKVNKDVLKKWDE
SYI_BACTN       ---------------------MGKRFTEY-------------SQFDLSQVNKDVLKKWDE
SYI_PORGI       ---------------------MSRRFAEY-------------ESLDLSRVNEEVLADWMQ
SYI_CHLTE       ---------------------MPATYPEYP------------SSLSYSAMEAQIREFWIE
SYI_SULAC       ----------------------------MT------------SKFDPLKFEEEVLKYWDD
SYI_SULTO       ----------------------------MP------------SKFDPLSTEKEILKFWEQ
SYI_AERPE       --------------------MGSVPRVLEG------------ERYDQFALESFVKSYWEE
SYI_METJA       --------------------------MKKV------------EPVNFRELDKKIKKFWEE
SYI_METMP       --------------------------MKQV------------KSVNFRELDKKVKEYWKK
SYI_PYRFU       -----------------------MIKEPEF------------RDYTPGKLEEKIEQFWKE
SYI_PYRHO       -----------------------MIKEPEF------------RDYTPGKLEEKIEEFWKE
SYI_PYRAB       -----------------------MIKEPEF------------REYDPKKLEEKVEKFWSE
SYI_THEKO       -----------------------MIREPEF------------REYNPGQLEEKIEAFWKE
SYI_METTH       -----------------------MPIQEAE------------KSYRPHRIEEKVQSFWEE
SYI_METTM       -----------------------MPIQEAE------------KSYKPHVIEEKVQSFWEE
SYI_METKA       ------------------------MGAGEM------------AEALGEELEREIQRRWEE
SYI_METAC       ------------------------MIKEIT------------AKYNAEQIEKKVTQFWED
SYI_METMA       ------------------------MIKEIT------------AKYDAEQIEKKVTQFWED
SYI_ARCFU       ---------------------------MLP------------AKYSPKDVESEIFKFWED
SYI_HALMA       ----------------------MERFAAVD------------DQYDPDAVEDGVFEYWDD
SYI_NATPD       ----------------------MSRFAEVD------------DQYDPDAVEDRVFDYWDE
SYI_HALSA       ----------------------MSGFGDVP------------DQYDPAGVEERVFSYWEA
SYI_PYRAE       ---------------------MPHGDLPLP------------PSYRPHEVKKAVEEFWRR
                                                                  .  :   *  

SYI2_BACAN      QNIFEQSIQNREGAQ----SFVFYEGPPTANG-LPHVGHALGRTIKDVVARYKTMAGYKV
SYI2_BACHK      QSIFEQSIQNREGAQ----SFVFYEGPPTANG-LPHVGHALGRTIKDVVARYKTMAGYKV
SYI2_BACCZ      QSIFEQSIQNREGAQ----SFVFYEGPPTANG-LPHVGHALGRTIKDVVARYKTMAGYKV
SYI2_BACC1      QSIFEQSIQNREGAQ----SFVFYEGPPTANG-LPHVGHALGRTIKDVVARYKTMAGYKV
SYI2_BACCR      QNIFEQSIQNREGAQ----SFVFYEGPPTANG-LPHVGHALGRTIKDLVARYKTMAGYKV
SYI2_OCEIH      NRTFQRSIENREGQQ----TYVFYEGPPTANG-MPHAGHALGRTIKDFVARYKTMSGYQV
SYI2_STAAU      QKIFKKSIDNRKGQE----SFVFYDGPPTANG-LPHAGHVLGRVIKDLVARLKTMQGFYV
SYI_CLOAB       KEIVKKSFNSNQDGE----YFSFYDGPPTANG-RPHVGHIITRVMKDLIPRYKVMKGYKV
SYI_CLOTE       NNIVDKSFALNEEGE----YFTFYDGPPTANG-KPHVGHVLTRVIKDLIPRYKVMKGYKV
SYI_CLOPE       KNIIKKNFDMNQDGE----YFTFYDGPPTANG-KPHVGHVLTRVMKDIIPRYKVMKGYKV
SYI_THEAC       KNILEKILS-KGGSK----KFVFLEGPPTANG-RPHIGHAMTRTIKDIVLRYNTMTDHKI
SYI_THEVO       HAINEKIFK-KEGTK----KFVFLEGPPTANG-RPHIGHAMTRTIKDIVLRYNTMTGHKI
SYI_PICTO       NHIDENIIKSNRNLK----PFAFLEGPPTANG-RPHVGHLMTRAVKDTVMRYKYMTGHDI
SYI_EHRRG       NNIFKKSIENRDEK----RRFVFYDGPPFANG-LPHYGHLLTGFIKDTVARYKTMAGFRV
SYI_EHRRW       NNIFKKSIENRDEK----RRFIFYDGPPFANG-LPHYGHLLTGFIKDTVARYKTMAGFRV
SYI_EHRCJ       NNIFKKSVDNRDEN----KRFIFYDGPPFANG-LPHYGHLLTGFIKDTVARYKTMAGFKV
SYI_ANAMM       EKIFEESVNTRSRD----RSFVFYDGPPFANG-LPHYGHLLTGFIKDAVARYKTMRGFRV
SYI_RICCN       NNIFQKSIDDRNGE----SEFIFYDGPPFANG-LPHYGHLLTGFIKDVYARYQTIKGKKV
SYI_RICFE       NNIFQKSIDDRNGE----SEFIFYDGPPFANG-LPHYGHLLTGFIKDVYARYQTVKGKKV
SYI_RICPR       NNIFQKSIDYRNGE----SEFIFYDGPPFANG-LPHYGHLLTGFIKDVYARYKTIKGKKV
SYI_RICTY       NNIFQKSIDHRDGE----SEFIFYDGPPFANG-LPHYGHLLTGFIKDVYARYQTVKGKKV
SYI_WOLPM       NKVFERSVEERSKD----NCFVFYDGPPFANG-LPHYGHLLTGFIKDAFARYQTMLQKRV
SYI_WOLTR       NKIFEQSVEKRSKD----NCFVFYDGPPFANG-LPHYGHLLTGFIKDAFARYQTMLQKKV
SYI_COREF       DDTFQASIDQRNDA----EDYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYQTMRGYRV
SYI_CORGL       DDTFQASIDQRDGA----EDYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYQTMRGYRV
SYI_CORDI       DETFKASLTNREEN----PEYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYQTMKGKLV
SYI_CORJK       DGTFNESVASREGN----EEYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYQTMQGKKV
SYI_MYCBO       DDTFRASIARRDGA----PEYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYRTMRGYKV
SYI_MYCTU       DDTFRASIARRDGA----PEYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYRTMRGYKV
SYI_MYCPA       DDTFRASIARRDGA----EEYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYRTMRGNKV
SYI_MYCLE       DDTFRASIARCDDA----PEYVFYDGPPFANG-LPHYGHLLTGYVKDIVPRYRTMCGYKV
SYI_NOCFA       DDTFRASIENRSGA----AEFVFYDGPPFANG-LPHYGHLLTGYVKDVIPRFQTMRGKRV
SYI_LEIXX       DGTFHASIDNRDGA----PEWVFYDGPPFANG-LPHYGHLMTGYAKDVFPRYQTMRGKKV
SYI_TROW8       DKTFEASLEQRQHG----KRWVFYDGPPFANG-LPHFGHLLTGYIKDAIPRYQTMRGQYV
SYI_TROWT       DKTFEASLEQRQHG----KRWVFYDGPPFANG-LPHFGHLLTGYIKDAIPRYQTMRGQYV
SYI_BIFLO       DDTFQKSVERNPSGDHSQNEFVFFDGPPFANG-LPHYGHLLTGYAKDVIPRYQTMKGRKV
SYI2_PSEFL      EKTFEQSISAREGK----PVYVFYDGPPFATG-LPHYGHILTSYIKDVIPRYQTMLGKQV
SYI_CHLAB       QEIFQKSLKNREGR----TLYSFYDGPPFATG-LPHYGHLLAGTIKDVVGRFATMDGYYV
SYI_CHLCV       HDIFQKSLKNREGK----TLYSFYDGPPFATG-LPHYGHLLAGTIKDVVGRFATMDGYYV
SYI_CHLPN       NQIFEKSLQNRQGK----TLYSFYDGPPFATG-LPHYGHLLASTIKDVVGRYATMDGYYV
SYI_CHLMU       QNIFQKTLENRDGS----PTFSFYDGPPFATG-LPHYGHLLAGTIKDVVCRYATMDGHYV
SYI_CHLTR       QDIFQKTLDNREGC----PTFSFYDGPPFATG-LPHYGHLLAGTIKDVVCRYASMDGHYV
SYI_PARUW       GQLFERSVENRKGQ----PLFTFYDGPPFATG-LPHYGHILAGTIKDVVLRYKTMKGFCA
SYI_BDEBA       EKIFAQSL-NPEGK----KTYSFYDGPPFATG-LPHYGHLLAGVLKDVVPRYWTMKGYTV
SYI_BORBU       NKIFEKSIKQREGC----EEFTFYDGPPFATG-LPHFGHFVPNTIKDIIPRYQTMQGKYV
SYI_BORBP       NKIFEKSMEQREGC----EEFTFYDGPPFATG-LPHFGHFVPNTIKDIIPRYQTMKGKYV
SYI_TREDE       NDVFKKSVSSRDGR----DNYIFFDGPPFATG-LPHFGHFVPGTIKDIIPRYKTMKGFRV
SYI_TREPA       RRVFEQSVAQRAQG----KSYVFFDGPPFATG-LPHFGHFVPSTIKDIIPRYQTMRGAYV
SYI_DEHM1       KGVFKKSIENRRDG----KRFTLYEGPPTANG-RPGIHHVLSRVFKDVIPRYKVMKGYYA
SYI_DEHMC       KGIFKKSIENRRDG----KRFTLYEGPPTANG-RPGIHHVLSRVFKDVIPRYKVMKGYYA
SYI_THET2       EKIFQKSVENRKGG----PRYTVYEGPPTANG-LPHVGHAQARSYKDLFPRYKTMRGYYA
SYI_THET8       EKIFQKSVENRKGG----PRYTVYEGPPTANG-LPHVGHAQARSYKDLFPRYKTMRGYYA
SYI_DEIRA       EQVFEQTQTRPAPA----GEFVFYEGPPTANG-KPALHHVLARSFKDLFPRFKVMQGHHV
SYI_STRAW       QKIFAKSLEQSEGR----PEWVFYEGPPTANG-MPGAHHIEARVFKDVFPRFRTMRGYHV
SYI_STRCO       QKIFAKSLEQSEGR----PEWVFYEGPPTANG-MPGAHHIEARVFKDVFPRFRTMRGYHV
SYI_THEFY       HKIFERSLEQTQGG----PTWVFYEGPPTANG-TPGVHHVEARVFKDVFPRFKTMKGFYV
SYI_CUTAK       QHTFDKSLEATKDG----QPWTFFEGPPTANG-QPGTHHVEARVFKDIFPRFKTMQGFRV
SYI_BACFN       NQVFAKSMTEREGC----PSFVFFEGPPSANG-MPGIHHVMARSIKDIFCRYKTMKGYQV
SYI_BACFR       NQVFAKSMTEREGC----PSFVFFEGPPSANG-MPGIHHVMARSIKDIFCRYKTMKGYQV
SYI_BACTN       NQVFAKSMTERDGC----PSFVFFEGPPSANG-MPGIHHVMARTIKDIFCRYKTMKGYQV
SYI_PORGI       HRLFEESLKSREGA----PSFVFYEGPPSANG-MPGIHHVMARAIKDTICRYKTMKGFRV
SYI_CHLTE       RNIFRKSLEKDAPK----GIYSFYEGPPTVNG-KPGVHHLFSRTIKDVVCRYHTMQGYQV
SYI_SULAC       NNIYKKLKEINEKN---HKKFLFIDGPPYPSSPIPHIGTVWNKTIKDCILRYERLMGYSV
SYI_SULTO       NKIYEKLKEYNSKF---EKKFLFIDGPPYPSSPIPHIGTVWNKVIKDCILRYERLAGFRT
SYI_AERPE       NSIYRKVKEKSSRA---PRKFYFLDGPPYASAKSIHIGTAWNKVVKDVVLRFYRMTGYNV
SYI_METJA       NDIYQKVKKKNER----NKEFYFVDGPPYCSG-AIHLGTAWNKIIKDTYLRFKRMQGYNV
SYI_METMP       ENTYKKVKALNEH----GPEYYFVDGPPYCSG-AIHLGTAWNKIIKDTVLRFKRIQGYNV
SYI_PYRFU       SNIYQKVKELRKN----GPKYYFLDGPPYVSG-AIHLGTAWNKIIKDMIIRFRTMQGYNV
SYI_PYRHO       NNIYQKIKELRKN----GPKYYFLDGPPYVSG-AIHLGTAWNKIIKDMIIRFRTMQGYNV
SYI_PYRAB       NEIYRKVKELRKD----GPKYYFLDGPPYVSG-AIHLGTAWNKIIKDMIIRFRTMQGYNV
SYI_THEKO       NNTYEKVKKLREN----GPKYYFLDGPPYVSG-AIHLGTAWNKIIKDMIIRFRSMQGYNV
SYI_METTH       RDIYERVKELRED----RPRYSFLDGPPYCSG-RIHLGTAWNKIMKDTYLRFKSMKGFNV
SYI_METTM       RDIYERVKELREE----GPRYSFLDGPPYCSG-RIHLGTAWNKIMKDSYLRFKSMRGFNV
SYI_METKA       MDLLSKVLEKNRD----GPLFYFLDGPPYASG-SIHLGTAWNKIIKDAVNRYKLMRGYRV
SYI_METAC       SDAYRKTRERRKT----GKRLFFVDGPPYTTG-HIHLGTAWNKIIKDTILRYYSMNNRYI
SYI_METMA       SDAYRKTREHRKS----GKRLFFVDGPPYTTG-HIHLGTAWNKIIKDSILRYYSMNNRYI
SYI_ARCFU       NDIYRKVKE--KG----GRKFYFVDGPPYTTG-RIHLGTAWNKVLKDTILRYKRMMGFAP
SYI_HALMA       VDAYEQTKAHRAD----GEDYFFVDGPPYTSG-AAHMGTTWNKTLKDCYIRYLRMQGYNV
SYI_NATPD       VDAYERTVEHRAD----GEDFFFVDGPPYTSG-SAHMGTTWNKTLKDAYIRYHRMRGYNV
SYI_HALSA       VDAYEQTVDHRAD----AETFFFVDGPPYTSG-AAHMGTTWNKTLKDAYIRYHRMQGYDV
SYI_PYRAE       NRIFEKWKSWRGG-----PKFTFLEGPPTTNG-MPHVGHIRGRTYKDVVIRFYRLLGYDV
                                      . :***  ..             **   *   :     

SYI2_BACAN      LRK-AGWDTHGLPVELGVEKQL---GISGKHEIEEYG-IEPFIKKCKESVFTYEKQ----
SYI2_BACHK      LRK-AGWDTHGLPVELGVEKQL---GISGKHEIEEYG-IEPFTKKCKESVFTYEKQ----
SYI2_BACCZ      LRK-AGWDTHGLPVELGVEKQL---GISGKHEIEEYG-IEPFIKKCKESVFTYEKQ----
SYI2_BACC1      LRK-AGWDTHGLPVELGVEKQL---GISGKHEIEEYG-IEPFIKKCKESVFTYEKQ----
SYI2_BACCR      LRK-AGWDTHGLPVELGVEKQL---GISGKHEIEEYG-IEPFIQKCKESVFTYEKQ----
SYI2_OCEIH      LRK-AGWDTHGLPVELEVEKQL---NIRGKDDIEKFG-VERFIEKCKESVFVYENE----
SYI2_STAAU      ERK-AGWDTHGLPVELEVEKKI---GIKGKQDIEKYG-IENFINECKKSVFNYEKE----
SYI_CLOAB       PRK-AGWDTHGLPVELEIEKKL---GISGKPQIEEYG-IEKFVKECKESVFSYVSL----
SYI_CLOTE       LRK-AGWDTHGLPVELEIEKKL---GISGKEEIEKFG-VEEFIKECKDSVFTYSSM----
SYI_CLOPE       IRK-AGWDTHGLPVELEIEKKL---GISGKPQIEDYG-VEKFVTECKDSVFTYVSM----
SYI_THEAC       YRRVGGWDCHGLPVELEAEKHF---GFHTKSEIVNFG-VEKFNQYCRESIFRYIDE----
SYI_THEVO       YRRYGGWDCHGLPVELEAEKYF---GFKTKSDIINYG-VEKFNSYCRDSVFRYIDE----
SYI_PICTO       LRRTGGWDCHGLPVELEAEKHF---GFKNKKDIENFG-IEKFNQYCRDSVFRYIDE----
SYI_EHRRG       DRR-FGWDCHGLPAEMLAEKEL---GVSGKLAIEEFG-IEKFNNYCRNSVMKFSRE----
SYI_EHRRW       DRR-FGWDCHGLPAEMLAEKEL---GVSGKLAIEKFG-IEKFNNYCRNSVMKFSRE----
SYI_EHRCJ       ERR-FGWDCHGLPAEMLSEKEL---GISGKLAIEKFG-IEKFNNHCRNSVMKFSKE----
SYI_ANAMM       ERK-FGWDCHGLPAEMLAEKEL---GVSGKVSIESFG-IDKFNDYCRSSIMRFTQQ----
SYI_RICCN       ERR-FGWDCHGLPAEMQSEKEL---GISGRLAIANFG-IEKFNAHCRASVMKYAND----
SYI_RICFE       ERR-FGWDCHGLPAEMQSEKEL---GISGRLAITNFG-IEKFNSHCRASVMKYASD----
SYI_RICPR       ERR-FGWDCHGLPAEMQSEKEL---GISGRIAITNFG-IEKFNNHCRASVMQYASE----
SYI_RICTY       ERR-FGWDCHGLPAEMQSEKEL---GISGRLAITNFG-IEKFNNHCRASVMQYASE----
SYI_WOLPM       ERR-FGWDCHGLPAEMGAEKEL---GISGRTEIEKFG-IDKFNDHCRTSVMKFSSE----
SYI_WOLTR       ERR-FGWDCHGLPAEMGAEKEL---GISGRTEIEKFG-IEKFNNYCRTSVMKFSSE----
SYI_COREF       PRV-FGWDTHGLPAELEAEKQL---GIKDKGEIESMG-LAQFNDYCAKSVLQYTKE----
SYI_CORGL       PRV-FGWDTHGLPAELEAEKQL---GIKDKGEIEAMG-LAKFNEYCATSVLQYTKE----
SYI_CORDI       NRV-FGWDCHGLPAELEAEKQL---GIKDKGEIEAMG-LESFNNYCAKSVLEYTQE----
SYI_CORJK       ARV-FGWDCHGLPAELEAEKQL---GIKDRAGIEEMG-MRSFNEYCATSVLRYTDE----
SYI_MYCBO       ERR-FGWDTHGLPAELEVERQL---GITDKSQIEAMG-IAAFNDACRASVLRYTDE----
SYI_MYCTU       ERR-FGWDTHGLPAELEVERQL---GITDKSQIEAMG-IAAFNDACRASVLRYTDE----
SYI_MYCPA       ERR-FGWDTHGLPAELEVERQL---GITDKSQIDDMG-IAAFNDACRESVLRYTDE----
SYI_MYCLE       ERR-FGWDTHGLPAELEVERQL---GITDKSQIDAMG-IAAFNEACRKSVLRYTEE----
SYI_NOCFA       DRR-FGWDCHGLPAEIEAEKQL---GITDKSQIDAMG-LAEFNAACKSSVLRYTGE----
SYI_LEIXX       ERR-FGWDTHGLPAELEAERQL---GITDKSQIEEMG-LAAFNQAAKDSVLKYTRE----
SYI_TROW8       PRV-FGWDTHGLPAELEAMKRL---GITEKSQIESMG-IASFNEAARKSVLTYVDQ----
SYI_TROWT       PRV-FGWDTHGLPAELEAMKRL---GITEKSQIESMG-IASFNEAARKSVLTYVDQ----
SYI_BIFLO       NRV-FGWDTHGLPAELEAQKEL---GIDSVDQIEKMG-IDKFNDACRASVLKYTNE----
SYI2_PSEFL      PRR-WGWDCHGLPVEFEVEKAM---GFKSKRDILEFG-VEQFNDECRELVLKYADD----
SYI_CHLAB       PRR-FGWDCHGVPVEYEVEKSL---NLTTPGAIEDFG-VAKFNEECRKIVFRYVDE----
SYI_CHLCV       PRR-FGWDCHGVPVEYEVEKSL---DLTTPGAIEDFG-VAKFNEECRKIVFRYVDE----
SYI_CHLPN       PRR-FGWDCHGVPVEYEVEKSL---SLTAPGAIEDFG-IASFNEECRKIVFRYVHE----
SYI_CHLMU       PRR-FGWDCHGVPVEYEVEKSL---GLTEPGAIDRFG-IANFNEECRKIVFRYVDE----
SYI_CHLTR       PRR-FGWDCHGVPVEYEVEKSL---GLTEPGAIERFG-VANFNEECRKIVFRYADE----
SYI_PARUW       PRR-FGWDCHGLPVENEIEKTF---GLSGAKSIEEFG-IAKFNEECRNIVLRYTEE----
SYI_BDEBA       PRR-FGWDCHGLPVEYEINKTH---KIESRKDVFKMG-VANYNDACRSIVKRYSTE----
SYI_BORBU       KRN-FGWDTHGLPVEYEVEKKL---GISGKYEIENYG-IENFNKECRKIVLRYTEE----
SYI_BORBP       KRN-FGWDTHGLPVEYEVEKKL---GISGKYEIENYG-IENFNKECKKIVLRYTEE----
SYI_TREDE       ERR-FGWDCHGLPVENLIEKEL---GLNSKTDIEKYG-IDKFNEACRASVLRYVKE----
SYI_TREPA       PRR-FGWDCHGLPIEHLIEQEL---NLNSKSDVESYG-VSAFNAACRSSVLRYVKE----
SYI_DEHM1       PRI-GGWDTHGLPVELEVEKEL---GFTSKNDIEKYG-IAEFNARCRSSVFKYVSE----
SYI_DEHMC       PRI-GGWDTHGLPVELEVEKEL---GFTSKNDIEKYG-IAEFNTRCRSSVFKYVSE----
SYI_THET2       PRR-AGWDTHGLPVELEVEKKL---GLKSKREIEAYG-IERFNQACRESVFTYEKE----
SYI_THET8       PRR-AGWDTHGLPVELEVEKKL---GLKSKREIEAYG-IERFNQACRESVFTYEKE----
SYI_DEIRA       TRK-GGWDTHGLPVEISVEKKL---GWLGRNHGASREELEEFNRLCRTSVWETIQD----
SYI_STRAW       ARK-AGWDCHGLPVELAVEKEL---GFSGKQDIEAYG-IAEFNAKCRESVTRHTDA----
SYI_STRCO       GRK-AGWDCHGLPVELAVEKEL---GFSGKQDIEAYG-IAEFNAKCRESVTRHTDA----
SYI_THEFY       ERK-AGWDCHGLPVEVAVEKEL---GISGKKDIEAFG-IAEFNARCRESVLRNVDA----
SYI_CUTAK       DRK-AGWDCHGLPVELAVEKEL---GFSGKPDIEKYG-VEPFNAKCRESVTRHVDA----
SYI_BACFN       KRK-AGWDTHGLPVELGVEKSL---GITKEDIGKTIS-VAEYNAHCRQDVMKFTKE----
SYI_BACFR       KRK-AGWDTHGLPVELGVEKSL---GITKEDIGKTIS-VAEYNAHCRQDVMKFTKE----
SYI_BACTN       KRK-AGWDTHGLPVELSVEKAL---GITKEDIGKKIS-VADYNAACRKDVMKYTKE----
SYI_PORGI       DRK-AGWDTHGLPVELGVEKSL---GITKEDIGKSIS-VEEYNAACRRDVMKFTKE----
SYI_CHLTE       PRK-AGWDTHGLPVEISVEKKL---GLKNKSHVEEYG-VGEFNREARALVYHHIDDNREG
SYI_SULAC       KDQ-PGYDTHGLPIEVETEKRL---GIKSKAEIIEKVGVDNFISKCKEFAVNNSKS----
SYI_SULTO       YDQ-PGYDTHGLPIEVAIEKQL---GIQKKSDIIEKIGVDNFVNKCKEFALNNASS----
SYI_AERPE       WDK-PGYDTHGLPIEVKIEQSL---GVRVKREIEEKVGVENFIAACKRFVDENMEA----
SYI_METJA       LDK-AGWDMHGLPIEVKVENEF---GIKNKKEIETKIGVKQFIEKCKEFALKHKEI----
SYI_METMP       LDK-AGWDMHGLPIEVKVENEF---NIGSKKDIETKIGTQEFINKCKEFALNHLGH----
SYI_PYRFU       WRQ-PGYDMHGLPIEVKVEQAL---GLKTKKEIEEKIGVENFIQKCKEFALNNLRI----
SYI_PYRHO       WRQ-PGFDMHGLPIEVKVEQAL---GLKTKKEIEEKIGVENFIKKCKEFALNNLKI----
SYI_PYRAB       WRQ-PGYDMHGLPIEVKVEQAL---GLKTKKEIEEKIGVENFIKKCKEFALNNLKI----
SYI_THEKO       RRQ-PGFDMHGLPIEVKVEQAL---KLKNKREIETKIGVDNFIKKCKEFALNNLKI----
SYI_METTH       RRQ-PGWDTHGLPIEHKVEGLL---GVRSKKDIEDKIGIEEFVNKCREFAVENKAV----
SYI_METTM       RRQ-PGWDTHGLPIEHKVEGIL---GVRSKKDIEDKIGIEEFVRKCREFAMENKAV----
SYI_METKA       RLQ-PGWDCHGLPIEVKVEQEVLSDEIECKKDIEEKVGVDKFVEKCKEFALKHVEI----
SYI_METAC       LER-PGWDMHGLPIEVRVEGVL---GFKSKKDIES-FGVENFIEKCKEFAITQKQA----
SYI_METMA       LER-PGWDMHGLPIEVKVEGVL---GFKSKKDIES-FGVENFIEKCKEFAIKQKQA----
SYI_ARCFU       TDT-PGWDMHGLPIEVKVEQEL---GFRTKRDIES-FGIDKFIERCMNYALANKDA----
SYI_HALMA       TDR-PGYDMHGLPIETKVEERL---DFENKKDIEQ-FGEENFIEECKDFAEEQLEG----
SYI_NATPD       TDR-PGYDMHGLPIETKVEERL---GFDNKKDIEE-FGEQNFIDECKSFAEEQLEG----
SYI_HALSA       TDR-PGYDMHGLPIETKVEEQL---GFESKKDIQE-FGEEAFIEECKRFADDNLDG----
SYI_PYRAE       WVQ-GGWDMQGMPVEWEVEKKL---KLRSKKDIEQ-FGLEKFALECNSLVEEYLAYW---
                     *:* :*:* *                          :   .              

SYI2_BACAN      WREFTESIGYWVDMDDPYVTLENPYIESVWHILGTIHEKGLLYKGHRVSPYCPSCQTSLS
SYI2_BACHK      WREFTESIGYWVDMDDPYVTLENPYIESVWHILGTIHEKGLLYKGHRVSPYCPSCQTSLS
SYI2_BACCZ      WREFTESIGYWVDMDDPYVTLENPYIESVWHILGTIHEKGLLYKGHRVSPYCPSCQTSLS
SYI2_BACC1      WREFTESIGYWVDMDDPYVTLENPYIESVWHILGTIHEKGLLYKGHRVSPYCPSCQTSLS
SYI2_BACCR      WREFTESIGYWVDMDDPYVTLKNPYIESVWHILGTIHEKGLLYKGHRVSPYCPSCQTSLS
SYI2_OCEIH      WKEFTDKLGYWVDMEDPYKTLNNPYIESVWNILATIHDEDLLYKGHRVVPYCPNCETSLS
SYI2_STAAU      WRDFSKDLGYWVDMDSPYITLENNYIESVWNILSTFHKKGLLYKGHKVTPYCTHDQTALS
SYI_CLOAB       WKDMSEKLGYWVDMENPYVTYHNDYIESVWWALKQMWDKDLLYKGHKIVPYCPRCGTALS
SYI_CLOTE       WKDMSEKLAFWVDMENPYVTYHNDYIESVWWALKQLWNKELLYKGHKVIPYCPRCGTALS
SYI_CLOPE       WEKMTEQIGYWVDMENPYVTYHNPYIESVWWALKQMWDKKLLYKGYKTMPYCPRCGTSLS
SYI_THEAC       WKQVDDLIGFSIDHNGDYITLRNDYMESEWFALKTMYNSGLLYKDYTVVPYCPRCETSLS
SYI_THEVO       WKTVDQIIGFSIDHSGDYITLRNEYIESEWYVLKYIYENGLLYKDYTVVPYCPRCETSLS
SYI_PICTO       WNIVDDLVGFWVDKENSYITLKNDYMESEWWALKTLYENNLLVKDYKIVPYCPRCGTSLS
SYI_EHRRG       WKQYIDRQSRWVDFENDYKTMNLSFMESIMWSFYQLWQKGLIYESIKIVPYSWACQTPLS
SYI_EHRRW       WKQYIDRQSRWVDFENDYKTMNLSFMESIMWSFYQLWQKGLIYESIKIVPYSWACQTPLS
SYI_EHRCJ       WKQYVDRQARWVDFENDYKTMNSSFMESIIWSFHELWNKGLIYESIKIVPYSWACQTPLS
SYI_ANAMM       WREYVERQGRWVDFENGYRTMDKSFMESVMWAFHELWHKGLVYESVKVVPYSWACQTPLS
SYI_RICCN       WEEYVTRQARWVDFKNSYKTMDKNFMESVLWAFKELYNKGLLYESMRVMPYSWACETPLS
SYI_RICFE       WEEYVTRQARWVDFKNSYKTMDKNFMESVIWAFKELYNKGLLYESMRVMPYSWACETPLS
SYI_RICPR       WEQYVTRQARWVAFKNAYKTMDKNFMESVLWAFKELYNKDLLYESMRVMPYSWACETPLS
SYI_RICTY       WKQYVTRQARWVAFDNAYKTMDKNFMESVLWAFKELYNKGLLYESMRVMPYSWACETPLS
SYI_WOLPM       WEKYVNRQARWVDFHNDYKTMDKSFMESVMWAFKQLYDKGLVYESVRVVPYSWACETPLS
SYI_WOLTR       WEKYVNRQARWVDFHNDYKTMDRSFMESVIWAFKQLYDKGLVYESVRVVPYSWACETPLS
SYI_COREF       WEEYVTRQARWVDFENGYKTMDLTYMESVIWAFKELYDKGLIYQGFRVLPYSWAEHTPLS
SYI_CORGL       WEEYVTRQARWVDFENGYKTMDLSFMESVIWAFKELYDKGLIYQGFRVLPYSWAEHTPLS
SYI_CORDI       WKDYVTRQARWVDFDNGYKTMDMDFMESVMWAFKTLYDKGLIYQGFRVLPYSWAEHTPLS
SYI_CORJK       WKEYVTRQARWVDFDNGYKTMDPGFMESVMWAFKTLYDKGLIYQGFRVLPYSWAEHTPLS
SYI_MYCBO       WQAYVTRQARWVDFDNDYKTLDLAYMESVIWAFKQLWDKGLAYEGYRVLPYCWRDETPLS
SYI_MYCTU       WQAYVTRQARWVDFDNDYKTLDLAYMESVIWAFKQLWDKGLAYEGYRVLPYCWRDETPLS
SYI_MYCPA       WRAYVTRQARWVDFDHDYKTLDLPYMESVIWAFKQLWDKGLAYEGYRVLPYCWRDETPLS
SYI_MYCLE       WQAYVTRQARWVDFDNDYKTLDLSYMESVIWAFKQLWDKGLAYESYRVLPYCWRDETPLS
SYI_NOCFA       WRDYVTRQARWVDFDNDYKTLDLDFMESVMWAFKSLYDKGLIYQGFRVLPYSWYEQTPLS
SYI_LEIXX       WQQYVTRQARWVDFDNGYKTLDTTYMESVIWAFKQLHEKGLAYEGYRVLPYCWRDQTPLS
SYI_TROW8       WEEYVNRQARWVDFKNGYKTLDLDYMESVLWAFKTLYKKGVIYEGYKVLPYCWNDQTPLS
SYI_TROWT       WEEYVNRQARWVDFKNGYKTLDLDYMESVLWAFKTLYKKGVIYEGYKVLPYCWNDQTPLS
SYI_BIFLO       WQNYVHRQARWVDFEHGYKTLNIPYMESVMWAFKQLYDKGLAYQGYRVLPYCPKDRTPLS
SYI2_PSEFL      WRGFVNRMGRWVDFDGAYKTMDNDYMESVLWGFKTLHDKGHVYEGGKIVPYCVRCQTVLS
SYI_CHLAB       WEHYIYRVGRWVDFSATWKTMDASFMESVWWVFRSLYDQGLVYEGVKVVPFSTKLGTPLS
SYI_CHLCV       WERYVHRLGRWVDFSVTWKTMDASFMESVWWVFRSLYDQGLVYEGVKVVPFSTKLGTPLS
SYI_CHLPN       WEYYINRIGRWVDFSSTWKTMDASFMESVWWVFQSLYNQGLVYEGTKVVPFSTALGTPLS
SYI_CHLMU       WKYFVDRIGRWVDFSATWKTMDLSFMESVWWVFHSLYKQGLVYEGTKVVPFSTKLGTPLS
SYI_CHLTR       WKYFVDRIGRWVDFSATWRTMDLSFMESVWWVFRSLYDQGLVYEGTKVVPFSTKLGTPLS
SYI_PARUW       WKFTVNRMGRWVDFNQTYRTMDLPFMESVWWVFKQLYAKGLVYEGLKVMPFSAKLGTPLS
SYI_BDEBA       WKTTVRRVGRWVDMENPYFTMDVSFMQSVWWVFQQLFNKGLIYEGYKVVPYSVGISTSLS
SYI_BORBU       WKNIILRLGRWVDFEKGYKTMDISFMESVWWVFKNLYEKGLIYESYYVLPYSPKLATPLS
SYI_BORBP       WKNIILRLGRWVDFEKGYKTMDISFMESVWWVFKNLYNKGLIYESYYVLPYSPKLATPLS
SYI_TREDE       WKQTITRLGRWVDFENDYKTMEPAFMESIWWVMKSLWEKGLLYEGYYILPYCPRCSTVLS
SYI_TREPA       WQRTLTRLGRWVDFDNDYKTMDVCYMESVWWVVAQLWQRKLLYEGYKILPYCPRCATALS
SYI_DEHM1       WNKLTERIAYWVDLDNAYITMDNNYIESGWWALKQMWDKGLVYQGHRVTPHCPRCGTSLS
SYI_DEHMC       WNKLTERIAYWVDLDNAYITMDNKYIESGWWALKQMWDKGLVYQGHRVTPHCPRCGTSLS
SYI_THET2       WEAFTERIAYWVDLENAYATLEPTYIESIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPLS
SYI_THET8       WEAFTERIAYWVDLENAYATLEPTYIESIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPLS
SYI_DEIRA       WNELTERMGYWLDLGDPYITYQNSYVESVWNLLRRLHEKGLVAQDYKVVPLSPRISSTLS
SYI_STRAW       FEELTSRMGYWTDLNDPYRTMDPEYIESVWWSLKEIFNKGLLVQDYRVAPWCPQDETGLS
SYI_STRCO       FEELTTRMGYWADLQDPYRTMDPEYIESVWWSLKEIFNKGLLVQDHRVAPWCPRCGTGLS
SYI_THEFY       FTEMTRRMGYWVNMDEAYRTMDREYVESVWWAIKQIWDKGLLVQDYRISPYCPRCGTTLS
SYI_CUTAK       FSELTERMGYWVNMDEAYWTMSPSYVESVWWGLKRIWDKGLLGEDHRVAPYCPRCGTTLS
SYI_BACFN       WEDLTHKMGYWVDMKHPYITYDNRYIETLWWLLKQLYKKGLLYKGYTIQPYSPAAGTGLS
SYI_BACFR       WEDLTHKMGYWVDMKHPYITYDNRYIETLWWLLKQLYKKGLLYKGYTIQPYSPAAGTGLS
SYI_BACTN       WEDLTHQMGYWVDMKHPYITYDNRYIETLWWLLKQLHKKGLLYKGYTIQPYSPAAGTGLS
SYI_PORGI       WEDLTHKMGYWVDMEHPYITYDNRYIETLWWLLAELYKKGLLYKGYTIQPYSPAAGTGLS
SYI_CHLTE       WGKLTERMGYWVDMDSPYITCDNNYIESVWWALKTIFDKGLIYKDYKIVPQDPKSETVLS
SYI_SULAC       LTQNFRNLGIFMDWENPYFTFNNDYISNSWAVIKKAYERGLLYKGVHVLHWCSRCETTLA
SYI_SULTO       LTANFKNIGIFMDWNNPYMTLHNDYISNSWMLIKKAYERGLLYKGVHVLHWCPRCETTLA
SYI_AERPE       MTRQFKEIGVFMDWENPYVTYRDEYIESGWWLVKKAWEKGLLYKGYRVLHWCPRCETTLA
SYI_METJA       MEKQFKNLGVWLDWENAYMPITKEYMEIGWWTLKVAHEKGLLTRDLRVVYWCPRCETALA
SYI_METMP       MQGQFENLGVWLDFENAYMPIKRDYMEMGWWTLKKAHEKELLTKDLRSGYWCPRCETSLA
SYI_PYRFU       MTEQFKMLGVWMDWDNPYMTIKNEYIESAWFTLKRAWEKGLLEKDKRVLHWCPRCETALA
SYI_PYRHO       MTEQFKMLGIWMDWDDPYMTIKNEYIESAWFTLKKAWEKGLLEKDKRVLHWCPRCETALA
SYI_PYRAB       MTEQFKMLGIWMDWDNPYMTIKNEYIESAWFTLKRAWEKGLLEKDKRVLHWCPRCETALA
SYI_THEKO       MTEQFKQLGVWMDWDNPYMTIKNEYIESGWFTLKRAWEKGLLEKDKRVLHWCPRCQTALA
SYI_METTH       MTGQFQRLGVWMDWDDPYVTFDPAYMESCWWTLKRAHEKDLLVRDLRVITWCPRCETALA
SYI_METTM       MTSQFQRLGVWMDWDDPYVTFDPAYMESCWWTLKRAHEKDLLLRDLRVITWCPRCETALA
SYI_METKA       MTEQFKRLGVLMDWDNPYMTLDNEYIEGAWYTLKRAHERGLLDRDVRIVNWCPRCETALA
SYI_METAC       MTEQFQRLGVWMQWPEPYMTLKDDYIEAAWWTLKQAHEKDLLEVGKRSVNWCPRCETAIA
SYI_METMA       MTEQFQRLGVWLQWPDPYMTLKDEYIEAAWWTLKQASEKDLLEVGKRSVNWCPRCETAIA
SYI_ARCFU       MTEQFKSLAVWMDWENPYMTIKAEYMNAAWFAIKRAHERGLLERKKMVVNWCHRCETALA
SYI_HALMA       LQTDFQDFGVWMDWDDPYKTVNPEYMEAAWWGFQQAHERDLVEQGQRSINQCPRCETGIA
SYI_NATPD       LQEDFKSFGVWMDWDDPYKTVDPEYMEAAWWGFSKAHDRDLVEQGQRSISQCPRCETAIA
SYI_HALSA       LQSDFQSFGVWMDWDNPYKTVDPSYMEAAWWAFSEVHDNGLVERGQRSISQCPRCETAIA
SYI_PYRAE       REWGTKRLGLWLDLENAYETRQPHYLQYAWRIVKRAHELGLLTEDYRVLWFCPRCETSLS
                        .        : .    ::.     .                       : ::

SYI2_BACAN      SHEVAQG---YKTVKDLSATVKFKVKDSENE----------------------YFLGWTT
SYI2_BACHK      SHEVAQG---YKTVKDLSATVKFKVKDSENE----------------------YFLGWTT
SYI2_BACCZ      SHEVAQG---YKTVKDLSATVKFKVKDSENE----------------------YFLGWTT
SYI2_BACC1      SHEVAQG---YKTVKDLSATVKFKVKDSENE----------------------YFLGWTT
SYI2_BACCR      SHEVAQG---YKTVKDLSATVKFKVKDSENE----------------------YFLGWTT
SYI2_OCEIH      SHEVAQG---YKDVTDLSVTAKFRIKNKENE----------------------YILGWTT
SYI2_STAAU      SHEVAQG---YKNVKDLSAVVKFQLTNSKDT----------------------YFLSWTT
SYI_CLOAB       SHEVAQG---YKDVKEATAFVKFKVKGEENK----------------------YILAWTT
SYI_CLOTE       SHEVAQG---YKDVKEATAFVKFKVKGEENK----------------------YILAWTT
SYI_CLOPE       SHEVSQG---YKDVKDLTAVAKFKVKGEDNK----------------------YFLAWTT
SYI_THEAC       SHEVAQG---YKDVKDPSVYVRFKSADEENT----------------------YFVAWTT
SYI_THEVO       SHEVAQG---YKDVKDPSVYVRFKEKGSENT----------------------YFVAWTT
SYI_PICTO       SHEVAQG---YKNVDDPSVFVKFAEKGRKNR----------------------YFIAWTT
SYI_EHRRG       NFETRIDN-AYRQKTSKTVTLA--FELLDAP-----------KSLIVDNITAYKILVWTT
SYI_EHRRW       NFETRIDN-AYRQKTSKTVTLA--FELLDAP-----------KSLIVDNITAYKILVWTT
SYI_EHRCJ       NFETRMDN-AYREKTSKTVTVA--FELLESP-----------KFITVENVKTYKILVWTT
SYI_ANAMM       NFETKMDN-AYREKVSKSVTVR--FKLSEQ------------VGFVPQGVESCSILAWTT
SYI_RICCN       NFETRLDN-SYRERADKAVTVS--FVLSH------------PVTTTTGSFKEYRILAWTT
SYI_RICFE       NFETRLDN-SYRERADKAVTVS--FVLNEIPAINGMTSRE-SGTTSSGDYKEYRILAWTT
SYI_RICPR       NFETRLDN-AYRERTDKAITVS--FVLNEVTLINGIISQK-SDMKEGDNFKEYRILAWTT
SYI_RICTY       NFETRLDN-SYRERTDKAITVS--FMLNDITLFNSMISQK-LGMTGGDNFKEYRILAWTT
SYI_WOLPM       NFETRLDN-AYREKVSKAVTVA--FELLE------------NPQQFKSVKRKCKLLAWTT
SYI_WOLTR       NFETRLDT-AYRKKTSKAVTVA--FELLE------------NPQQF---KQKCKLLAWTT
SYI_COREF       NQETRLDD-SYKMRQDPTLTVT--MPITGKIEGTG----------ANEALIGANAIAWTT
SYI_CORGL       NQETRLDD-SYKLRQDPTLTVT--FPVTGVVEGSS----------ANAGLVGALALAWTT
SYI_CORDI       NQETRLDD-SYKMRQDPTLTVT--FPITGVKDDSA----------ADASLVGAYALAWTT
SYI_CORJK       NQETRLDD-SYKMRQDPTITVT--FPITGATEGTASV----KTLAEHPELADAAFIGWTT
SYI_MYCBO       NHELRMDDDVYQSRQDPAVTVG--FKVVGGQPDNG--------------LDGAYLLVWTT
SYI_MYCTU       NHELRMDDDVYQSRQDPAVTVG--FKVVGGQPDNG--------------LDGAYLLVWTT
SYI_MYCPA       NHELRMDDDVYPSRQDPALTVG--FKVVGGE------------------LDGAHLLIWTT
SYI_MYCLE       NHELRMDDDVYQSRQDPAVTLG--FKVLGGD-DED--------------LVGAYLLVWTT
SYI_NOCFA       NQETRLDD-AYKMRQDPAVTVDMVLSVPGEHPLRE--------------LDGANALIWTT
SYI_LEIXX       NHELRMDDDVYKMRQDQTVTVT--FPLTGAKAESL-------------GLTGVRVLAWTT
SYI_TROW8       NHELRMDDEVYKQRLDDSLTVT--FPLIGQKAKTC-------------GLDGVAALAWTT
SYI_TROWT       NHELRMDDEVYKQRLDDSLTVT--FPLIGQKAKTC-------------GLDGVAALAWTT
SYI_BIFLO       AHELRMDADVYQDRQDTTVSVA-------VKMRDE---------------DDAYAVFWTT
SYI2_PSEFL      NFEARLDD-AFRPRRDMSAYVKFR----------------------QQDRPDTFFLAWTT
SYI_CHLAB       NFEAGQN---YKEVDDPSVVIKFALHGDP-----------------------GSLLVWTT
SYI_CHLCV       NFEAGQN---YKEVDDPSVVIKFALHGDP-----------------------ASLLVWTT
SYI_CHLPN       NFEASQN---YKEVDDPSLVVRMPLQNDS-----------------------ASLLVWTT
SYI_CHLMU       NFEAGQN---YKEVDDPSVVAKFALQDDQ-----------------------GILLAWTT
SYI_CHLTR       NFEAGQN---YKEVDDPSVVVKFALQDNQ-----------------------GFLLAWTT
SYI_PARUW       NFEASEN---YKEVDDPSLTVAFQSRDNSN----------------------TYFLAWTT
SYI_BDEBA       NFEANQN---YKMVQDPAITVMFKLVNQPD----------------------TAIMAWTT
SYI_BORBU       NFEVNLGE--YKEVNDPSLTIKFKIKDKNE-----------------------YLLVWTT
SYI_BORBP       NFEVNLGE--YKEVNDPSLTIKFKIKDKNE-----------------------YLLAWTT
SYI_TREDE       NHELNLGG--YKDVHDPAITVRFKTLSPVKTSPAGKAFE-----GKNALPSDTYLLAWTT
SYI_TREPA       NHELNLGG--YQDVSDPAITVRFECTSVVPGSPAAREFCAAASWGSASLPAHTCFLAWTT
SYI_DEHM1       SHEVAQ--GYKDNTEDPSVFVKFEIAKE------SLAKAGLAKKWAYPADKPLYLLAWTT
SYI_DEHMC       SHEVAQ--GYKDNTEDPSVFVKFEINHE------SLAQTGLGQKWVNPSDKPLYLLAWTT
SYI_THET2       SHEVAL--GYKEIQ-DPSVYVRFPLK--------EPKKLGLEKAS---------LLIWTT
SYI_THET8       SHEVAL--GYKEIQ-DPSVYVRFPLK--------EPKKLGLEKAS---------LLIWTT
SYI_DEIRA       RAELGEVDSYRMVD-DPSVYVRLPIVWDTLP---ERAHAALSSLSG-EQRQGLSLLVWTT
SYI_STRAW       DHELAQ--GYETIV-DPSVYVRFPLT--------SGPLAGRAA-----------LLVWTT
SYI_STRCO       DHELAQ--GYETVV-DPSVYVRFPLT--------SGPLAGEAA-----------LVVWTT
SYI_THEFY       DHELAQ--GYETVT-DPSVYVRFPLT--------SGPLAGQAA-----------LLVWTT
SYI_CUTAK       DHELAQ--GYQDDR-DPSIYVRFPVT--------SGPLAGRAK-----------LLVWTT
SYI_BACFN       SHELNQPGCYRDVK-DTTVVAQFKMKNPK---------------PEMAQWGTPYFLAWTT
SYI_BACFR       SHELNQPGCYRDVK-DTTVVAQFKMKNPK---------------PEMAQWGTPYFLAWTT
SYI_BACTN       SHELNQPGCYRDVK-DTTAVAQFKMKNPK---------------PEMAEWGTPYFLAWTT
SYI_PORGI       THELNQPGCYRDVK-DTTCVAQFKIMDPK---------------PEMQLHGDAFFLAWTT
SYI_CHLTE       SHELALG--YKEVQ-DPSVYIKFRLKDS-----------------------GESILVWTT
SYI_SULAC       DYEV-S---EYRDLEDPSIYVKFRVKGEPN----------------------RYLVIWTT
SYI_SULTO       DYEV-S---EYKEIEDPSIYVKFKVKGSEN----------------------RYLVIWTT
SYI_AERPE       DYEV-S---EYRELEDPSIYVKFPVEGREG----------------------EYLLVWTT
SYI_METJA       EHEVRG---EYKEVYDPSVYVKFRLANEEN----------------------TYIVIWTT
SYI_METMP       EHEVRG---EYKEVLDPSVYVKFKLEKSD-----------------------EYITIWTT
SYI_PYRFU       EHEVRG---EYKLRKDPSIYVKFPVEGKEN----------------------EYLLIWTT
SYI_PYRHO       EHEVRG---EYKLRKDPSIYVKFPIEGKEN----------------------EYLLIWTT
SYI_PYRAB       EHEVRG---EYKLRKDPSIYVKFPVEGKEN----------------------EYLLIWTT
SYI_THEKO       EHEVRG---EYKMRKDPSIYVKFPIEWKEK----------------------EYLLIWTT
SYI_METTH       LAEI-----DYHDKEDPSIYVKFPVSGDT------------------------HILVWTT
SYI_METTM       LAEI-----DYHEKEDPSIYVKFPVSGDT------------------------YILVWTT
SYI_METKA       DHEV-----EYKEVEDPSIFVIFPIEDDSDAEVDLPEN--------------SALLIWTT
SYI_METAC       DSEV-----EYSERTDPSIYVKFKVKGEEN----------------------TFIVIWTT
SYI_METMA       DSEV-----EYSERTDPSIYVKFRVKGEEN----------------------TFIVIWTT
SYI_ARCFU       DAEV-----EYWDEEDPSIYVKFPVKGEKD----------------------TYIVIWTT
SYI_HALMA       NNEV-----EYHDVGKPSIYVKFPLA-EQD----------------------GSLVIWTT
SYI_NATPD       NNEV-----EYDHVEDPSIYVKFPLA-ERE----------------------GHLVIWTT
SYI_HALSA       NNEV-----EYEDVTDPSIYVRFDLD-DRE----------------------GSLVVWTT
SYI_PYRAE       DHEVAL---GYDEREDPSIYVKFRVEGGVD----------------------EYLVIWTT
                  *            . :                                       ***

SYI2_BACAN      TPWTLPANVALAVHPNMEYVKAKQE-----------------------------------
SYI2_BACHK      TPWTLPANVALAVHPNMEYVKAKQE-----------------------------------
SYI2_BACCZ      TPWTLPANVALAVHPNMEYVKAKQE-----------------------------------
SYI2_BACC1      TPWTLPANVALAVHPNMEYVKAKQE-----------------------------------
SYI2_BACCR      TPWTLPANVALAVHPNMEYVKAKQE-----------------------------------
SYI2_OCEIH      TPWTLPGNVALAVNPEMTYVKAKQG-----------------------------------
SYI2_STAAU      TPWTLPANVALAINKDLNYSKIRVE-----------------------------------
SYI_CLOAB       TPWTLPSNVALAINKAYDYVEVINN-----------------------------------
SYI_CLOTE       TPWTLPSNVALAINKNFDYVEVKNN-----------------------------------
SYI_CLOPE       TPWTLPSNVALCINKAYDYVEAKQAEG---------------------------------
SYI_THEAC       TPWTLPSNEFLVVNPDMEYSLVEAQ-----------------------------------
SYI_THEVO       TPWTLPSNEFLVVNPDIEYSLIEYN-----------------------------------
SYI_PICTO       TPWTLPSNEFLVVNPDMDYSLIESD-----------------------------------
SYI_EHRRG       TPWTLPCNLALAISPNIKYCGAII------------------------------------
SYI_EHRRW       TPWTLPCNLALAISPNIKYCGAII------------------------------------
SYI_EHRCJ       TPWTLPCNLALAISKNIKYCGAII------------------------------------
SYI_ANAMM       TPWTLVSNFALAINTNMDYVGAVV------------------------------------
SYI_RICCN       TPWTLPSNLALAVGSDIDYALVPK------------------------------------
SYI_RICFE       TPWTLPSNLALAVGSDIDYASIPK------------------------------------
SYI_RICPR       TPWTLPANLALAVGSDIDYAFVDK------------------------------------
SYI_RICTY       TPWTLPANLALAVGSDIDYALVNK------------------------------------
SYI_WOLPM       TPWTLPSNLALAIGKDIKYCAVSVHPLMSFQRVTLESISGSQCLGTGMTGSSEG------
SYI_WOLTR       TPWTLPSNLALAIGKDIEYCAVSVHSSVSFQHVTLESREKETWIPLSRTGMTEEGTETVT
SYI_COREF       TPWTLPSNLALAVNPSVTYALVEVAGD-----G---------------------------
SYI_CORGL       TPWTLPSNLALAVNPAVTYALVEVAED-----G---------------------------
SYI_CORDI       TPWTLPSNLALAVNPQVNYVEVKVGDQ-----G---------------------------
SYI_CORJK       TPWTTPANLALAVNPEVTYAAVRIGDDAAGADG---------------------------
SYI_MYCBO       TPWTLPSNLAVAVSPDITYVQVQAGD----------------------------------
SYI_MYCTU       TPWTLPSNLAVAVSPDITYVQVQAGD----------------------------------
SYI_MYCPA       TPWTLPSNLAVAVHPEVTYVQVRSGD----------------------------------
SYI_MYCLE       TPWTLPSNLAVAVHPDVTYVDVRAGD----------------------------------
SYI_NOCFA       TPWTLPSNLAIAVHPDVRYVHLRAADG---------------------------------
SYI_LEIXX       TPWTLPTNLALVVGPDIQYAVVPAGPNGAADAHGRP------------------------
SYI_TROW8       TPWTLPSNMALIVSPNVEYVVVSSARQ---------------------------------
SYI_TROWT       TPWTLPSNMALIVSPNVEYVVVSSARQ---------------------------------
SYI_BIFLO       TPWTVPTNFAIVVGGDIDYVEVRPTEG---------------------------------
SYI2_PSEFL      TPWTLPANVALAVAADENYVCIEHGE----------------------------------
SYI_CHLAB       TPWTLVSNMAVAVGPEITYVRVADKVSGE-------------------------------
SYI_CHLCV       TPWTLVSNMAAAVGPEITYVRVADKVSGE-------------------------------
SYI_CHLPN       TPWTLPSNMAIAVGETLVYVRIQDKKSGE-------------------------------
SYI_CHLMU       TPWTLVSNMALAVHPGLTYVRIQDKESGE-------------------------------
SYI_CHLTR       TPWTLVSNMALAVHPELTYVRIKDKESGD-------------------------------
SYI_PARUW       TPWTLVSNLALMVSPMIEYAEVQDHVSKR-------------------------------
SYI_BDEBA       TPWTLPSNLALAVGNDIEYVKVQEKATGR-------------------------------
SYI_BORBU       TPWTLPSNLGIAVGQEIEYSKIFDKTKEE-------------------------------
SYI_BORBP       TPWTLPSNLGIAVGKEIEYSKIFDKKKEE-------------------------------
SYI_TREDE       TPWTLPSNLGLAVGADIDYALI--EYDGA-------------------------------
SYI_TREPA       TPWTLPCNAALALGPQILYVLI--EANDE-------------------------------
SYI_DEHM1       TPWTLPANTALAVSAADQYAILDM------------------------------------
SYI_DEHMC       TPWTLPANTALAVSATDEYAILDM------------------------------------
SYI_THET2       TPWTLPGNVAAAVHPEYTYAAFQV------------------------------------
SYI_THET8       TPWTLPGNVAAAVHPEYTYAAFQV------------------------------------
SYI_DEIRA       TPWTLPSNTLAAVNPDLDYVVADS------------------------------------
SYI_STRAW       TPWTLVSNTAVAAHPDVTYVVATN------------------------------------
SYI_STRCO       TPWTLVSNTAVAAHPDVTYVVATD------------------------------------
SYI_THEFY       TPWTLVSNTAVAVHPEVDYVVATD------------------------------------
SYI_CUTAK       TPWTLVSNTAVAVHPEVRYVVAHRDPVPEGSDAVAT------------------------
SYI_BACFN       TPWTLPSNTALCVGPKIDYVAVQS------------------------------------
SYI_BACFR       TPWTLPSNTALCVGPKIDYVAVQS------------------------------------
SYI_BACTN       TPWTLPSNTALCVGPKIDYVAVQT------------------------------------
SYI_PORGI       TPWTLPSNTALCVGPEIEYLAVQT------------------------------------
SYI_CHLTE       TPWTLISNVALAVGRDIDYVRVK-------------------------------------
SYI_SULAC       TPWTLPANVFVMINKDFEYADVRVGDEI--------------------------------
SYI_SULTO       TPWTLPANVFVMINKDYEYAEVEVNNEI--------------------------------
SYI_AERPE       TPWTLPANAFVMAHPDMEYVKVRVGRDT--------------------------------
SYI_METJA       TPWTLVANLAVTVHPDYDYAYVEVEFDD--------------------------------
SYI_METMP       TPWTLPSNMLVCVNPEFDYAYVNVEFENG-------------------------------
SYI_PYRFU       TPWTLPANLAVSAHPDYDYVKVRVDLNG--------------------------------
SYI_PYRHO       TPWTLPANLAVSAHPEYDYVKVKVEFNG--------------------------------
SYI_PYRAB       TPWTLPANLAVSAHPDYDYVKVKVEFNG--------------------------------
SYI_THEKO       TPWTLPANLAVAAHPEYEYAKVKVETEN--------------------------------
SYI_METTH       TPWTLPANMAVAVHPDFEYAYAR--LDG--------------------------------
SYI_METTM       TPWTLPANMAVAVHPDFDYAHTR--LDG--------------------------------
SYI_METKA       TPWTLPANLAVAVHPEEEYVLARAEVDG--------------------------------
SYI_METAC       TPWTIPANVAVAVHPAYEYSKFRAIRQDG-------------------------------
SYI_METMA       TPWTIPANVAVAVHPAYEYSKFRAIRQDG-------------------------------
SYI_ARCFU       TPWTLPANMAVAVHPSLEYAKFRAVK-DG-------------------------------
SYI_HALMA       TPWTIVANTFVAADGDLEYVGVDAEK-DG-------------------------------
SYI_NATPD       TPWTVPANTFVAVDEEMTYQAIEVDT-GD-------------------------------
SYI_HALSA       TPWTIPANQFVAVDEDGDYQQVRATTPDG-------------------------------
SYI_PYRAE       TPWTIVDNEAVAVHPDYVYAKVEVEVGG--------------------------------
                ****   *          *                                         

SYI2_BACAN      ---------GHVYIVAKERVQDVLKEN------------------YEVLSVHKGEELLNI
SYI2_BACHK      ---------GHVYIVAKERVQDVLKEN------------------YEVLSVHKGEELLNT
SYI2_BACCZ      ---------GHVYIVAKERVQDVLKEN------------------YEVLSVHKGEELLNI
SYI2_BACC1      ---------GYVYIVAKERVQDVLKED------------------YEVLSVHKGEELVNT
SYI2_BACCR      ---------SHVYIVAKERVQEVLKEN------------------YEVLSVHKGEELLNT
SYI2_OCEIH      ---------EEIYVVAKSLANTVLGEA------------------YEVVEEVSGEDLVGI
SYI2_STAAU      ---------NEYYILATDLINSIITEK------------------YEIIDTFSGSNLINL
SYI_CLOAB       ---------GEHLILAKALL-TVLEGE------------------YEVVSEFKGEKLLGM
SYI_CLOTE       ---------DEVLILAKELVDSVIDGE------------------YEIIKEFKGEDILGL
SYI_CLOPE       ---------DEIFILAKELAPKVLGEG------------------FEIVREFKGEELLGM
SYI_THEAC       ---------GSRYYVASSRAGYIFKE-------------------YREIRRMHGRDLVGK
SYI_THEVO       ---------NAKYYVASSRAQYIFKD-------------------FKVLKKMKGFELAGK
SYI_PICTO       ---------GFEYYLLSSKVESLFND-------------------YKLIKTFKGRDLEGI
SYI_EHRRG       --------NKEMYIFSRAYLKNFEDHCKKNNIE-----------YLIHSDDICYLSLEYL
SYI_EHRRW       --------NKEMYIFSRAYLKNFEDHCRKNNIE-----------YLIHNGDICYLSLEYL
SYI_EHRCJ       --------KHEMLIFATGYLKIFQEHCKKNNIE-----------YQLYNQDISSVNLEDL
SYI_ANAMM       --------GAEMLIFSAGYLDHFMRYCERHSLE-----------CAKVVQ-IPAKELLAV
SYI_RICCN       --------NDVCYIIAAYSVSKYAKELGLS--------------GEENFEIIKGSALQGL
SYI_RICFE       --------EDICYIIAASSVSKYAKELGLS--------------GEENFEIIKGSALQGL
SYI_RICPR       --------NEVCYIIAASSVAKYAKELGLS--------------GKENFEIIKGLKLQGL
SYI_RICTY       --------NDVCYIIAASSVAKYAKELGLS--------------GKENFEIIKGLKLQGL
SYI_WOLPM       -----SSMNGEIYIFAESYLEKFISHSEQNNIP-----------YENCNIKLKANDLAGL
SYI_WOLTR       EDNEVSLVNNEIYIFAEDYLEKFIGHCEQNNIP-----------YENCNTKLKADDLAGL
SYI_COREF       ----EEGFVGQQLLLARDLVGAYAKELGT---------------DARIISEHPGTELIGL
SYI_CORGL       ----EAEFVGKRVLLAKDLVGSYAKELGA---------------EAVIVSEHPGSELVGL
SYI_CORDI       ----AEAIRGQRVLLAEALVGAYAKELGE---------------DHEVLTVRPGSELVGL
SYI_CORJK       ----AEGMYGKTVVLADDLRGAYAKELGE---------------KAEVLGTFTGAELEGM
SYI_MYCBO       ----------RRFVLAEARLAAYARELGE---------------EPVVLGTYRGAELLGT
SYI_MYCTU       ----------RRFVLAEARLAAYARELGE---------------EPVVLGTYRGAELLGT
SYI_MYCPA       ----------RRFVLAQPRLAAYARELGP---------------EPEILGSYRGAELLGT
SYI_MYCLE       ----------RRFVLAQARLTAYARELGD---------------EPEVLATYRGADLLGR
SYI_NOCFA       ----------TRYVLAAERVSHYSREFGE---------------DATVLAEFEGAALVGL
SYI_LEIXX       ----DDEVLSGEYLLAIDLVGNYAKDLGYGSPEA---------ARAAVTRTIPGRELEGV
SYI_TROW8       -------NSNSDFLLCKSSLDSYAECLGYESGQD---------ARASIRRTLLGKEIEGI
SYI_TROWT       -------NSNSDFLLCKSSLDSYAECLGYESGQD---------ARASIRRTLLGKEIEGI
SYI_BIFLO       ------KFAGKKFYLGKDLLPHYEKELGE---------------NYEVVRELKGSELEGR
SYI2_PSEFL      ----------ERLWLAEGCLGGLFDEPVI-------------------LERCTGAELAGL
SYI_CHLAB       -----------QWILGQGCLSRWFSDP----------------DTYEVIESFPGTALIGK
SYI_CHLCV       -----------QWILGQGCLSRWFSDP----------------DSYEILESFLGTALVGK
SYI_CHLPN       -----------QWILSQGCVSRWFSNP----------------EEFVILESFSGKDLVGR
SYI_CHLMU       -----------EYILGQESLARWFPDR----------------ESYKWIGQLSGESLVGR
SYI_CHLTR       -----------EYILGQESLPRWFPDR----------------ESYEWIGQLSGKSLVGQ
SYI_PARUW       -----------NYILATERLKGYYKDS----------------GEYTIVRKFPGSELEGQ
SYI_BDEBA       -----------KLIMAQALLSSVFKKAD---------------EEVEVLQMMKGTELVGL
SYI_BORBU       -----------ILILGSKKLNSYYDDEN----------------SYTIIEKFKGSKLEGI
SYI_BORBP       -----------ILILGSKKINSYFDDEN----------------AYTIIEKFKGSQLQGI
SYI_TREDE       -----------HYIMAVPRLEAYFAKSGKEEA-----------KEYKLIWTKKGAELEGL
SYI_TREPA       -----------HYILARSRLEFYYPDSS----------------AYRVVWEKRGEHLAGI
SYI_DEHM1       --------TDYYMILAKPRLSALKL------------------AENPVAGECLGSDLSGL
SYI_DEHMC       --------ADYYMVLAKPRLSSLKL------------------TENPIVGECLGSDLKGL
SYI_THET2       --------GDEALILEEGLGRKLLG------------------EGTPVLKTFPGKALEGL
SYI_THET8       --------GDEALILEEGLGRKLLG------------------EGTPVLKTFPGKALEGL
SYI_DEIRA       --------PSGRVIVAEGAVERLSALHK-------------DAAPLEVLARFKGRDLEWV
SYI_STRAW       --------GEEKLVVAEPLVEKALG-----------------EGWETTGETFTGAEMERW
SYI_STRCO       --------GEEKLVVAEPLLAKALG-----------------EGWETTGQSFTGAEMERW
SYI_THEFY       --------GSEQLVVAEPLVGAALG-----------------DGWTLTGQRFKGAELERW
SYI_CUTAK       --ASAEDPASQDLIIAEPLFEKVLG-----------------EGWSLTGESFLGSQMELW
SYI_BACFN       --YNAYTGQPITVVLAKALLNAHFNPKA-AELKLEDYKAGDKLVPFKVIAEYKGPDLVGM
SYI_BACFR       --YNAYTGQPITVVLAKALLNAHFNPKA-AELKLEDYKAGDKLVPFKVIAEYKGPDLVGM
SYI_BACTN       --YNAYTGEPITVVLAKALLNTHFNSKA-ADLKLEDYKAGDKLVPFKVVAEYKGADLIGM
SYI_PORGI       --FNPYNGIPITVVLGKPLLHTLFNPKGECEEIPASYDPAQKLLPYKVIASWKGKELEGM
SYI_CHLTE       -----HRETGEVLILAESRLSVLVEKIG-------------DESAWEVIDRCKGSDLEGR
SYI_SULAC       ------------LVIAKDRVKELMKEARI--------------KEYKILRVYKGEELLGL
SYI_SULTO       ------------LIMAKDRVSDVMKEAGI--------------KNYKIVRTFKGVELVGL
SYI_AERPE       ------------LILAKARLDHVMREAGV--------------SEYEVLEVLKGSQLEGL
SYI_METJA       --------KKEVWIIAEKLVEEVINKAKKFHNI----------KNYKIIKKVKGKELEGI
SYI_METMP       --------TAETWIIAEKLVNDVMKKAEKNNDI----------SKFSISKVVKGDSLIGL
SYI_PYRFU       --------REEYWILAKALVEKVLGDIGV---------------KGEVVEEFKGKELEGL
SYI_PYRHO       --------KEEYWILAKALVDKVLGEIGV---------------KGEVIEEFKGRELEGL
SYI_PYRAB       --------REEYWILAKALVDKVLGEIGV---------------KGEVVEEFKGRELEGL
SYI_THEKO       --------GEEYWIMAKALVERVLSEVGV---------------KGEIVETFKGEELEGI
SYI_METTH       ----------ETYIMAEA----LVEKVLG--------------EEAEILKRVKGTELEGL
SYI_METTM       ----------ETYIMAEA----LVEKVLG--------------EEAEIIKTVRGSELEGL
SYI_METKA       ----------EEWHLIVADKLKVVLSVVT--------------DSYEIVDSFPGEALEGL
SYI_METAC       --------SEEILIAATELIKNVLKQGRY--------------ADFKVLETMLGEELTKL
SYI_METMA       --------SEEILIAATELIKNVLKQGRY--------------TDFEVLETMLGEELTKL
SYI_ARCFU       --------KVEYLILAKELADSVLGKGDY--------------DSWEVVETYLGEDLEGL
SYI_HALMA       --------DTERLYLAEACVEDVLKAGRY--------------DDYEVVEELSGEEMVGW
SYI_NATPD       --------GTETLYVGEPCVEDVVDHGGY--------------EDYEVVGEHEGSDLVGW
SYI_HALSA       --------ETDVLYVASECVEDVLSAGGY--------------SDHEIVADHSGSDLIGW
SYI_PYRAE       --------RREYWWLAEALVPSLMAKFGI--------------KTWRVVETKKGVELAGV
                                                                        :   

SYI2_BACAN      SYTAPFPMKEVTN---------------------GYRVIGADFVTADSGTGLVHIAPAYG
SYI2_BACHK      SYTAPFPMKEVTN---------------------GYRVIGADFVTADSGTGLVHIAPAYG
SYI2_BACCZ      SYTAPFPMKEVTN---------------------GYRVIGADFVTADSGTGLVHIAPAYG
SYI2_BACC1      SYTAPFPMKEVTN---------------------GYHVIAADFVTADSGTGLVHIAPAYG
SYI2_BACCR      SYTAPFPMKEVTN---------------------GYRVIAADFVTGDSGTGLVHIAPAYG
SYI2_OCEIH      NYEAPFDFISLDN---------------------GHYVIGADFVTDTSGTGIVHLNPAHG
SYI2_STAAU      KYIPPFESDGLVN---------------------AYYVVDGEFVTNSEGTGIVHIAPAHG
SYI_CLOAB       EYEQLFKFANPDK--------------------KAFYVVHGDFVTLSDGTGIVHIAPAYG
SYI_CLOTE       QYEQLLPFYTPEE--------------------EAFRVIHGDFVTLSDGTGIVHTAPAYG
SYI_CLOPE       EYEQLLPFVTPTEG-------------------KAFVVVHGDYVTLSDGTGIVHIAPAYG
SYI_THEAC       RYLQLMPFLDPPS--------------------GSLKVVAGSFVTSEDGSGIVHAAPAFG
SYI_THEVO       GYEQLLPFLDPPA--------------------GALRVVTGDFVTDIDGSGIVHAAPAFG
SYI_PICTO       EYEQLMPFLEKPE--------------------NAFRVVAASFVTAEDGTGIVHAAPAFG
SYI_EHRRG       SYKPVFNYFIDIK--------------------NAFKVLVADFVVEDEGTGIVHMAPGFG
SYI_EHRRW       SYKPVFNYFIDIK--------------------NAFKVLVADFVVEDEGTGIVHMAPGFG
SYI_EHRCJ       HYKPLFKYFADVK--------------------NAFKILTADFVVEGEGTGIVHIAPGFG
SYI_ANAMM       KYMPPFPYFADSK--------------------NAFMVLDAEFVAEGAGTGIVHLAPGFG
SYI_RICCN       NYKSLFDYFENHP--------------------NSFKIFAGDFVVEGDGTGVVHMAPGFG
SYI_RICFE       SYKPLFDYFANHP--------------------NSFKIFAGDFVVEGDGTGIVHMAPGFG
SYI_RICPR       SYKPLFNYFENHP--------------------NSFKIFASDFVVEGDGTGIVHMAPGFG
SYI_RICTY       SYKPLFNYFENHP--------------------NSFKIFASNFVVEGEGTGIVHMAPGFG
SYI_WOLPM       SYKPLFDYFKDTK--------------------NAFRVFIADYVTEEDGTGVVHTAPGFG
SYI_WOLTR       SYKPLFNYFKGTK--------------------NAFRVFIADYVTGEDGTGVVHTAPGFG
SYI_COREF       TYEPVFDFFRDH--------------------PNAFQILGADYVTTEDGTGIVHQAPAFG
SYI_CORGL       TYEPIFGYFRDH--------------------ANGFQILGAEYVTTEDGTGIVHQAPAFG
SYI_CORDI       TYQPIFSYFADH--------------------ENAFQILAAEYVTTEDGTGIVHQAPAFG
SYI_CORJK       TYEPLFGYFAERAGEKASAGEGSEGGEGNQRKPGAFRVLCADYVTTADGTGVVHQAPAFG
SYI_MYCBO       RYLPPFAYFMDWP--------------------NAFQVLAGDFVTTDDGTGIVHMAPAYG
SYI_MYCTU       RYLPPFAYFMDWP--------------------NAFQVLAGDFVTTDDGTGIVHMAPAYG
SYI_MYCPA       RYLPPFPYFMDNP--------------------NAFRVLAGEFVTTEDGTGIVHLAPAYG
SYI_MYCLE       HYLPPFQYFYESAR-------------------NAFQVLPGDFVTTDDGTGIVHIAPAYG
SYI_NOCFA       SYRPPFDFFLGHP--------------------NAHRVLAADYVTTDSGTGVVHMAPAFG
SYI_LEIXX       TYDRLWDYYADAAT---------------WGTQNAWQILVDGYVTTEDGTGIVHQAPAYG
SYI_TROW8       HYKPLFDYYADLH--------------------NAFTILSDNYVDVTEGTGIVHASPAHG
SYI_TROWT       HYKPLFDYYADLH--------------------NAFTILSDNYVDVTEGTGIVHASPAHG
SYI_BIFLO       RYYPVFPYFAGDEAES----------EGHVPGPNGYTIFTADYVDTVEGTGLVHQAP-YG
SYI2_PSEFL      RYLPVVGEVIDAS---------------------AHRVVTADFVQMGDGSGIVHIAPAFG
SYI_CHLAB       SYEPPFNFFEQ------------------KRAEGAYTILPGSFVEESEGTGVVHMAPAFG
SYI_CHLCV       SYEPPFSFFEH------------------KRAEGAYKILSGSFVEESEGTGVVHMAPAFG
SYI_CHLPN       TYEPPFTFFQS------------------KREEGAFRVIAASFVEESEGTGVVHMAPAFG
SYI_CHLMU       RYCPLFPYFQD------------------QQDRGAFRVIPADFIEESEGTGVVHMAPAFG
SYI_CHLTR       SYEPLFPYFQD------------------KKELEAFRILPADFIEESEGTGIVHMAPAFG
SYI_PARUW       HYIPLFDYFND------------------RAHSGAFKIILEDSISVEEGTGIVQTAPAFG
SYI_BDEBA       TYEPLFPYFGD------------------RADKGAFRIISSDHVTTESGTGVVHMAPAFG
SYI_BORBU       EYEPIFNYFLE------------------QKDKGAFKVHTADYVTTDDGTGIVHIAPFGE
SYI_BORBP       EYEPIFNYFLE------------------QKDKGAFKVHTADYITTDDGTGIVHIAPFGE
SYI_TREDE       RYEPLFPYFKNLAADENG--------KNAEAGQGAFRVLIGDFVTTEDGTGIVHTAPGFG
SYI_TREPA       RYRPLFSYPVFGQGPDPS--------VQGDSEEGLFCTRVADFVSTEDGTGVVHVAPAFG
SYI_DEHM1       FYKPLFDPREFGIPVRNMQDNS----ETGVSEELLYPVITTSYVSMDDGTGIVHTAPAYG
SYI_DEHMC       TYKPLFDPREFGISVKNMQDNS----EIDALEPLSYPVITTSYVSMDDGTGIVHTAPAYG
SYI_THET2       PYTPPYPQALEKG----------------------YFVVLADYVSQEDGTGIVHQAPAFG
SYI_THET8       PYTPPYPQALEKG----------------------YFVVLADYVSQEDGTGIVHQAPAFG
SYI_DEIRA       EYEPPFPEVASQLGVVSELH------ERRDGKPVLHFVVMADFVSDVDGSGVAHEAPAYG
SYI_STRAW       TYQRPFELVEFP--------------------APAHYVVNAEYVTTEDGTGLVHQSPAFG
SYI_STRCO       TYQRPFELVEFP--------------------EPAHYVVNADYVTTEDGTGLVHQSPAFG
SYI_THEFY       TYQRPFELVEFD--------------------SPAHFVVLGDYVTVEDGTGLVHQAPAFG
SYI_CUTAK       TYERPYNFLEWPKTERVTVD-------GRPTPADANFVVLADYVTVEDGTGLVHQAPAFG
SYI_BACFN       EYEQLIPWVNPGEG--------------------AFRVILGDYVTTEDGTGIVHIAPTFG
SYI_BACFR       EYEQLIPWVNPGEG--------------------AFRVILGDYVTTEDGTGIVHIAPTFG
SYI_BACTN       EYEQLIPWVKPVEVSEDGTW---------KVSGKGFRVIPGDYVTTEDGTGIVHIAPTFG
SYI_PORGI       RYEQLIPWVNPGEG--------------------AFRVITGDFVTTEDGTGIVHIAPTFG
SYI_CHLTE       DYEPLFNYFSPERR--------------------AWYVVCGDFVSTGEGTGIVHIAPAFG
SYI_SULAC       EYEHPLADIVSAQSKIN---------------NHHKVLDGGEAVTLQEGTGLVHSAPGHG
SYI_SULTO       QYIHPLADIVTAQKGLD---------------NYHIVVDAGEEVTLTEGTGLVHSAPGHG
SYI_AERPE       RYRHPLEDVVDAQRELS---------------KWHKVVMAPEAVTPHEGSGLVHSAPGHG
SYI_METJA       KYIHPLLEENERQKEF-A------------ELENAHTVILGEHVTLEGGTGLVHTAPGHG
SYI_METMP       KYIHPLLEENEKQQEF-A------------KIENVHTIVPGDHVTLEGGTGLVHTAPGFG
SYI_PYRFU       RYVHILMDEYPRQKEFRE------------KYEWVHRVILADFVTLEEGTGLVHTAPGHG
SYI_PYRHO       RYIHVLMDEYPRQKEFRE------------KYEWAHRIILADFVTLEEGTGLVHTAPGHG
SYI_PYRAB       RYVHILMDEYPRQKEFKE------------KYEWAHRVILADFVTLEEGTGLVHTAPGHG
SYI_THEKO       RYTHVLLEEYPAQKEFRE------------KYEWAHRVILGEHVTLEDGTGLVHTAPGHG
SYI_METTH       TYRHPLDDEVPLHREIE------------------HRVILGDHVTLTEGTGCVHTAPGHG
SYI_METTM       TYRHPLDEEVPCHRDME------------------HRVILGDHVTLTEGTGCVHTAPGHG
SYI_METKA       RYRPPLWEEVPKLRELHE------------EDDRVHRVYTAEWVTMEEGTGCVHSAPGHG
SYI_METAC       EYESPVGDLVPIQNE------------------IKHGVYLADFVTVEN-TGCVHIAPGHG
SYI_METMA       EYESPVGDLVPVQNE------------------IKHGVYLADFVTVEN-TGCVHIAPGHG
SYI_ARCFU       EYEHPLADEVPLQKN------------------WKHQVFFADFVTAEN-TGCVHIAPGHG
SYI_HALMA       AYEHPLAEEVPDHAQ----------------GEGSGQVYTADYVEADR-TGLVHSAPGHG
SYI_NATPD       RYEHPLREEVPEAPA----------------FEGALEVYGADYVEADR-TGLVHSAPGHG
SYI_HALSA       SYTPPLADAVPANPTD---------------ADGTHEVYHGDWVEADR-TGLVHSAPGHG
SYI_PYRAE       RYIHPLAEEVPERASRP------------------HQVVTAEFVTLEQGTGLVHIAPGHG
                 *                                         :     :* .:  *   

SYI2_BACAN      EDDYRVVQSEGLS---------------FLHVVDEKGEYTEAVPFLKGK-----------
SYI2_BACHK      EDDYRVVQSEGLS---------------FLHVVDEKGEYTEVVPFLKGK-----------
SYI2_BACCZ      EDDYRVVQSEGLS---------------FLHVVDEKGEYTEAVPFLKGK-----------
SYI2_BACC1      EDDYRVVQSEGLS---------------FLHVVDEKGEYTEAVPFLKGK-----------
SYI2_BACCR      EDDYRVVQSEGLS---------------FLHVVDEKGEYTEAVPFLKGK-----------
SYI2_OCEIH      EDDYNAIQAKGMD---------------FVNVVDSKGRYEDVIAPLAGQ-----------
SYI2_STAAU      EDDYQLVLERDLD---------------FLNVITREGVYNDRFPELVGN-----------
SYI_CLOAB       EDDNMLGKKYDLP---------------LINLVNGEGKFVDEVEPWKGL-----------
SYI_CLOTE       EDDNIVCKKHGLP---------------MINLVDKEGKFIDCVEPWKGM-----------
SYI_CLOPE       EDDNLIGKQNGLA---------------FLNLVDLSGNFVEEVTPWAGK-----------
SYI_THEAC       ADDYQIGKEEGVE---------------ILNPVDKNGRFADPRIPWNGK-----------
SYI_THEVO       SDDYQIGKRENVP---------------ILNPVDKNGRFSDERLPWYGK-----------
SYI_PICTO       ADDFEIGKRFSVE---------------ILNPVDQDGRF-NEKLPWSGL-----------
SYI_EHRRG       EDDFILCKK---QGIPDIDDKDTSKLLATICPIDDGGKFTERISDFVNM-----------
SYI_EHRRW       EDDFILCKK---QGIPDIDDKDTSKLLATICPIDDGGKFTERISDFVNM-----------
SYI_EHRCJ       EDDFILCKM---QDIPHIEG-DTSNLLSIICPIDDGAKFTDKISDFKNM-----------
SYI_ANAMM       EDDFLLCKQ---HGIPNLGE-ESRGMLSVICPIDDAGRFTAAVGDFAGQ-----------
SYI_RICCN       EDDQILCES---KGIE------------LVCPVDNSGKFTKEIPDLEGL-----------
SYI_RICFE       EDDQILCES---KGIS------------LVCPVDNSGKFTKEIPDLEGV-----------
SYI_RICPR       EDDQILCES---KGIE------------LVCPVDNSGKFTKEIPDLEGV-----------
SYI_RICTY       EDDQILCES---KGIE------------LVCPVDNSGKFTKEIPDLEGV-----------
SYI_WOLPM       EEDFYLCQS---HDIP------------VICPIDNSGKFTAEVSDLAGV-----------
SYI_WOLTR       EEDFYLCQS---HDIP------------AICPIDNSGRFTAEVSDLTGI-----------
SYI_COREF       EDDMNVCNA---ADIA------------PVIPVDMDGKFTSLTPEYEGQ-----------
SYI_CORGL       EDDMNTCNA---AGIE------------PVIPVDIDGKFTGLVPEYQGQ-----------
SYI_CORDI       EDDMNTCKE---YGIE------------VVIPVDMDGKFTSLVPEYQGQ-----------
SYI_CORJK       EDDMFTCEA---AGID------------LEIPVDMDGKFTSLAPEYQGQ-----------
SYI_MYCBO       EDDMVVAEA---VGIA------------PVTPVDSKGRFDVTVADYQGQ-----------
SYI_MYCTU       EDDMVVAEA---VGIA------------PVTPVDSKGRFDVTVADYQGQ-----------
SYI_MYCPA       EDDMAVADA---AGIA------------PVTPVDSNGRFDAAVPDYQGL-----------
SYI_MYCLE       EDDMATADK---VGIV------------PVTPVDSNGCFDATVPDYQGQ-----------
SYI_NOCFA       EEDMEVCSA---NDIE------------LVQPLDPGGRFTSMVPPYEGL-----------
SYI_LEIXX       EDDQRVCEA---AGIP------------VIISVDDGARFLPAVQDVAGL-----------
SYI_TROW8       EDDKRVCDA---FGVP------------TVVSINDAACFTDVISNYAGM-----------
SYI_TROWT       EDDKRVCDA---FGVP------------TVVSINDAACFTDVISNYAGM-----------
SYI_BIFLO       EDDMNTLNA---KGIK------------STDVLDDGCRFTAQCPDYEGD-----------
SYI2_PSEFL      EDDALLGQQ---YELP------------APNPVRDDGTFSDAVAQYAGQ-----------
SYI_CHLAB       EADFFVCKE---HHVP------------MVCPVDNHGCFTEEIPEYQGQ-----------
SYI_CHLCV       EADFFVCKE---HHVP------------IVCPVDNHGCFTEEIPEYQGQ-----------
SYI_CHLPN       EGDFLVCKE---NHVP------------LVCPVDAHGSFTEEIPQYQGQ-----------
SYI_CHLMU       EADFFACQE---HNVP------------LVCPVDNQGCFTSEVTDFVGE-----------
SYI_CHLTR       EADFFACQE---HNVP------------LVCPVDNQGCYTAEVKDFVGE-----------
SYI_PARUW       EIDFYACQK---AGID------------PVCPVDNNGQFTDEIPEYKGI-----------
SYI_BDEBA       EEDYYACAK---AGIP------------MVNPVDDDGMFTMEVPDYAGK-----------
SYI_BORBU       EDYRILKKH---TNVD------------IIDPLDAECKFTNQVKDFKGL-----------
SYI_BORBP       EDYRVLKKH---TNVD------------IIDPLDAECKFTNRVKDFKGL-----------
SYI_TREDE       EDDNRIFKD---TGVP------------TVCPVDAECKFTHEVSDYQGL-----------
SYI_TREPA       EDDYEVFKD---AGIS------------IQCPLDAECRFTAEVADYQGL-----------
SYI_DEHM1       ELDYESGVK---YGLK------------FVHHVDLQGRITGSYPFAGK------------
SYI_DEHMC       ELDYESGVK---YGLK------------FVHHVDLQGRITGNYPFAGK------------
SYI_THET2       AEDLETARV---YGLP------------LLKTVDEEGKLLVE-PFKGL------------
SYI_THET8       AEDLETARV---YGLP------------LLKTVDEEGKLLVE-PFKGL------------
SYI_DEIRA       AEDLEVARA---YGVP------------LMFGVDDHGILQVT-HEQGK------------
SYI_STRAW       EDDLKVCRE---YGLP------------VVNPVRTNGTFEEDVPLVGGV-----------
SYI_STRCO       EDDLKVCRA---YGLP------------VVNPVRPDGTFEEDVPLVGGV-----------
SYI_THEFY       ADDMQVCRA---YGLP------------VVNPVRNDGTFEEHLDLVGDE-----------
SYI_CUTAK       ADDLQTCRR---YGLP------------LVNPIRPDGTFEESVPLVGGQ-----------
SYI_BACFN       ADDAQVAKA---AGIP------------PLQLVNKKGELRPMVDLTGKFYTLDELDEDFI
SYI_BACFR       ADDAQVAKA---AGIP------------PLQLVNKKGELRPMVDLTGKFYTLDELDEDFI
SYI_BACTN       ADDANVARA---AGIP------------SLFMINKKGETRPMVDLTGKFYMLDELDENFV
SYI_PORGI       ADDDRVAKK---SGVP------------PLMLRDKEGNMRPMVDLAGRYFPTTDLDPVFV
SYI_CHLTE       ADDYELSKQ---YQLP------------MLQPVARNGCFTAEV-----------------
SYI_SULAC       DVDFEIGKK---------------YDMPVVMLVNDKGEFTQDSGKYAGKYVRS-------
SYI_SULTO       DIDFEIGKK---------------IGAPVVMLVNDRGEFLPEAGKYVGKNVRS-------
SYI_AERPE       TIDYEIAQR---------------IGAPVVSLVDERGFMTEAAGKYSGLYFRGE------
SYI_METJA       EEDFEVGKK---------------YNLPIYSPIDDEGKYVE--GKWKGVFVKD-------
SYI_METMP       EDDFNIGKE---------------HNIPVYAPIDDNGKYTD--SIWKGTFVKD-------
SYI_PYRFU       EEDFEVGQK---------------YGLPVYSPVDDQGKYVE--GKWKGVYVKE-------
SYI_PYRHO       EEDFEVGKK---------------YGLPIYSPVDDQGRYVE--GKWKGIYVKE-------
SYI_PYRAB       EEDFEVGQK---------------YGLPVYSPLDDQGKYTE--GKWKGIYVKE-------
SYI_THEKO       EEDFEVGQR---------------YGLPVYSPVDDAGRYTE--GKWKGVYVKD-------
SYI_METTH       PEDFEIGKK---------------YGLEVICPVDEAGIFTEEAGKYSGRFVKD-------
SYI_METTM       PEDFEIGKE---------------YGLPVFCPVDEAGVFTEDAGKYRGLFVKD-------
SYI_METKA       EEDFELGRE---------------VGLPPHCPVAEDGTFTEDGGKYEGLYVRD-------
SYI_METAC       MDDFNLGVK---------------HKLPILCPVGSNGAYTEEAGEYAGKNVRE-------
SYI_METMA       MDDFNLGAK---------------HKLPILCPVGSNGSYTEEAGEYAGKNVKE-------
SYI_ARCFU       VEDYELGVE---------------KGLEVFNPVDDRGVYTEEAGKYAGKHVKE-------
SYI_HALMA       EEDFERGQE---------------LDLEIFCPVGSDGVYTDDAGKYAGTFVRD-------
SYI_NATPD       EVDFERGQE---------------LGLSVFCPVGPDGVYEDAAGDYAGQFVKD-------
SYI_HALSA       EEDFERGAE---------------LDLPVFCPVGEDGVYTDAGGKYAGAFVRD-------
SYI_PYRAE       PEDFELAKK---------------YGLPVTNSVEINGIYNELGGRYKGKHVYD-------
                                                                            

SYI2_BACAN      ---------------FVKDCDVDIVRYLAK----------------------EDLLYHKE
SYI2_BACHK      ---------------FVKDCDVDIVRYLAK----------------------EGLLYHKE
SYI2_BACCZ      ---------------FVKDCDVDIVRYLAK----------------------EGLLYHKE
SYI2_BACC1      ---------------FVKDSDVDIVRYLAK----------------------EGLLYHKE
SYI2_BACCR      ---------------FVKDCDVDIVRYLAK----------------------EGLLYHKE
SYI2_OCEIH      ---------------FVKDSDVDIIKMLAK----------------------DGTLYEKQ
SYI2_STAAU      ---------------KAKNSDIEIIKLLSK----------------------KQLLYKKQ
SYI_CLOAB       ---------------FVKKADPKILEYMKE----------------------NGTLYKSE
SYI_CLOTE       ---------------PVKKADSKIIEYMDE----------------------KGILYKSE
SYI_CLOPE       ---------------FVKKCDQQIVDYLKE----------------------QNKLFKAE
SYI_THEAC       ---------------FVRDANEDIIVYLKK----------------------NQMLLKSE
SYI_THEVO       ---------------KVREANEDIIVYLKN----------------------NGLLIKSE
SYI_PICTO       ---------------FVTDANKSIINYLKE----------------------NNLLFKAE
SYI_EHRRG       ---------------HVFDTNDQIISILKA----------------------KNLCFKTD
SYI_EHRRW       ---------------HVFDTNDQIISILKA----------------------KNLCFKTD
SYI_EHRCJ       ---------------HVFDTNDQIINILKQ----------------------KNLCFKID
SYI_ANAMM       ---------------HVFDVVDAVIRQLKE----------------------KGLWFATE
SYI_RICCN       ---------------QVFDANDKIIIKLKE----------------------QGNWLKTE
SYI_RICFE       ---------------QVFDANDKIIIKLKE----------------------QGNWLKTE
SYI_RICPR       ---------------QVFDANDKIIIKLKE----------------------QGNWIKTE
SYI_RICTY       ---------------QVFDANDKIIIKLKE----------------------QGNWIKTE
SYI_WOLPM       ---------------HVFDANDTVIKKLKG----------------------QGSWFKTE
SYI_WOLTR       ---------------HVFDTNDAIIKKLKE----------------------QGNWFKTE
SYI_COREF       ---------------LVFDANKDIIRDLKA----------------------KGRVFRHQ
SYI_CORGL       ---------------LVFDANKDIIKDLKA----------------------AGRVVRHQ
SYI_CORDI       ---------------LVFDANKSIIADLKA----------------------AGRVVRHQ
SYI_CORJK       ---------------LVFDANKAIIKDLKA----------------------AGRVLRHQ
SYI_MYCBO       ---------------HVFDANAQIVRDLKTQ----------SGPAAVN----GPVLIRHE
SYI_MYCTU       ---------------HVFDANAQIVRDLKTQ----------SGPAAVN----GPVLIRHE
SYI_MYCPA       ---------------NVFDANPQIIWDLKNG----------SGAAAAN----APVLLRHE
SYI_MYCLE       ---------------HVFEANAQIIRDLKNQ----------SGSAAVN----GAVLLRHE
SYI_NOCFA       ---------------MVFDANPVIIKDLKA----------------------AGKLLRHE
SYI_LEIXX       ---------------QVFEAGKPLIKLLRE----------------------EGRLLRQA
SYI_TROW8       ---------------HIFDANAVIRSDLSR----------------------DGRILRHE
SYI_TROWT       ---------------HIFDANAVIRSDLSR----------------------DGRILRHE
SYI_BIFLO       ---------------FVFDANLPILRNLRAG----------DGPLAEIPEERRAILFQEK
SYI2_PSEFL      ---------------NIFEATPRILADLKS----------------------SGLLFKQE
SYI_CHLAB       ---------------YIKSCDKGIIKSLKN----------------------QGKVFYHG
SYI_CHLCV       ---------------YIKSCDKGIIKSLKN----------------------LGKVFYHG
SYI_CHLPN       ---------------YIKHADKEIIKFLKK----------------------EGRIFYHG
SYI_CHLMU       ---------------YIKFADKGIARRLKN----------------------ENKLFYQG
SYI_CHLTR       ---------------YIKSADKGIARRLKN----------------------ENKLFYQG
SYI_PARUW       ---------------FVKEADKDIIKRLKQ----------------------QAKVIHQG
SYI_BDEBA       ---------------RVKEADKDIIADLKK----------------------RGNLFKQD
SYI_BORBU       ---------------FVKDADKKIIENLKL----------------------RNFLFKRE
SYI_BORBP       ---------------FVKDADKKIIENLKL----------------------RNFLFKRE
SYI_TREDE       ---------------FVKDADKQIMERLKT----------------------EGKLFKKA
SYI_TREPA       ---------------FVKAADKAIIARVQK----------------------QGALFRRE
SYI_DEHM1       ---------------FVKEADKDISR----------------------NLKERGLMFRNE
SYI_DEHMC       ---------------FVKEADKDISR----------------------NLKERGLMFRNE
SYI_THET2       ---------------YFREANRAILR----------------------DLRGRGLLFKEE
SYI_THET8       ---------------YFREANRAILR----------------------DLRGRGLLFKEE
SYI_DEIRA       ---------------FFKDADKGLIA----------------------DMKARGLMFWAG
SYI_STRAW       ---------------FFKKADEKLTE----------------------DLQNRGLLFKHI
SYI_STRCO       ---------------FFKKADEKLTE----------------------DLETRGLLFKHI
SYI_THEFY       ---------------FFKTADAALVA----------------------DLKDRGLLFKHL
SYI_CUTAK       ---------------FFKTADKPLCE----------------------DLDRRGVLFRLE
SYI_BACFN       KQRVNVDLYKEYAGRFVKNAYDPNLS----------DQDESLDVSICMMMKVNNQAFKIE
SYI_BACFR       KQRVNIDLYKEYAGRFVKNAYDPNLS----------DQDESLDVSICMMMKVNNQAFKIE
SYI_BACTN       KECVDVDKYKEYQGAWVKNAYNPVFMVDGKYDEKAAQAAESLDVALCMMMKANNQAFKIE
SYI_PORGI       EKHMDLPLYDVYAGRYVKNAYDAGKT----------EKDETLDVELCVMLKMQNRVFRIE
SYI_CHLTE       ---------PDYEGMFFKDADKPIMQ----------------------RLKEEGKLYRRE
SYI_SULAC       -------------------ASEEIISDLKQ----------------------RSALLHAS
SYI_SULTO       -------------------AAEEIINDLKQ----------------------RNALLHSG
SYI_AERPE       -------------------ANKAIVEDLRA----------------------RGALFHAA
SYI_METJA       -------------------ADAEIIETLKN----------------------KGLLVYAG
SYI_METMP       -------------------MDESVIETLIS----------------------KNLLVNSG
SYI_PYRFU       -------------------ADPQIIEHLKE----------------------KGYLVKAG
SYI_PYRHO       -------------------ADPQIIEHLKE----------------------KGYLVKAG
SYI_PYRAB       -------------------ADPKIIEHLRE----------------------KGYLVKAG
SYI_THEKO       -------------------ADPEIIEYLKE----------------------KGYLVKAG
SYI_METTH       -------------------ADEDIIADLRS----------------------KGLLLKAG
SYI_METTM       -------------------ADSDIIDDLRS----------------------KNLLLRAE
SYI_METKA       -------------------ANEKIVEDLRE----------------------KGLLAHED
SYI_METAC       -------------------ANPIVIEDLKA----------------------RNRLLAEG
SYI_METMA       -------------------ANPIVIEDLKA----------------------RNRLLAEG
SYI_ARCFU       -------------------ANDDIIDDLYR----------------------KDLLLAEE
SYI_HALMA       -------------------ANDEVIDDLDE----------------------NGVLLSSE
SYI_NATPD       -------------------ADAAIMDDLEA----------------------KGLLLSRG
SYI_HALSA       -------------------ANDDIIADLEA----------------------RDAMLASQ
SYI_PYRAE       -------------------VDKEVTRDLRS----------------------KGLLVFEE
                                                                            

SYI2_BACAN      KYEHSY-PHCWRCDSPLLYYAGESWLIRTTAIKDTFLQNNDT-VTWYPDHMKHGRFGKFL
SYI2_BACHK      KYEHSY-PHCWRCDSPLLYYAGESWLIRTTAIKDTFLQNNDT-VTWYPDHMKHGRFGKFL
SYI2_BACCZ      KYEHSY-PHCWRCDSPLLYYAGESWLIRTTAIKDTFLQNNDS-VTWYPDHMKHGRFGKFL
SYI2_BACC1      KYEHSY-PHCWRCDSPLLYYAGESWLIRTTAIKDTFLQNNDT-VTWYPDHMKHGRFGKFL
SYI2_BACCR      KYEHSY-PHCWRCDSPLLYYAGESWLIRTTAIKDTFLQNNDS-VTWYPDHMKHGRFGKFL
SYI2_OCEIH      KYEHSY-PHCWRCDTPLLYYAMEGWFIKTTAVKERMQENNQS-VEWFPNHMRDGRFGNFL
SYI2_STAAU      KYEHNY-PHCWRCGNPLIYYAMEGWFIKTTNFKNEIINNNNN-IEWFPSHIKEGRMGNFL
SYI_CLOAB       KFTHSY-PHCWRCDTPLLYYPRDSWFVRMTSLRDKLVENNNK-IHWYPDNIRTGRFGKFV
SYI_CLOTE       KFTHSY-PHCWRCDTALLYYPTDSWFVRMTSLRDKLLENNNK-VNWYPDNIRTGRFGKFL
SYI_CLOPE       KHTHSY-PHCWRCDTPLLYYPKESWFVAMTTLRDKLLANNEK-INWYPDNIKNGRFGKFL
SYI_THEAC       KYEHSY-PFCYRCDTPLLYYPLDAWFIAVSRIRDKLVEYNER-INWKPDYLKHGRFGNFL
SYI_THEVO       KYEHSY-PFCYRCDTPLLYYPLDAWFIRVSSVRDKLVENNEK-IRWKPDYLKHGRFGNFL
SYI_PICTO       TMKHDY-PFCYRCGTRLLYYPLDTWFIKVSLIRKKLLENNEK-INWVPDYLKNGRFGNFL
SYI_EHRRG       QYLHNY-PHCWRTDTPLIYRAMSSWYVEVTKIKNRMIDLNKD-VNWIPSHIRSGQFGKWL
SYI_EHRRW       QYLHNY-PHCWRTDTPLIYRAMSSWYVEVTKIKNRMIDLNKD-VNWIPSHIRSGQFGKWL
SYI_EHRCJ       QYLHNY-PHCWRTDTPLIYRAMSSWYVEVTKIKDKMIELNKT-VNWIPNHICNGQFGKWL
SYI_ANAMM       QCTHSY-PHCWRTDTPLIYRATSSWYVEVTKLKARMVELNKE-VNWVPEHVQSGQFGKWL
SYI_RICCN       QYIHNY-PHCWRTDTPLIYKAVPSWYVKVTQFKDRMVELNQQ-INWIPFHVKDNLFGKWL
SYI_RICFE       QYIHNY-PHCWRTDTPLIYKAVPSWYVKVTQFKDRMVELNQQ-INWIPFHVKDNLFGKWL
SYI_RICPR       QYIHNY-PHCWRTDTPLIYKAVPSWYVRVTKFKDRMVELNQQ-INWIPHNVKDNLFGKWL
SYI_RICTY       QYIHNY-PHCWRTDTPLIYKAVPSWYVRVTQFKDRMVELNQQ-INWIPHNVKDNLFGKWL
SYI_WOLPM       QYIHNY-PHCWRTDTPLIYRTMPSWYVAVTKFKSRMVELNKR-VNWIPNHIRDGQFGKWL
SYI_WOLTR       QYIHNY-PHCWRTDTPLIYRAMPSWYVAVTKFKERMIELNKR-VNWIPTHIRDGQFGKWL
SYI_COREF       TIEHSY-PHSWRSGEPLIYMALPSWFVNVTKIRDRMVETNQD-IEWMPAHIRDGQFGKWL
SYI_CORGL       TIEHSY-PHSWRSGEPLIYMALPSWFVNVTEIRDRMVEVNQD-IEWMPAHIRDGQFGKWL
SYI_CORDI       TIEHSY-PHSWRSGEPLIYMALPSWFVEVTKIRDRMVELNKE-IDWMPSHIRDGQFGKWL
SYI_CORJK       TIEHSY-PHSWRSGEPLIYMALPSWFVAVTKFRDRMVELNHEQIEWMPSHIRDGQFGKWL
SYI_MYCBO       TYEHPY-PHCWRCRNPLIYRSVSSWFVRVTDFRDRMVELNQQ-ITWYPEHVKDGQFGKWL
SYI_MYCTU       TYEHPY-PHCWRCRNPLIYRSVSSWFVRVTDFRDRMVELNQQ-ITWYPEHVKDGQFGKWL
SYI_MYCPA       TYEHPY-PHCWRCRNPLIYRAVSSWFVAVTRFRDRMVELNQQ-ITWYPEHVKDGQFGKWL
SYI_MYCLE       TYEHPY-PHCWRCRNPLIYRAVSSWFVAVTEFRDRMVELNQQ-ITWYPEHVKDGQFGKWL
SYI_NOCFA       TIEHSY-PHSWRSGQPLIYMAVPSWFVAVTKFRDRMVELNKQ-ITWVPEHIRDGQFGKWL
SYI_LEIXX       SYEHSY-PHCWRCRNPLIYKAVSSWFVRVTDFRDRMVALNQE-ITWVPENVKDGQFGKWL
SYI_TROW8       SYKHSY-PHCWRCRSPLIYKAVTSWFFRITDSVNRMLELNQQ-INWVPKSVKNGQFAKWL
SYI_TROWT       SYKHSY-PHCWRCRSPLIYKAVTSWFFRITDSVNRMLELNQQ-INWVPKSVKNGQFAKWL
SYI_BIFLO       SYVHSY-PHCWRCATPLIYKPVSSWFVSVTKIKPRLLELNQQ-INWIPGNVKDGQFGKWL
SYI2_PSEFL      QIEHNY-PHCWRCDNPLIYRAVESWFIRASALREQLVENNSQ-VNWVPEHVKEGRFGDWI
SYI_CHLAB       TVVHRY-PFCWRTDTPLIYKTVNSWFISVEKIKDKMLQANKK-IHWVPEHIKEGRFGKWL
SYI_CHLCV       TVMHRY-PFCWRTDTPLIYKTVNSWFVSVEKIKDKMLRANQK-IHWVPEHIKEGRFGKWL
SYI_CHLPN       TVKHRY-PFCWRTDTPLIYKAVNSWFVAVEKIKDKMLRANSS-IHWVPEHIQEGRFGKWL
SYI_CHLMU       TIRHRY-PFCWRTDSPLIYKAVNSWFVSVEKVKHKMLKANES-IHWTPGHIKHGRFGKWL
SYI_CHLTR       TVRHRY-PFCWRTDSPLIYKAVNSWFVAVEKVKSKMLKANES-IHWTPEHIKQGRFGKWL
SYI_PARUW       TCHHRY-PFCPRSDTPLIYKTVRTWFVAVEKIKDRLLAANSQ-IHWTPEHIQYGRFGKWL
SYI_BDEBA       TIQHSY-PFCYRSDTPLIYRAVSSWFVAVEKIKEELIANNKQ-TSWVPDHLRDGRFGNWL
SYI_BORBU       NYLHRY-PFCYRTNCPIIYRPISSWFVNVEKIKTKLLEVNEK-INWMPAHLKKGRFGKWL
SYI_BORBP       NYLHRY-PFCYRTNYPIIYRPISSWFVNVEKIKTQLLEVNEK-INWMPAHLKKGRFGKWL
SYI_TREDE       QILHSY-PHCWRCSSPLIYRAVASWFVSVTKIKDKLLNANSK-INWQPDHIKTGRFGKWL
SYI_TREPA       QISHAY-PHCWRCASPLIYRAVHSWFVAVEKIKDKMLAANAS-ICWQPSHIRDGRFGKWL
SYI_DEHM1       RMHHTY-PFCWRCDSPLIYYAKQSWYIRTTAVRDELIKGNQQ-INWYPEHIKDGRFGDWL
SYI_DEHMC       RMHHTY-PFCWRCDSPLIYYAKQSWYIRTTAVRDELIKGNQQ-INWYPEHIKDGRFGDWL
SYI_THET2       SYLHSY-PHCWRCSTPLMYYATESWFIKNTLFKDELIRKNQE-IHWVPPHIKEGRYGEWL
SYI_THET8       SYLHSY-PHCWRCSTPLMYYATESWFIKNTLFKDELIRKNQE-IHWVPPHIKEGRYGEWL
SYI_DEIRA       TLKHRY-PFHDRTGDPILYFAKKGWYIRTSQVAGEMLAQNEK-INWVPGNIKHGRFGNWL
SYI_STRAW       PYEHSY-PHCWRCHTALLYYAQPSWYIRTTAVKDRLLQENEK-TNWFPESVKHGRFGDWL
SYI_STRCO       PYEHSY-PHCWRCHTALLYYAQPSWYIRTTAIKDRLLQENEK-TNWFPDAVKHGRYGDWL
SYI_THEFY       DYEHSY-PHCWRCHTPLMYYAVPSWYIKTTAIKDQLLAENAK-TNWVPANVKDGRYGEWL
SYI_CUTAK       MHWHSY-PHCWRCDTHLIYYAQPSWYIRTTKVKEQLLAQNEV-TTWYPETIKHGRFGDWL
SYI_BACFN       KHVHNY-PHCWRTDKPVLYYPLDSWFIRSTACKERMIELNKT-INWKPESTGTGRFGKWL
SYI_BACFR       KHVHNY-PHCWRTDKPVLYYPLDSWFIRSTACKERMIELNKT-INWKPESTGTGRFGKWL
SYI_BACTN       KHIHNY-PHCWRTDKPVLYYPLDSWFIRSTACKERMMELNKT-INWKPESTGTGRFGKWL
SYI_PORGI       KMTHNY-PHCWRTDKPVLYYPLDSWFIRTTACKEEMIANNGK-IYWKPESTGTGRFGKWL
SYI_CHLTE       TIQHTY-PFSWRYDVPVIYYARESWYIRTTDIAPRMVALNKT-INWNPPEIGTGRFGNWL
SYI_SULAC       KIVHRY-PVCWRCKTPLILRAIEQWFIAVSKLKDHLMGEI-DRVRWIPDWG-KTRIGNMV
SYI_SULTO       KVVHRY-PVCWRCKTPLILRAIEQWFIGVSKLKEELLKEI-DNVKWVPDWG-KTRIGNMV
SYI_AERPE       TIVHRY-PVCWRCKTPLLLRATTQWFVAVTRLKNQLMREA-EKVEWQPGWA-KTRFMNML
SYI_METJA       KIKHSY-PHCWRCKTPLLFRATEQWFLEISKIKDNIIEHA-KTVQWIPHWV-ETRYINGV
SYI_METMP       KVKHTY-PHCWRCKTPLLFRATEQWFLSISKIKDSIIEQG-KTVDWVPDWV-KTRYVNGV
SYI_PYRFU       EIEHKY-PHCWRCKTPLIFRATDQWFLKVSKVKEKIIKENDEKVTWYPEWV-KIRFDNGV
SYI_PYRHO       EIEHKY-PHCWRCKTPLIFRATDQWFLKVSKVKDRIIKENDEKVTWYPDWV-KIRFDNGV
SYI_PYRAB       EIEHKY-PHCWRCKTPLIFRATDQWFLKISKVKDKIIKENDEKVTWYPDWV-KIRFDNGV
SYI_THEKO       EIEHKY-PHCWRCKTPLIFRATDQWFLKVSKVKDQIIKENDEKVTWYPEWV-KVRYDNGV
SYI_METTH       TISHRY-GFCWRCKTPIIYLATEQWFLKITEIKDKMLREL-DRVQWVPSWAGESRFRNWI
SYI_METTM       TISHRY-GFCWRCKTPIIYLATEQWFLKITEIKDKMLSEL-DRVQWIPSWAGESRFRNWI
SYI_METKA       TVEHRY-GHCWRCKTPIIYRATEQWFLKVTEVKDEMLEWI-ERVEWIPEWAGHSRFKSWV
SYI_METAC       TVTHRY-GHCWRCKTPIIYLATEQWFLKITEIKEKMLEEI-DAVDWYPDWAGSARFRTWV
SYI_METMA       TVTHRY-GHCWRCKTPIIYLATEQWFLKVTEIKEKMLEEI-DAVDWYPDWAGSARFRTWV
SYI_ARCFU       RIVHRY-GHCWRCKTPIIYRATEQWFIKISELKDEMLEEI-DKVMWIPEWAGSARFKDWV
SYI_HALMA       PGHTVREGQCWRCDTDIVRIVTDQWFITVTDIKDELLANI-EDSEWYPQWARDNRFRDFV
SYI_NATPD       TVNHDY-GHCWRCDTPIIQMVTDQWFITVTDIKDELLANM-EESEWFPQEARDNRFRSFI
SYI_HALSA       TVEHSY-GHCWRCDTGIIQIVTDQWFITITDVKDELLANM-DTSEWHPEWARDNRFRDFV
SYI_PYRAE       KIRHEY-PHCWRCGSKLILRADRQWFIAISRIRDKMYAEL-QKVNVVPTKL-RDRFDIFV
                           *    ::      * .        :           *           :

SYI2_BACAN      ENMVDWNISRNRYWGTPLNVWEC--ERCDHQFAPKSIADLRKHSMKETPEDL--------
SYI2_BACHK      ENMVDWNISRNRYWGTPLNVWEC--ESCDHQFAPKSIADLRKHSTKETPEDL--------
SYI2_BACCZ      ENMVDWNISRNRYWGTPLNVWEC--ESCDHQFAPKSIDDLRKHSTKETQEDL--------
SYI2_BACC1      ENMVDWNISRNRYWGTPLNVWEC--ESCDHQFAPKSIADLRKHSTKETPEDL--------
SYI2_BACCR      ENMVDWNISRNRYWGTPLNVWEC--ESCDHQFAPKSIAELRKHSTKETPEDL--------
SYI2_OCEIH      DNMVDWNIGRNRYWGTPLNVWVC--DDCDKQKSPHSIQELRAFADSDVPEDI--------
SYI2_STAAU      ENMVDWNIGRNRYWGTPLNVWIC--NDCNHEYAPSSIKDLQNNSINKIDEDI--------
SYI_CLOAB       ENVIDWGISRDRYWGTPLPIWQC--E-CGHRDCVGSIEELKE-KGINVPENI--------
SYI_CLOTE       ENVIDWGISRDRYWGTPLPIWEC--E-CGHRECIGSISELKE-KGIDVPEDI--------
SYI_CLOPE       ENVIDWGISRDRYWGTPLPIWEC--E-CGHRECIGSIEELKT-KGINVPEDI--------
SYI_THEAC       GEAKDWNLSRDRFWGTPLPAWRC--K-NGHLVFVGSRKEIED-LGGKVPED---------
SYI_THEVO       DEAKDWNLSRDRFWGTPLPVWRC--R-NNHVRFIGSRKEIEE-MGATVPQD---------
SYI_PICTO       EEAKDWALSRDRYWGTPLPIWRC--N-KNHYLAIGSRDDLLK-YGGYIPED---------
SYI_EHRRG       ENAKDWAISRNRFWGTPLPVWKS--DNPNYPRIDVYGSIKKVFDDIKALEEDFDIP----
SYI_EHRRW       ENAKDWAISRNRFWGTPLPVWKS--DNPNYPRVDVYGSIKKVFDDIKALEEDFDIP----
SYI_EHRCJ       ENAKDWAISRNRFWGTPLPVWKS--DNPNYPRIDVYGSIRKVFNNVKALEEDFDISS---
SYI_ANAMM       DGAKDWSVSRHRFWGAPVPVWRS--DDPKYPRTDVYGSIKKVLPDVKALEEDFGPV----
SYI_RICCN       ENARDWSISRNRFWGTPLPVWKS--DDPKYPRIDVYGSIEE-------LEKDFGVK----
SYI_RICFE       ENARDWSISRNRFWGTPLPVWKS--DDPKYPRIDVYGSIEE-------LEKDFGVK----
SYI_RICPR       ENARDWSISRNRFWGTPLPVWKS--DDPKYPRIDVYGSIEE-------IEKDFGVK----
SYI_RICTY       ENARDWSISRNRFWGTPLPVWKS--DDPKYPRIDVYGSIEE-------IEQDFGVK----
SYI_WOLPM       EGAHDWSISRNRFWGTPIPVWKS--DDARYPRVDVYGSIEE-------LERDFNVK----
SYI_WOLTR       ERAHDWSISRNRFWGTPIPIWKS--DNARYPRVDVYGSIAE-------LERDFNVK----
SYI_COREF       EGARDWNISRSRYWGSPIPVWVS--DDENYPRVDVYGSLDE-------LEADFGVRP---
SYI_CORGL       EGARDWNISRSRYWGSPIPAWVS--DNDEYPRVDVYGSLDE-------LEADFGVRP---
SYI_CORDI       EGARDWNISRNRYWGSPIPVWVS--DDENYPRVDVYGSLEE-------LERDFGVRP---
SYI_CORJK       EGARDWNISRNRYWGAPIPVWVS--DSEEYPRMDVYGSLEE-------LERDFGRKP---
SYI_MYCBO       QGARDWSISRNRYWGTPIPVWKS--DDPAYPRIDVYGSLDE-------LERDFGVRP---
SYI_MYCTU       QGARDWSISRNRYWGTPIPVWKS--DDPAYPRIDVYGSLDE-------LERDFGVRP---
SYI_MYCPA       AGARDWSISRNRYWGTPIPVWKS--DDPAYPRIDVYGSLDE-------LERDFGVRP---
SYI_MYCLE       QGARDWSISRNRYWGTPIPVWKS--DDPDYPRIDVYGSLDE-------LERDFGVRP---
SYI_NOCFA       EGARDWNISRNRYWGSPIPVWVS--DDPAYPRVDVYGSLEE-------LERDFGVRP---
SYI_LEIXX       AGARDWSISRNRYFGSPIPVWKS--DDPDYPRVDVYGSLAE-------LERDFGRLPLN-
SYI_TROW8       SSAKDWSISRTRYWGTPIPVWKS--DNPEYPRIDCYGSLKE-------LEDDFGIKL---
SYI_TROWT       SSAKDWSISRTRYWGTPIPVWKS--DNPEYPRIDCYGSLKE-------LEDDFGIKL---
SYI_BIFLO       ANARDWSISRNRFWGSPIPVWVS--DDPKYPRVDVYGSLEE-------LKADFGDYPRD-
SYI2_PSEFL      RNARDWAVSRNRFWGAPIPVWRC--D--QCGTVEVMGSIAQ-------IEARSGRKV---
SYI_CHLAB       EGARDWAISRNRYWGTPIPVWKS--KD---GDILVIGSVEE-------LEKLTGEKV---
SYI_CHLCV       DGARDWAISRNRYWGTPIPIWKS--KE---GEILVIGSVKE-------LEELTGEKI---
SYI_CHLPN       EGARDWAISRNRYWGTPIPIWKS--AD---GEILVVGSIRE-------LEELTGTQI---
SYI_CHLMU       EGARDWAISRNRYWGTPIPIWRS--ED---GELLVIRSIQE-------LEELSGQKI---
SYI_CHLTR       EGARDWAISRNRYWGTPIPIWRS--DD---GELLVIGSIQE-------LEALSGQKI---
SYI_PARUW       EGARDWAISRNRYWGTPIPLWRA--QD---GEIHVVGSIEE-------LKQLTGNPL---
SYI_BDEBA       EGARDWAISRNRFWGTPLPIWRN--AE---GEVMCIGSRAE-------LEKLSGQKV---
SYI_BORBU       ENAKDWAISRNRFWGNPIPIWIC--SKT--GKKICIGSKKE-------LENLSGQKI---
SYI_BORBP       ENAKDWAISRNRFWGNPIPIWIC--SKT--GKKICVGSRKE-------LEELSGQKI---
SYI_TREDE       EGARDWAISRNRYWGNPIPIWKC--PDC--GETICVGSREE-------LKELSGVFP---
SYI_TREPA       VCARDWAISRDRYWGNPLPIWRC--VHC--GATDCIGSRTQ-------LYERSGMLL---
SYI_DEHM1       ENNIDWAFSRERYWGTPVPIWR---CEKCGRTECVGGIDELKAKPNFKGMQEK-------
SYI_DEHMC       ENNIDWAFSRERYWGTPVPIWR---CEKCGQTECVGGIDELKAKPNFKGMQEK-------
SYI_THET2       KNLVDWALSRNRYWGTPLPIWV---CQACGKEEAIGSFQELRERAT-QPLPEP-------
SYI_THET8       KNLVDWALSRNRYWGTPLPIWV---CQACGKEEAIGSFQELKARAT-KPLPEP-------
SYI_DEIRA       EGNVDWAISRERYWGTPLPFWQ---SES-GQLRVIGSVAELSELAG-RDLSD--------
SYI_STRAW       NNNVDWALSRSRFWGTPLPLWTC--EEGH--LTCVGSRAELSELTG-TDQSN--------
SYI_STRCO       NNNIDWALSRNRYWGTPLPIWRC--AEDH--LTVVGSRAELTELSG-TDQSS--------
SYI_THEFY       RNNVDWALSRSRYWGTPLPIWEF--PDGR--RICVGSLKELSELSG-QDLSD--------
SYI_CUTAK       ENNIDWAVSRSRYWGTPLPLWRN--DDDRSDVICVESLAELSQYVG-RDLTG--------
SYI_BACFN       ENLNDWNLSRSRYWGTPLPIWRT--EDNSDEKCIESVEELYNEIEKSVAAGYMQSNPYKD
SYI_BACFR       ENLNDWNLSRSRYWGTPLPIWRT--EDNSDEKCIESVEELYNEIEKSVAAGYMQSNPYKD
SYI_BACTN       ENLNDWNLSRSRYWGTPLPIWRT--EDGTSEICIESVEELYNEIEKSVAAGFMKSNPYKD
SYI_PORGI       ENLQDWNLSRSRYWGTPLPIWRT--EDGSEEICIGSVEELYNEIEKAVKAGMMERNPWA-
SYI_CHLTE       EENKDWALSRERFWGTPLPVWVA--EDFAIGDGPDSGKLFAVGSVAELREGFIEIDGEE-
SYI_SULAC       KEVRDWVISRQRFWGTPLPIWV----CSNCQNIIVVGGVDELSKISINQV----------
SYI_SULTO       REIRDWVISRQRFWGTPLPIWI----CKNCGNIIVIGSRDELEKVAITKV----------
SYI_AERPE       RELRDWVISRQRYWGIPLPVWR----CSSCGYEHVVGSVEELESMG-GRR----------
SYI_METJA       KFVGDWNISRQRYWGIPIPVWV----CEKCGKYIVVGSVEELEEKMINKDE---------
SYI_METMP       SFVGDWNISRQRYWGIPLPIWI----CEECGNYEVIGSVDELKERANEKD----------
SYI_PYRFU       RDSGDWVISRQRYWGIPLPIWQ----SED-GEIYVVGSWKELVELAVAIEVNGERIDLPE
SYI_PYRHO       RDSGDWVISRQRYWGIPLPIWQ----SED-GEIYVVGSWRELVELAVAIEVNGERIDLPE
SYI_PYRAB       RDSGDWVISRQRYWGIPLPIWQ----SED-GEIYVVGSWRELVELAVAIEVNGERIELPE
SYI_THEKO       MNSGDWVISRQRYWGIPLPIWE----SED-GEYYVVGSFEELVKLAVAIEVNGERIDLPE
SYI_METTH       ENARDWTISRQRYWGIPIPIWI----CEECDSIHVVGSIDELRELAVEGE----------
SYI_METTM       ENARDWTISRQRYWGIPIPIWV----CEDCDSIHVVGSIGELRELAVEGQ----------
SYI_METKA       ENARDWCISRQRYWGIPLPVWE----CEECGHLEVIGSLSELEAKAVSLP----------
SYI_METAC       EGARDWCISRQRYWGIPLPVWKCKKCG----KLEVIGTKAELLEKAGLSGD---------
SYI_METMA       EGARDWCISRQRYWGIPIPVWKCKKCG----KLEVIGTKAELLEKAGLNGD---------
SYI_ARCFU       SNAKDWCISRQRYWGIPIPVWICEKCG----EMKVVGSINEI----EWEND---------
SYI_HALMA       EDAPDWNVSRQRYWGIPIPIWLPEDWSGDMDDAIVVGDREELAERVDQDIDP--------
SYI_NATPD       EESPDWNVSRQRYWGIPIPIWTPDDWSGDVEEAIVVSTREELAERVDQDIDP--------
SYI_HALSA       ENAPDWNVSRQRYWGIPVPIWTPEDWSGDAEDVLVVGTREELAALADQDVDP--------
SYI_PYRAE       QNARDWNISRSRVWGTPLPVWR----CKKDGRILVIGSLEELKKLAKELPPV--------
                    ** ..* * :* *:  *                                       

SYI2_BACAN      ----------------ELHKPYVDEVQVCCEK-------CGSTMNRTPEVIDVWFDSGSM
SYI2_BACHK      ----------------ELHKPYVDEVQVSCEK-------CGSAMNRTPEVIDVWFDSGSM
SYI2_BACCZ      ----------------ELHKPYVDEVQVCCEK-------CGGTMTRTPEVIDVWFDSGSM
SYI2_BACC1      ----------------ELHKPYVDEVQVSCEK-------CGGAMNRTPEVIDVWFDSGSM
SYI2_BACCR      ----------------ELHKPYVDEVQVCCGK-------CGGTMNRTPEVIDVWFDSGSM
SYI2_OCEIH      ----------------ELHKPYVDKITFDCE--------CGGKMHRTKEVIDVWFDSGSM
SYI2_STAAU      ----------------ELHRPYVDNITLSCPK-------CNGKMSRVEEVIDVWFDSGSM
SYI_CLOAB       ----------------ELHKPYIDEVKLTCPK-------CGKPMTRTEEVIDCWFDSGSM
SYI_CLOTE       ----------------ELHKPYIDKVKLKCSK-------CGKEMKRTREVIDCWFDSGSM
SYI_CLOPE       ----------------ELHKPYIDKVHLNCPH-------CNKEMKRTAEVIDCWFDSGSM
SYI_THEAC       -----------------LHRPYIDEVRFKCPT-------CGEEMSREPYVIDTWFDSGSA
SYI_THEVO       -----------------LHRPYIDEVKFVCPD-------CGEEMRREPYVIDTWFDSGSA
SYI_PICTO       -----------------LHRPYIDDVVLKCPE-------CGSEMHRESYVIDTWFDSGSA
SYI_EHRRG       --------------IDDLHRPYIDNLVRPNPDDP----TGKSMMRRVTDVFDCWFESGSM
SYI_EHRRW       --------------IDDLHRPYIDNLVRPNPDDP----TGKSMMRRVTDVFDCWFESGSM
SYI_EHRCJ       --------------INDLHRPYIDNLVRPNPDDP----TGKSMMRRVSDVFDCWFESGSM
SYI_ANAMM       ---------------EDLHRPYIDNLVRPNPDDP----TGKSMMRRVPDVLDCWFESGSM
SYI_RICCN       --------------VTDLHRPFIDELTRPNPDDP----TGKSTMRRIEDVFDCWFESGSM
SYI_RICFE       --------------VTDLHRPFIDELARPNPNDP----TGKSTMRRIEDVFDCWFESGSM
SYI_RICPR       --------------INDLHRPFIDELTRTNPDDP----TGKSTMRRIDDVFDCWFESGSM
SYI_RICTY       --------------INDLHRPFIDELTRTNPDDP----TGKSIMRRIDDVFDCWFESGSM
SYI_WOLPM       --------------IDDLHRPFIDTLTRLNPDDP----TGKSVMRRVPDVFDCWFESGSM
SYI_WOLTR       --------------VNDLHRPFIDSLTRPNPDDP----TGKSIMRRVPDVFDCWFESGSV
SYI_COREF       ---------------TSLHRPYIDELTRPNPDDP----TGKSTMRRVPDVLDVWFDSGSM
SYI_CORGL       ---------------KSLHRPDIDELTRPNPDDP----TGKSTMRRVTDVLDVWFDSGSM
SYI_CORDI       ---------------ESLHRPHIDELTRPNPDDP----TGKSTMRRVPEVLDCWFESGSM
SYI_CORJK       ---------------ASLHRPDIDELTRPNPDDP----TGKSTMRRVPEVLDCWFESGSM
SYI_MYCBO       ---------------ANLHRPYIDELTRPNPDDP----TGRSTMRRIPDVLDVWFDSGSM
SYI_MYCTU       ---------------ANLHRPYIDELTRPNPDDP----TGRSTMRRIPDVLDVWFDSGSM
SYI_MYCPA       ---------------DNLHRPYIDELTRPNPDDP----SGRSTMRRIPDVLDVWFDSGSM
SYI_MYCLE       ---------------TNLHRPYIDELTRPNPDDP----TGLSTMRRIPDVFDVWFDSGSM
SYI_NOCFA       ---------------TDLHRPAIDQLTRPNPDDP----TGRSMMRRVPEVLDCWFESGSM
SYI_LEIXX       -----------AAGEPDLHRPFVDDLTRPNPDDP----TGRSTMRRIPDVLDVWFDSGSM
SYI_TROW8       ---------------TDLHRPEIDRLTRPNPDDP----TGASTMRRVPDVLDVWFDAASM
SYI_TROWT       ---------------TDLHRPEIDRLTRPNPDDP----TGASTMRRVPDVLDVWFDAASM
SYI_BIFLO       -----------KDGNINMHRPWIDNLVRVNPDDP----TGKSHMHRISDVLDCWFESGSM
SYI2_PSEFL      ---------------EDLHVPHIDEHRFAC---Q----CCEGTMSRVTGVFDCWFESGAM
SYI_CHLAB       ---------------SDLHCHFVDQLKIEK--------DGKS-FHRVPYVFDCWFDSGAM
SYI_CHLCV       ---------------SDLHCHFIDQLKVEK--------EGKT-FQRVPYVFDCWFDSGAM
SYI_CHLPN       ---------------TDIHRHFIDDLNIVK--------DGKP-FHRIPYVFDCWFDSGAM
SYI_CHLMU       ---------------VDLHRHFIDEIVIHK--------NGKS-FHRIPYVFDCWFDSGAM
SYI_CHLTR       ---------------VDLHRHFIDEIEINQ--------NGKS-FRRIPYVFDCWFDSGAM
SYI_PARUW       ---------------TDLHRHFIDEMSFEK--------NGKT-FKRIPEVFDCWFESGSM
SYI_BDEBA       ---------------DDLHIEFVDKITIPSP-------TGKSPLKRVDGVLDCWFESGSM
SYI_BORBU       ---------------EDLHKDQIDKITWPSK--------DGGKFIRTSEVLDCWFESGAM
SYI_BORBP       ---------------EDLHKDKIDKITWPSK--------DGGTFIRTSEVLDCWFESGAM
SYI_TREDE       ---------------EDMHKHFVDKISIPCK-------KCGGTMKRVSEVLDCWFESGSM
SYI_TREPA       ---------------EDLHKHVVDMVTIPCA--------CGSVMRRVPEVLDCWFESGAM
SYI_DEHM1       ---------------LDIHRPYVDEWTYDCDKC-------GGNMKRVTEVMDCWYDSGAM
SYI_DEHMC       ---------------LDIHRPYADEWTYDCAKC-------GGNMKRVTEVMDCWYDSGAM
SYI_THET2       ---------------FDPHRPYVDQVELACEC--------GGTMRRVPYVIDVWYDSGAM
SYI_THET8       ---------------FDPHRPYVDQVELACAC--------GGTMRRVPYVIDVWYDSGAM
SYI_DEIRA       ---------------LDLHRPYIDDITFTLD---------GEEYRRVPEVLDVWFDSGSM
SYI_STRAW       ---------------LDPHRPFIDAVTFACPQDG-----CGRTATRVPEVIDAWYDSGSM
SYI_STRCO       ---------------LDPHRPFIDDVTFTCAQEG-----CSLEAVRVPEVIDAWYDSGSM
SYI_THEFY       ---------------LDPHRPYVDDIVIPDPDADPSLPLEQRVARRVPEVIDVWFDSGAM
SYI_CUTAK       ---------------MDPHRPFIDEVTFTR---------DGHTYHRVPEVADAWLDSGSM
SYI_BACFN       KGFVPGEYNEENYNKIDLHRPYVDDIILVSK--------DGKPMKREADLIDVWFDSGAM
SYI_BACFR       KGFVPGEYNEENYNKIDLHRPYVDDIILVSK--------DGKPMKREADLIDVWFDSGAM
SYI_BACTN       KGFVPGEYTEGNYDKIDLHRPYVDDIILVSE--------DGQPMKRESDLIDVWFDSGAM
SYI_PORGI       -GFKPGVYTEENYAKIDLHRPFVDGITLCSP--------SGQPMRRELDLIDVWFDSGAM
SYI_CHLTE       --MNLGDALDKGLVELDLHKPFVDRIWFIR---------DGKRFNRTPELIDVWFDSGSM
SYI_SULAC       --------------PQDLHRPWIDSVVVRCEK-------CGGEARRISDVADVWFDSGVA
SYI_SULTO       --------------PEDLHRPWIDKVVVRCNK-------CGGEAHRVPDVADVWFDSGVA
SYI_AERPE       --------------PENLHRPWVDRVELKCPR-------CGGSMKRVPDVLDVWFDSGIA
SYI_METJA       -----------VGEINDLHKPTVDKIKLRCEC--------GGEMKRVPDVLDVWFDSGLA
SYI_METMP       ------------VDLSDIHKPAVDKITLTCSC--------GGKMKRTPDVLDVWYDSGLA
SYI_PYRFU       SYEEKLKVIEEKLGPEDLHRPYVDAFIIKVN---------GKEMRRVKDVVDVWFDSGIA
SYI_PYRHO       SYEEKLKVIEEKLGPEDLHRPYVDAFIIKVN---------GKEMRRVKDVVDVWFDSGIA
SYI_PYRAB       SYEEKLKVIEEKLGPEDLHRPYVDAFIIKVN---------GKDMRRVKDVVDVWFDSGIA
SYI_THEKO       GYEEKLKIIEEKLGPEDLHRPYVDAFIIKVN---------GKEMKRVKDVVDVWFDSGIA
SYI_METTH       ------------LEGDFIHRPHVDRIVLECGE-------CGGRMKRTPDVLDVWIDSGVA
SYI_METTM       ------------LEGDFIHRPHVDRIILECGR-------CGGRMKRTPDVLDVWIDSGVA
SYI_METKA       ------------PGEPDLHRPWVDEVVLKCPE-------CGSYMRRVPDVLDVWVDSGVA
SYI_METAC       ---------------IELHRPYVDRVT-VPCE-------CGGEKKRVEDVFDVWFDSAVA
SYI_METMA       ---------------IELHRPYVDRVT-VPCE-------CGGEKKRVEDVFDVWFDSAVA
SYI_ARCFU       ---------------LDLHRPKIDAVT-FSCQ-------CGGVMRRVPDVFDVWFDSGVA
SYI_HALMA       -------------ENVDLHKGTVDDLT-ITED-------ST-TYTRVGDVFDVWLDSSVA
SYI_NATPD       -------------ESVDLHKDTVDDLT-ITAD-------GT-TYTRVPDVFDVWLDSSVA
SYI_HALSA       -------------ASVDLHKPTVDDIT-ITED-------GT-EYTRVPDVFDVWLDSSVA
SYI_PYRAE       ------------DDFKLVHRPWIDQVKISAHD-------CD-EWVREPYVMDVWLDSGIA
                                  *    *                     *   : * * ::.  

SYI2_BACAN      PFAQYHYPFENKEL----------------FEEQFPADVIAEGIDQTRGWFYSLLAVSAL
SYI2_BACHK      PFAQYHYPFENKEL----------------FEEQFPADVIAEGIDQTRGWFYSLLAVSAL
SYI2_BACCZ      PFAQYHYPFENKEL----------------FEEQFPADVIAEGIDQTRGWFYSLLAVSAL
SYI2_BACC1      PFAQYHYPFENKEL----------------FEDQFPADVIAEGIDQTRGWFYSLLAVSAL
SYI2_BACCR      PFAQYHYPFENKEL----------------FEEQFPADVIAEGIDQTRGWFYSLLAVSAL
SYI2_OCEIH      PFAQYHHPFENDEL----------------FNKQFPADVVIEGVDQTRGWFYSLLAVSTL
SYI2_STAAU      PFAQHHYPFDNQKI----------------FNQHFPADFIAEGVDQTRGWFYSLLVISTI
SYI_CLOAB       PFAQLHYPFENKEV----------------FENTFPAQFISEAVDQTRGWFYTLLAISTS
SYI_CLOTE       PFAQHHYPFENKEV----------------FEKTFPAQFISEAVDQTRGWFYTLTAISTA
SYI_CLOPE       PFAQHHYPFENKEL----------------FEANYPAQFISEAVDQTRGWFYTLLAISTA
SYI_THEAC       TYAASHYPFEKNFD----------------PETDVPVSFITEAIDQTRGWFYVLHVIATI
SYI_THEVO       TYAAMHYPFEDNFD----------------PSSDLPVSFITEAIDQTRGWFYVLHVISTI
SYI_PICTO       SYAAMHYPFSKDF-----------------TKSHFPVDFITEAIDQTRGWFYTLHVVASL
SYI_EHRRG       PYAQLHYPFENKE----LFENY------------FPADFITEYVAQTRGWFYTLFVLSTA
SYI_EHRRW       PYAQLHYPFENKE----LFENY------------FPADFITEYVAQTRGWFYTLFVLSTA
SYI_EHRCJ       PYAQLHYPFENKE----FFENY------------FPADFITEYIAQTRGWFYTLFILSTA
SYI_ANAMM       PYAQMHYPFENKE----FFDSH------------FPADFITEYIAQTRGWFYTLFVLSTG
SYI_RICCN       PYGQAHYPFENKE----WFEDH------------FPADFIVEYSAQTRGWFYTLMVLSTA
SYI_RICFE       PYGQAHYPFENKK----WFEDH------------FPADFIVEYSAQTRGWFYTLMVLSTA
SYI_RICPR       PYGQVHYPFENKK----WFVEH------------FPADFIVEYSSQTRGWFYTLMVLSTA
SYI_RICTY       PYGQAHYPFENKK----WFVEH------------FPADFIVEYSSQTRGWFYTLIVLSTA
SYI_WOLPM       PFAQIHYPFENKE----WFES---------------ADFITEYIAQTRGWFYTLFVLSTA
SYI_WOLTR       PFAQVHYPFENKE----WFESN------------FPADFITEYIAQTRGWFYTLFVLSTA
SYI_COREF       PFAQVHYPFENKD----WFDT------------HAPADFIVEYIGQTRGWFYLLHVLSVG
SYI_CORGL       PFAQVHYPFENKE----WFDT------------HAPADFIVEYIGQTRGWFYLLHVLSTA
SYI_CORDI       PFAQKHYPFENKD----WFDT------------HSPADFIVEYSGQTRGWFYTLHVLATA
SYI_CORJK       PFAQKHYPFENKE----WFDT------------HSPADFIVEYSGQTRGWFYTMHVLSTA
SYI_MYCBO       PYAQVHYPFENLD----WFQG------------HYPGDFIVEYIGQTRGWFYTLHVLATA
SYI_MYCTU       PYAQVHYPFENLD----WFQG------------HYPGDFIVEYIGQTRGWFYTLHVLATA
SYI_MYCPA       PYAQVHYPFENRD----WFET------------HYPGDFIVEYIGQTRGWFYTLHVLATA
SYI_MYCLE       PYAQVHYPFENDD----WFDGFDSADSDKQVDAHYPGDFIVEYIGQARGWFYTLHVLATA
SYI_NOCFA       PYAQVHYPFENKE----WFDS------------HFPGDFIVEYNGQTRGWFYTLHVLATA
SYI_LEIXX       PFAQVHYPFENSD----WFDS------------HNPADFIVEYIGQARGWFYLLHALSTA
SYI_TROW8       PFAQLHYPFENIE----RFEA------------NKSADFIVEYAGQIRGWFYLLHAMSTA
SYI_TROWT       PFAQLHYPFENIE----RFEA------------NKSADFIVEYAGQIRGWFYLLHAMSTA
SYI_BIFLO       SFAQFHYPFENKE----KFEQ------------HFPADYIVEYIGQTRGWFYLLHVMATA
SYI2_PSEFL      PFASRHYPFENKQ----EFEQT------------FPADFIVEYLAQTRGWFYTMMVISTG
SYI_CHLAB       PYAQNHYPFENQKETESG----------------FPADFIAEGLDQTRGWFYTLTVISAA
SYI_CHLCV       PYAQNHYPFENQKETEAG----------------FPADFIAEGLDQTRGWFYTLTVISSA
SYI_CHLPN       PYAQNHYPFENQKETEEA----------------FPADFIAEGLDQTRGWFYTLTVISAI
SYI_CHLMU       PYAQNHYPFERAEETEAR----------------FPADFIAEGLDQTRGWFYTLTVIAAA
SYI_CHLTR       PYAQNHYPFERAEETEAC----------------FPADFIAEGLDQTRGWFYTLTVIAAA
SYI_PARUW       PYAQNHYPFENRELFEQN----------------FPADFIAEGLDQTRGWFYTLTVLSAA
SYI_BDEBA       PYAQWGYPETSVEDFKKA----------------FPADFIAEGLDQTRGWFYTLSIIGTA
SYI_BORBU       PYASNHYPFTNEINFKNI----------------FPADFIAEGLDQTRGWFYTLTILGTA
SYI_BORBP       PYASNHYPFANESNFKNI----------------FPADFIAEGLDQTRGWFYTLTILGTS
SYI_TREDE       PYAQQHYPFENKEHFEKN----------------FPADFISEGLDQTRGWFYTLTILAAA
SYI_TREPA       PYAQQHYPFEHATDFERY----------------FPAHFISEGLDQTRGWFYTLTILAVA
SYI_DEHM1       PVAQYHYPFEPESR-------------SIAKDGRFPADYICEAVDQTRGWFYSLHAISTL
SYI_DEHMC       PVAQYHYPFEPESR-------------TIASDGRFPADYICEAVDQTRGWFYSLHAISTL
SYI_THET2       PFASLHYPFEHQ----------------ETFRESFPADFIAEGIDQTRGWFNSLHQLGVM
SYI_THET8       PFASLHYPFEHE----------------EVFRESFPADFIAEGIDQTRGWFNSLHQLGVM
SYI_DEIRA       PYAQWGLLLNEQGEAV---------RGAEQFAKHYPADYICEAIDQTRGWFYSLHAISTM
SYI_STRAW       PFAQWGYPYK----------------NKELFESRYPAQFISEAIDQTRGWFYTLMAVGTL
SYI_STRCO       PFAQWGYPYK----------------NKELFESRYPAQFISEAIDQTRGWFYTLMAVGTL
SYI_THEFY       PFAQWGAPHR----------------NQEKFEANFPAQYICEAIDQTRGWFYSLMAVSTL
SYI_CUTAK       PFAQWGYPHVPG--------------SKEKFESHYPGDFICEAIDQTRGWFYTMMAVGTL
SYI_BACFN       PYAQIHYPFENK--------------ELLDSHQVYPADFIAEGVDQTRGWFFTLHAIATM
SYI_BACFR       PYAQIHYPFENK--------------ELLDSHQVYPADFIAEGVDQTRGWFFTLHAIATM
SYI_BACTN       PYAQIHYPFENK--------------NILDNREVYPADFIAEGVDQTRGWFFTLHAIATM
SYI_PORGI       PYAQMHYPFENR--------------ERVEDGSVFPADFIAEGVDQTRGWFFTLHAIATM
SYI_CHLTE       PFAQLHYPFENK--------------ELFD--KTFPADFIAEGVDQTRGWFYTLHAIATL
SYI_SULAC       FFASLGQDW-RKRWSELGPV-----------------DLVLEGHDQLRGWFFSLLRTGVI
SYI_SULTO       FFASLGKDW-EKKWKEIGPV-----------------DLVLEGHDQLRGWFFSLLRAGVI
SYI_AERPE       FYASLGYPRDRETWERLKPV-----------------DFIVEGHDQIRGWFFSLLRSGVI
SYI_METJA       PYASIGV-------KELKKA-----------------DFITEGHDQVTKWFYSQHALSAI
SYI_METMP       PYASIGS-------KKLKKA-----------------QFITEGNDQVTKWFYSQHALSAV
SYI_PYRFU       SWASLGYPRNKELFEKLWPA-----------------DFIVEGEDQVTKWFYSQQAASVI
SYI_PYRHO       SWASLGYPRNKELFEKLWPA-----------------DFIVEGEDQVTKWFYSQQAASVI
SYI_PYRAB       SWASLGYPRNKELFEKLWPA-----------------DFIVEGEDQVTKWFYSQQAASIV
SYI_THEKO       SWASLDYPRNKELFEKLWPA-----------------DFIVEGEDQVTKWFYSQQAASVI
SYI_METTH       GWAALHYPSETELFREWFPY-----------------DFITEGHDQTRGWFYSQLGCGVI
SYI_METTM       GWAALHYPREKELFSEWFPY-----------------DFITEGHDQTRGWFYSQLGCGVI
SYI_METKA       AWASLGYPRREDEFERWFLKEGRC----DPDDPEAGADFITEGHDQTRGWFYSQLGCGVV
SYI_METAC       SWATLKFPQTHDQFDEWWPA-----------------DFVTEGHDQTRGWFYSQLGASMV
SYI_METMA       SWATLKFPQTRDQFDEWWPA-----------------DFITEGHDQTRGWFYSQLGASMV
SYI_ARCFU       SWGSIAYPLRKDKFEELWPA-----------------DFITEGHDQTRGWFYSQLGTSVV
SYI_HALMA       TWGTVNYPEQTEDFEELWPA-----------------DLIMEAHDQTRGWFWSQLGMSTA
SYI_NATPD       SWGTLGYPGNEDDFEELWPA-----------------DLIMEAHDQTRGWFWSQLGMGSA
SYI_HALSA       SWGTLNYPEQEDDFDELWPA-----------------DLIMEAHDQTRGWFWSQLGMGTA
SYI_PYRAE       WIAAVDGENNRDLWEKLFPY-----------------DFVTEGIDQTRGWFYSLLATSVL
                  .                                    : *   *   **      .  

SYI2_BACAN      YTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALDPVDLVG--KFGADALRWALLVDSALWN
SYI2_BACHK      YTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALDPVDLVG--KFGADALRWALLVDSAPWN
SYI2_BACCZ      YTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALDPVDLVN--QFGADALRWALLVDSAPWN
SYI2_BACC1      YTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALDPVDLVN--QFGADALRWALLVDSAPWN
SYI2_BACCR      YTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALDPVDLVD--KFGADALRWALLVDSAPWN
SYI2_OCEIH      FTGKTPYKRVLSLGHILDEHGRKMSKSKGNALSPVELIE--EFGADALRWALLADSSPWN
SYI2_STAAU      LKGKSSYKRALSLGHILDSNGKKMSKSKGNVINPTELIN--KYGADSLRWALISDSAPWN
SYI_CLOAB       IFDKSSFENCIVLGHVLDKHGLKMSKHKGNVVDPFDVLD--NQGADACRWHFYTSSAPWL
SYI_CLOTE       IFDTNPFENCIVLGHVLDKHGLKMSKSKGNVVDPFDVLD--SAGADASRWHFYTASAPWL
SYI_CLOPE       IFDRNPFENCIVLGHVLDKKGLKMSKSKGNVVDPFEVLD--SQGADATRWHFYTASAPWL
SYI_THEAC       MFNKNAYESALSINFILDAQGRKMSKSKGNSVYALDFLN--EVPPDSLRLFFLY-GAPWK
SYI_THEVO       MFNKNAYDSALSISFILDEQGRKMSKSKGNSVFALDYLK--QVAPDSLRLFFLY-GAPWK
SYI_PICTO       LFDENAYKNVVSISHILDENGQKMSKSKGNFIAAIDFLN--DYGADAARMFFFT-GAPWN
SYI_EHRRG       LFDKPPFKNCICHGVVLDTQGQKLSKRLNNYADPMEIFK--QYGSDAMRFLMLSHTVSYG
SYI_EHRRW       LFDKPPFKNCICHGVVLDTQGQKLSKRLNNYADPMEIFK--QYGSDAMRFLMLSHTVSYG
SYI_EHRCJ       LFNKPPFINCICHGVVLDTQGQKLSKRLNNYADPMEIFN--QYGSDAMRFLMLSHTVLYG
SYI_ANAMM       LFDRHPFKNCICHGVVLDIKGQKLSKRLNNYPDPMEMFE--KYGADSVRFTMLSHAVSIG
SYI_RICCN       LFDRPPFLNCICHGVILDSTGQKLSKRLNNYADPLELFD--KYGSDALRVTMLSSNVVKG
SYI_RICFE       LFDRPPFLNCICHGVILDATGQKLSKRLNNYADPLELFD--KYGSDALRVTMLSSNVVKG
SYI_RICPR       LFDRPPFLNCICHGVILDATGQKLSKRLNNYADPLELFD--KYGSDALRVTMLSSNVVKG
SYI_RICTY       LFDRPPFLNCICHGVILDATGQKLSKRLNNYADPLELFD--RYGSDALRVTMLSSNVVKG
SYI_WOLPM       LFNREPFKNCICHGVVLDVKGQKLSKRLNNYADPMEVFD--RYGSDALRFLMLSGSIICG
SYI_WOLTR       LFDSEPFKNCICHGVVLDVKGQKLSKRLNNYADPMEVFD--KYGSDALRFLMLSGSIVCG
SYI_COREF       LFDRPAFKKVVAHGIVLGDDGLKMSKSKGNYPNVTEVFD--RDGSDAMRWFLMSSPILRG
SYI_CORGL       LFDRPAFKKVVAHGIVLGDDGLKMSKSKGNYPNVNEVFD--RDGSDAMRWFLMSSPILRG
SYI_CORDI       LFDRPAFKKVVAHGIVLGDDGTKMSKSRRNYPDVNEVFN--RDGSDAMRWFLMSSPILRG
SYI_CORJK       LFDRPAFKKVVAHGIVLGDDGLKMSKSKGNYPNVNEVFD--RDGSDAMRWFLMSSPILRG
SYI_MYCBO       LFDRPAFKTCVAHGIVLGFDGQKMSKSLRNYPDVTEVFD--RDGSDAMRWFLMASPILRG
SYI_MYCTU       LFDRPAFKTCVAHGIVLGFDGQKMSKSLRNYPDVTEVFD--RDGSDAMRWFLMASPILRG
SYI_MYCPA       LFDRPAFKTCVAHGIVLGSDGQKMSKSLRNYPDVSEVFD--RDGSDAMRWFLMASPILRG
SYI_MYCLE       LFDRPAFKTCIAHGVVLGSNGQKMSKSLRNYPDVTEIFD--RDGSDAMRWFLMASPILRG
SYI_NOCFA       LFDSPAFKTVAAHGIVLGDDGLKMSKSKGNYPDVNEVFD--RDGSDAMRWFLMSSPILRG
SYI_LEIXX       LFDRPAFTNVISHGIVLGNDGQKVSKSLRNYPDVNDVFD--RDGSDAMRWFLMSSPVLRG
SYI_TROW8       LFDGVAFKNAICHGIVLGDDGQKASKSLRNYPDVYDVFE--NEGSDAVRWYLISSSILRG
SYI_TROWT       LFDGVAFKNAICHGIVLGDDGQKASKSLRNYPDVYDVFE--NEGSDAVRWYLISSSILRG
SYI_BIFLO       LFDRPAFKNVICHGIVLGSDGQKMSKHLRNYPDVNGVFD--KYGSDAMRWFLMSSPILRG
SYI2_PSEFL      CFEQNPFKNAMCHGVILAKDGRKMSKRLKNYPNPMDLMQ--THGSDALRVALLASPVCKG
SYI_CHLAB       LFDQPVFKNAIVNGIVLAEDGNKMSKRLNNYPSPMSIMN--TYGADALRLYLLDSVVVKA
SYI_CHLCV       LFDQTAFKNAIVNGIVLAEDGNKMSKRLNNYPSPMGIMN--TYGADALRLYLLDSVVVKA
SYI_CHLPN       LFDRPAFRNAIVNGIILAEDGNKMSKRLNNYPSPKYVLD--TYGADALRLYLLHSVVVKA
SYI_CHLMU       LFDQPAFKNVIVNGIVLAEDGNKMSKRLNNYPSPKKIMD--TYGADALRLYLLNSVVVKA
SYI_CHLTR       LFDQPAFKNVIVNGIILAEDGNKMSKRLNNYPSPKMIMD--AYGADALRLYLLNSVVVKA
SYI_PARUW       LFDQPAMKNVIVNGLILAENGAKMSKRLKNYPDPAEVIQ--QYGADAIRLYMLHSPAVKA
SYI_BDEBA       LFNQAPFKNVVVNGLVLAEDGRKMSKSLKNYPDPMEVLN--QHGADALRLYLIDSPVVKA
SYI_BORBU       LFENTAFKNVIVNGLVLSSDGRKMSKSFKNYTDPMQVIN--TFGADALRLYLIMSPVVKA
SYI_BORBP       LFENTAFKNVIVNGLVLSSDGRKMSKSFKNYTDPMEVIN--TFGADALRLYLIMSPVVKA
SYI_TREDE       LFDEPAFKNCIVNGLVLAEDGKKMSKSLRNYTDPNEVIK--QFGADALRLFLMNSNVVKA
SYI_TREPA       LFERPAFENCIVTGLVLASDGKKMSKALRNYADPNEVMD--RYGADALRLFLVRSAVVRA
SYI_DEHM1       IFNRPCYQNVICLGHILDERGEKMSKSRNNVIQPATVLD--KYGADAVRWYFYTAAPPGN
SYI_DEHMC       IFGRPCYQNVICLGHILDERGEKMSKSKNNVIQPAAVLD--KYGADAVRWYFYTAAPPGN
SYI_THET2       LFGSIAFKNVICHGLILDEKGQKMSKSKGNVVDPWDIIR--EFGADALRWYIYVSAPPEA
SYI_THET8       LFGSIAFKNVICHGLILDEKGQKMSKSKGNVVDPWDIIR--EFGADALRWYIYVSAPPEA
SYI_DEIRA       LYDQPAYKNVICLGHIVDEKGLKMSKSKGNVVAPLPLFD--QYGADSVRWYMFMASDPGD
SYI_STRAW       VFDKSSYENVVCLGHILAEDGRKMSKHLGNILQPIPLMD--QHGADAVRWFMAAGGSPWA
SYI_STRCO       VFDKSSYENVVCLGHILAEDGRKMSKHLGNILQPIPLMD--QHGADAVRWFMAAGGSPWA
SYI_THEFY       VFGRSSYENVVCLGHILAEDGRKMSKHLGNILEPIPVMD--RHGADALRWFMAASGSPWM
SYI_CUTAK       VFDESSYRNVLCLGHILAEDGRKMSKHLGNILLPIPLMD--SHGADALRWFMAADGSPWS
SYI_BACFN       VFDSVSYKAVISNGLVLDKNGNKMSKRLGNAVDPFSTIE--QYGSDPLRWYMITNSSPWD
SYI_BACFR       VFDSVSYKAVISNGLVLDKNGNKMSKRLGNAVDPFSTIE--QYGSDPLRWYMITNSSPWD
SYI_BACTN       VFDSVSYKAVISNGLVLDKNGNKMSKRLNNAVDPFTTIE--KYGSDPLRWYMITNSSPWD
SYI_PORGI       ISGTSSFKVVVSNGLVLDKKGNKMSKRLGNAVDPFETIK--KYGSDPLRWYMITNSSPWD
SYI_CHLTE       IFDRPAYRNVVVNGHILDKSGQKMSKSKGNVVDPFESME--QYGADAIRWYLMITSPPWR
SYI_SULAC       LMDKAPYEAVLVHGFMLDEQGREMHKSSGNYVEPSQVVS--KYGRDTLRLWLLR-NTTWE
SYI_SULTO       LLDRAPYNAVLVHGFMLDEQGREMHKSLGNYVEPSQVTENEKYGRDVLRLWLLR-NTTWE
SYI_AERPE       GFGETPYRRVLVHGFALDEQGREMHKSLGNYVDFEELIA--KVPRDVVRFWVLQ-NTVWE
SYI_METJA       VFNDIPYKKCLMHGFTLDEHGDKMSKSLGNVVNPDDVVE--KYGADLLRFYLLSANKVWE
SYI_METMP       VFDDTSYEKCMMHGFTLDETGEKMSKSLGNIVSPDDVTE--QYGADVLRFYLLSANKAWE
SYI_PYRFU       AFDTVPYRAVAMHGYVLDEKGDKMSKSLGNIIRPEEVVE--KAGRDTFRFYMLWATNPWE
SYI_PYRHO       AFDTVPYRRVAMHGYVLDEKGDKMSKSLGNIIRPEEVVE--KAGRDTFRFYMLWATNPWE
SYI_PYRAB       AFDTVPYRRVAMHGYVLDEKGDKMSKSLGNIIRPEEVVE--RAGRDTFRFYMLWATNPWE
SYI_THEKO       AFDTVPYRAVAMHGYVLDEKGDKMSKSLGNIIRPEEVVQ--KEGRDPFRFYMLWATNPWE
SYI_METTH       ALDEVPYRRVLMHGFTLDEEGRKMSKSLGNVVEPEDVIE--KYGADVLRFYLLWENKPWE
SYI_METTM       ALDETPYRRVLMHGFTLDEEGRKMSKSLGNVVEPEDVIE--KYGADVLRFYLLWANKPWE
SYI_METKA       TFDTCPYRTVLMHGFTLDEEGRKMSKSLGNVVDPMDVVE--KYGADTLRWYVLRSNAPWR
SYI_METAC       GFGRAPYKSVLMHGFTLDAGGKKMSKSLGNVVSPLDIID--RLGADTLRAYVLSSSAPWE
SYI_METMA       GFGRAPYKSVLMHGFTLDAGGKKMSKSLGNVISPLDIIG--RFGADTLRAYVLSSSAPWD
SYI_ARCFU       CFDKAPYKAVLMHGFTLDEQGRKMSKSLGNVVEPEEVVG--QIGVDGFRLYVLYS-APWE
SYI_HALMA       ATGEIPYKQVLMHGYANMPDGRGMSKSKGVLIDPHEVIE--KHGRDPMRLFLLSVTAQGE
SYI_NATPD       ALGEAPYETVLMHGWALAEDGRKMSKSIGNIVAPQEAID--RHGADPMRLFLLTQNPQGD
SYI_HALSA       ALGDVPYEEVLMHGYANMPDGRGMSKSKGITIEPNEVID--EYGADPMRMFLLSVTPQGD
SYI_PYRAE       YTGRAPYKNVLIQGLILDKHGQKMSKSKGNVIWAKDLFE--KYGADPVRLYILSKVAPWE
                             .      *    *                   *  *  .        

SYI2_BACAN      AKRFSERTVL---EAKSKFVDTLVNVYSFYVLYANLDEYNP-NETYDVKRT---------
SYI2_BACHK      AKRFSERTVL---EAKSKFVDTLVNVYSFYVLYANLDEYNP-NETYDVKRT---------
SYI2_BACCZ      AKRFSERTVL---EAKSKFVDTLVNVYSFYVLYANLDEYNP-NETYDVKRT---------
SYI2_BACC1      AKRFSERTVL---EAKSKFVDTLVNVYSFYVLYANLDEYNP-DETYDVKRT---------
SYI2_BACCR      AKRFSERTVL---EAKSKFVDTLVNVYSFYVLYANLDEYNP-KETYDVKLT---------
SYI2_OCEIH      NKRFSKKTVS---QAKSKVIDTILNVYSFYSMYADIDKFNV-AEHATDAKT---------
SYI2_STAAU      NKRFSENIVA---QTKSKFIDTLDNIYKFYNMYNKIDHYNP-NNEITKSRN---------
SYI_CLOAB       PTRFSQEDVA---ETQRKFLSTLWNVYSFYVLYAEIDKFNPNDYKDFVSGN---------
SYI_CLOTE       PTRFSPEDVE---ETQRKFLSTLWNVYSFYVLYADIDKFNPLEYKDFVSEN---------
SYI_CLOPE       PTRFSIEDVA---ETQRKFLSTLWNVYSFYVLYAELDNFNPLDYKDFVSDN---------
SYI_THEAC       SKNLDKKVID---EVSRKTLMTVLNVYSFFAYNANIDNFQW--NGLQLSGN---------
SYI_THEVO       SKNLDRKIID---EVSRRVISTLLNVYSFFAYNANIDGFEF--KGILEAKD---------
SYI_PICTO       SKSVNKKLIG---EITRKNLSTLLNVYSFFASNANIDEYRF--TEIKEPEN---------
SYI_EHRRG       GDLLLDKDGVMVRDVIRNVIKPMWNSYNFFTIYADIDK-----VSARVISDLDE------
SYI_EHRRW       GDLLLDKDGVMVRDVIRNVIKPMWNSYNFFTIYADIDK-----VNARVISDLDE------
SYI_EHRCJ       GDLLLDKEGVMIKDVLRNVIKPIWNSYNFFTIYANIDH-----ITAEIITELNE------
SYI_ANAMM       GDLLLDQDGDVVRDTLKSVVKPIWNSYSFFTVYANSDQ-----MQGRILESLEG------
SYI_RICCN       QELLIDKDGKMVFDTLRLFIKPIWNAYHFFTMYANADS-----LKGKLNFSSK-------
SYI_RICFE       QELLIDKDGKMVFDTLRLFIKPIWNAYHFFTMYANADS-----LKGELNFASQ-------
SYI_RICPR       QELLIDKDGKMVFDTLRLFIKPIWNAYHFFTIYANADS-----LKGTLNFASQ-------
SYI_RICTY       QELLIDKDGKMIFDTLRLFIKPIWNAYHFFTIYANADA-----LKGTLNFTSQ-------
SYI_WOLPM       GNLLLDKEGNSIRDVLKNVIKPIWNSYHFFTMYANADG-----IKAEVCKDYQ-------
SYI_WOLTR       GNLFLNKEGSSIRDVLKNVMKPIWNSYHFFTMYANADG-----IKAEVCKDYK-------
SYI_COREF       GNLIVTEKG--IREGVRQAQLPMWNAYSFLQLYASKKA------TWSVDSTDV-------
SYI_CORGL       GNLIVTEKG--IREGVRQAQLPMWNAYSFLQLYTSKNA------TWSVDSTDV-------
SYI_CORDI       GNLIVTEQG--IREGVRQALLPMWNAYSFLQLYSSKPA------QWSVDSSDV-------
SYI_CORJK       GNLIVTEQG--IREGVRQAMLPMWNAYSFLRLYASQPA------QYDTSSTNV-------
SYI_MYCBO       GNLIVTEQG--IRDGVRQVLLPLWNTYSFLALYAPKVG------TWRVDSVHV-------
SYI_MYCTU       GNLIVTEQG--IRDGVRQVLLPLWNTYSFLALYAPKVG------TWRVDSVHV-------
SYI_MYCPA       GNLIVTEQG--IRDGVRQVLLPFWNAYSFLALYAPKIG------TWRTDSPQV-------
SYI_MYCLE       GNLIITEPG--IREGMRQVLLPLWNAYSFLALYAPKIG------TWHTDVSHV-------
SYI_NOCFA       GNLIVTERG--IREGVSHALRPLWNAWTFLQLYASKPG------EWRTDSTHV-------
SYI_LEIXX       GNLVVTEEG--VREGVRQVLLPLWNTWYFFSLYANATGY---EAKRSTASAAV-------
SYI_TROW8       GSLIVSRKK--IQDAIRQYITPLWSSWYFFHIYSEAARPGGYKARFSVDSQDI-------
SYI_TROWT       GSLIVSRKK--IQDAIRQYITPLWSSWYFFHIYSEAARPGGYKARFSVDSQDI-------
SYI_BIFLO       GNLIVTADG--IRDTVRQVMLPVWSSYYFFTLYANAANGGAGFDARQLRADEVA------
SYI2_PSEFL      EDIKFSEES--VRDVVRRYHLLFWNCLQFYKTFTEIDQFS------PSGDLGQP------
SYI_CHLAB       EDLRFSDKG--VESVLKQVLLPLTNVLSFFKTYTDLYGFDANNYDKEEISY---------
SYI_CHLCV       EDLRFSDKG--VESILKQILLPLTNVLSFFKTYTDLYGFDADNYDKEEITY---------
SYI_CHLPN       EDLRFSDKG--IEGVLKQILLPLTNVLSFFNTYAELYGFDPKSQD-IEPAY---------
SYI_CHLMU       EDLRFSDKG--VEAVLKQVLLPLSNALAFYKTYAELYGFSP--NETTDLEL---------
SYI_CHLTR       EDLRFSDKG--VESVLKQVLLPLSNALAFYKTYAELYGFDP--KETDNIEL---------
SYI_PARUW       DDLSFSKSG--VELVLRQILLPLWNAYTFFLTYARIYNWKP--GKLVQKPE---------
SYI_BDEBA       QELKFSEKG--VYDIVRKILLRWWNSYSFFANYANIDGFVP--KGDAKKSP---------
SYI_BORBU       DDLKYSDNG--VRDVLKNIIIPIWNAYSFFTTYAIIDKFKPPKNLSLAK-----------
SYI_BORBP       DDLKYSDNG--VRDVLKNIIIPIWNAYSFFTTYAIIDKFKPTKNLSLVK-----------
SYI_TREDE       DDLKYSDEG--VRDVLKGILIPFWNSYSFYITYANIDGVKPPHNAKVDGKDEGVE-----
SYI_TREPA       DDLKYSDEG--VKDILKTVIIPLWNSYSFYVTYANIDGIDPPVCAKVDGMGQAVT-----
SYI_DEHM1       ARRFSEKLVG---EVTRQFLLMLWNVYSFFVTYANI----DSFTPSE-------------
SYI_DEHMC       ARRFSEKLVG---EVTRQFLLMLWNIYSFFVTYANI----DNFTPSE-------------
SYI_THET2       DRRFGPNLVR---ETVRDYFLTLWNVYSFFVTYANL----DRPDLKN-------------
SYI_THET8       DRRFGPNLVR---ETVRDYFLTLWNVYSFFVTYANL----DRPDLKN-------------
SYI_DEIRA       QKRFSERLVA---EAQRSYVNTLWNVYSFFVLYANL----DQPDLAA-------------
SYI_STRAW       ARRVGHGTIQ---EVVRKTLLTYWNTVAFQALYART-SGWAPSEADP-------------
SYI_STRCO       ARRVGHGTIQ---EVVRKTLLTYWNTVAFQALYART-TGWAPSEADP-------------
SYI_THEFY       PRRVGHTVLE---EIVRKVLLTYYNSASFFTLYAGAGDGWSHEQLAD-------------
SYI_CUTAK       ARRVGDETIQ---ETVRKVLLTYWNTVSFQVLYARA-NGWSPAQGTQHDADPARGFGGVV
SYI_BACFN       NLKFDVDGIE---EVRRKFFGTLYNTYSFFALYANV----DGFEYKE-------------
SYI_BACFR       NLKFDVDGIE---EVRRKFFGTLYNTYSFFALYANV----DGFEYKE-------------
SYI_BACTN       NLKFDIDGIE---EVRRKFFGTLYNTYSFFALYANV----DGFEYKE-------------
SYI_PORGI       NLKFDTDGVE---EVRRKFFGTLYNTYQFFALYANL----DGFTGEE-------------
SYI_CHLTE       PKLFNAAEIE---EEQRKFFRAFINSYNFFVLYANV----DGFRYEE-------------
SYI_SULAC       DAKFSWKSLD----MTRRDLNIIWNVYVFANTYMSLDEFKYSKY--------SYNDIK--
SYI_SULTO       DAKFSWKALD----QTKRDLNIIWNVYVFASTYMNLDNFDPRIY--------NLDNLK--
SYI_AERPE       DLRFSWKGLD----LMRRDFNVIWNVYAFASIYMGLDRFDPRRT--------SLSSVE--
SYI_METJA       DLRFVWSEMD----DVLSLFNTLWNAYMFAVNYMVLDNFKPDEK--------YFE-----
SYI_METMP       DLRFSYSEMD----ETRSMLNTLWNSYAFSANYMVLDDFVPNNE--------YFK-----
SYI_PYRFU       NLKFSWKGVE----QVRRMLNILWNVYVLSATYMSLDNFDPRNV--------KVEEL---
SYI_PYRHO       NLKFSWKGVE----QVRRMLNILWNVYVLSATYMSLDNFDPRNV--------KVEEL---
SYI_PYRAB       NLKFSWKGVE----QVRRMLNILWNVYVLASTYMSLDNFDPRKL--------NPDEL---
SYI_THEKO       NLRFSWKGLE----QVKRMLNILWNVYVLSATYMSLDNFNPTKV--------NPEEL---
SYI_METTH       DLKFVWDELR----NVNKMFNILWNVYVFATTYMSLDRFQPGDH--------SAEDL---
SYI_METTM       DLKFVWDELK----NVNKMFNILWNVYVFATTYMSLDRFQPGDH--------ELEDL---
SYI_METKA       DMHFSWQDVR----DTHRALNVLWNAYRFTKMYSELDEFDPEEH--------PLEDLE--
SYI_METAC       DLKYNLEEVE----TVHRSINILWNVFRFPLPYMALDNFDPMQV--------SLDSVK--
SYI_METMA       DLKFNLEEVE----TIHRSINILWNVFRFPLPYMALDNFDPMQV--------SLDSVR--
SYI_ARCFU       DLRFSWEEAR----NINRMLNVVWNAVRFAHTYMSLDNYSFGE--------------K--
SYI_HALMA       DMNFSWEETA----EMQRRLNILWNVARFPLPYMRADDFDP--------EETTVEDLR--
SYI_NATPD       DMRFSWDEME----NRQRDLNILWNVFRFPLPYMRLDDFDP--------DAVALDE----
SYI_HALSA       DMSFSWDETE----NMQRDLNILWNVFRFPRPYMALDDFDANVPAAFGGDDAGVGIAD--
SYI_PYRAE       DLSFDPDEVK----YVIGDLNILWNVVKFADTYMSLDGFDAEKY--------PLSQWL--
                                        .   :                               

SYI2_BACAN      ---------------------KLDEWVLSRLHSTTKKVRTALDD---------YQFTNAA
SYI2_BACHK      ---------------------KLDEWVLSRLHSTTKKVRTALDD---------YQFTNAA
SYI2_BACCZ      ---------------------KLDEWVLSRLHSTTKKVRIALDD---------YQFTNAA
SYI2_BACC1      ---------------------KLDEWVLSRLHSTTKKVRTALDD---------YQFTNAA
SYI2_BACCR      ---------------------KLDEWVLSRLHSTTKKVRTALDD---------YQFTNAA
SYI2_OCEIH      ---------------------TLDSWILSRLNSVIKEVTTSLDQ---------YDITKGA
SYI2_STAAU      ---------------------TLDNWALSRLNTLIKESNIYVNN---------YDFTSAA
SYI_CLOAB       ---------------------VMDKWIVSRLNTLTKDVGNYLDS---------YGITQAA
SYI_CLOTE       ---------------------VMDKWIVSKLNSLIKDVEDHMDS---------YRITQAA
SYI_CLOPE       ---------------------VMDKWIMSKLNTLVKDVDDHLNN---------YRITQAA
SYI_THEAC       ---------------------ALDRYMVSKVNSFVRSSRDAYES---------LDFHEVV
SYI_THEVO       ---------------------TLDKWLISKINTFIIESRRAYDD---------LDFHEVV
SYI_PICTO       ---------------------LLDRWMLSRLNTTIIKVRENMDN---------YNIHTAL
SYI_EHRRG       ------------------VDNIMDKYIMCECISTIQSIFNAMEEFDQSVGNYGYNIKAAC
SYI_EHRRW       ------------------VDNIMDKYIMCECISTIQSIFNAMEEFDQSVGNYGYNIKAAC
SYI_EHRCJ       ------------------LSNIMDRYIICECINTIHSIFNAMEELDQCSNNLGYNIKLAC
SYI_ANAMM       ------------------ITNIMDQYILYECACMVVKVLEAMESSSAGVRD-PYNIRLAC
SYI_RICCN       --------------------NVLDVYILSKLKIAVQKIEESLDN---------FDTQTAY
SYI_RICFE       --------------------NVLDIYILSKLKIAVNKIEESLDN---------FDTQTAY
SYI_RICPR       --------------------NVLDVYILSKLKIAVNKIEESLDN---------FDTQTAY
SYI_RICTY       --------------------NVLDIYILSKLKIAVNKIEESLDN---------FDTQTAY
SYI_WOLPM       --------------------STIDRYMISKCFEAVESIQASMNS---------YSSQEAC
SYI_WOLTR       --------------------STIDSYMIFKCFEAVESIQASMSN---------YNSQEAC
SYI_COREF       ----------------------LDRYILAKLHDLVADVTAALDA---------TDIARAC
SYI_CORGL       ----------------------LDRYILAKLHDLVAETQAALDG---------TDIAKAC
SYI_CORDI       ----------------------LDRYILAKLHDVVAAVGDALDN---------TDIARAC
SYI_CORJK       ----------------------LDRYILAKLRDTVQGVSDALDN---------TDIATAC
SYI_MYCBO       ----------------------LDRYILAKLAVLRDDLSESMEV---------YDIPGAC
SYI_MYCTU       ----------------------LDRYILAKLAVLRDDLSESMEV---------YDIPGAC
SYI_MYCPA       ----------------------LDRYILAKLAELRDDLTREMDA---------CDISRAC
SYI_MYCLE       ----------------------LDRYILAKLAVLRDDLSQAMEV---------CDISGAC
SYI_NOCFA       ----------------------LDRYILAKLAQTRDGMTEALEV---------YDIAGAC
SYI_LEIXX       ----------------------LDRYLLAKTRDLVEAVTADLDA---------LDSTLAS
SYI_TROW8       ----------------------LDRYILSKTGLLVEDVTRFMDS---------FDMASAA
SYI_TROWT       ----------------------LDRYILSKTGLLVEDVTRFMDS---------FDMASAA
SYI_BIFLO       ------------------GLPEMDRYLLARTRRLVLAAEKSLNE---------FAISDAC
SYI2_PSEFL      ------------------LDNVLDHYLLHELAALESDIKMWMES---------LDFSKIY
SYI_CHLAB       --------------------SEIDRWILSNLYTVVGKVRESMSS---------YNLNTAV
SYI_CHLCV       --------------------SEIDRWILSNLYTVVGKVRESMSS---------YNLNTAV
SYI_CHLPN       --------------------TEIDQWILSNLYSVVGKVRESMSQ---------YHLNFAV
SYI_CHLMU       --------------------AEIDRWILSSLYSLVGKTRENMAQ---------YDLHAAV
SYI_CHLTR       --------------------AEIDRWILSSLYSLVGKTRESMSQ---------YDLHAAV
SYI_PARUW       --------------------LAIDQWIISLLNKLVHEVEQGMDD---------YDLSRSV
SYI_BDEBA       --------------------NILDQWVLSRLNGLIANTHKEMDA---------YRLYNVV
SYI_BORBU       -------------------NNNLDKWIISELESLKKILNTEIDK---------YNLTKSI
SYI_BORBP       -------------------SNNLDKWIISELESLKKILNKEIDK---------YNLTKSI
SYI_TREDE       -------------EFLAKLNNPLDLWILSVTEKLVADVTEALDK---------YDLSQAI
SYI_TREPA       -------------RLATHLNNPLDRWILSLTEKLVQDIACALDA---------YDVSKVA
SYI_DEHM1       -------------KYLEGEVPELDRWILSELNQLVLDVDKGLDN---------YDPTQAG
SYI_DEHMC       -------------KYLAGEVPELDRWILSELNQLVLDVDKGLDN---------YDPTQAG
SYI_THET2       -------------PPPPEKRPEMDRWLLARMQDLIQRVTEALEA---------YDPTTSA
SYI_THET8       -------------PPPPEKRPEMDRWLLARMQDLIQRVTEALEA---------YDPTTSA
SYI_DEIRA       -------------APAVAERPEMDRWLLARLEETVRDVTAALES---------YDARSGG
SYI_STRAW       -------------APA--DRPVLDRWLLSELHALTDQVTQALES---------YDTQRAG
SYI_STRCO       -------------APA--DRPVLDRWLLSELHALTDQVTQALDA---------YDTQRAG
SYI_THEFY       -------------APAPQDRPLLDRWILSELHSLIKTVDDALER---------FDTALAG
SYI_CUTAK       PPAVGSRGFGGVVPPAVTERHVLDRWLVSATNVLVRDVTEALNN---------FDTQRVG
SYI_BACFN       ------------ADLPMNERPEIDRWILSVLNTLVKEVDTCYNE---------YEPTKAG
SYI_BACFR       ------------ADLPMNERPEIDRWILSVLNTLVKEVDTCYNE---------YEPTKAG
SYI_BACTN       ------------ADVPMAERPEIDRWILSVLNTLIKEVDTCYNE---------YEPTKAG
SYI_PORGI       ------------ESIPFAKRPEIDRWILSELNTLIREVDDQLSD---------YEPTRAG
SYI_CHLTE       ------------ADIPFTQRSELDRWVLSSLNTLIAEVTSRMEQ---------YDLTGAC
SYI_SULAC       -----------------DYLKLEDIWLLSRYYRMLKEVIEAMKE---------YKVHELA
SYI_SULTO       -----------------QYLRIEDLWLLSRYNRVVKEVKESMND---------FKVHELA
SYI_AERPE       -----------------DSLEVEDRWILSRLASLKRRYLTAMED---------LRIHDAA
SYI_METJA       ------------------YLKDEDRWIVSRINSVAKIAIENLEV---------PYFHTYT
SYI_METMP       ------------------HVKDEDAWILSRINTVAKEAVEALEK---------PHLHVYT
SYI_PYRFU       ------------------EFREEDKWILSRVNNLIKEVENGIET---------FYLTKAT
SYI_PYRHO       ------------------AFREEDKWILSRVNSLIREVENGIET---------FYLTKAT
SYI_PYRAB       ------------------PFREEDKWILSRVNSLISEVENGIES---------FYLTKAT
SYI_THEKO       ------------------PFREEDRWILSRVNSLIGEVTDGIET---------FRLTRAT
SYI_METTH       ------------------SFRDEDRWILSRINSVALKVTEAIEN---------LHFHRAT
SYI_METTM       ------------------HFRDEDRWIISRVNSVALKVTEALDN---------LHFHRAT
SYI_METKA       -----------------EHLKPEDRWLLSRINSLVEEVTDAFER---------YHVHEAA
SYI_METAC       -----------------DALREEDRWILSRAQSVIKAVNEAMSG---------YLLHKAV
SYI_METMA       -----------------DALREEDRWILSRAQSVVKSVDEAMSG---------YLLHKAV
SYI_ARCFU       -----------------GELKIEDRWILSRLESFIKEANEAMEG---------YQVHRVV
SYI_HALMA       -----------------DDLELVDEWVLSRLQSVTEAMTDSMDD---------FENDKAV
SYI_NATPD       -----------------AALETVDEWVLSRLSTVTAEMTDHWEN---------FRQDKAL
SYI_HALSA       -----------------ADLETVDEWLLSRLQHVKADATAHWED---------FEQHRAL
SYI_PYRAE       -----------------EKGLEEDKWILSELNIMISEFTNFVKN---------FEFHKAA
                                       * : :                                

SYI2_BACAN      REIAALV-DEVSNWYVRRSRNRFWES-GMNAEKAAAYETLHDVLVTISKLIAPFTPFVAE
SYI2_BACHK      REIAALV-DEVSNWYVRRSRNRFWES-GMNAEKAAAYETLHDVLVTISKLIAPFTPFVAE
SYI2_BACCZ      REIAALV-DEVSNWYVRRSRNRFWES-GMNAEKAAAYETLHDVLVTISKLIAPFTPFVAE
SYI2_BACC1      REIATLV-DEVSNWYVRRSRNRFWES-GMNAEKAAAYETLHEVLVTISKLIAPFTPFVAE
SYI2_BACCR      REIAALV-DEVSNWYVRRSRNRFWES-GMNAEKAAAYETLHEVLVTISKLIAPFTPFVAE
SYI2_OCEIH      RSIALFV-DELSNWYVRRSRQRFWSS-GMNEDKKAAFTTLHEVLSKLTQLMAPYIPFVAD
SYI2_STAAU      RLINEYT-NTISNWYIGDSRGRFWEQ-GISNDKKDAYNTLYEILTTLSRLVAPFVPFISE
SYI_CLOAB       LEIQDFV-DDLSNWYVRRNRSRYWTQ-ELTDDKVGAYVTLYRVLVTLSKVAAPFIPFMTE
SYI_CLOTE       LAIEDFV-DELSNWYVRRNRSRFWSE-ELREDKIGAYVTLYKVLTTVSLIAAPFVPFITE
SYI_CLOPE       LEIEEFT-DELSNWYVRRNRARYWSE-ELTDDKIGAYTTLYRVLVTLCKVAAPFVPFITE
SYI_THEAC       RASMEFV-DDLSNFYLRLSRRRFWAE-GFDDDKLSAYSTLYYALKAFSEVMAPITPFFSD
SYI_THEVO       RLSMDFV-DNLSNFYLRLSRRRFWAE-DVTEDKLAAYSTLYTAIMTCSKVLAPIVPFVSD
SYI_PICTO       RYIEDLI-SELSNVYLRLSRKRFWEG-NLDDSKERAYSTLYYTLRETIKMMAPITPFFSE
SYI_EHRRG       NSIVQFF-EVLNNWYIRRCRSRFWSS-EITKDKVNAYNTLYTVMYYMVKVSAPFLPAITE
SYI_EHRRW       NSIVQFF-EVLNNWYIRRCRSRFWSS-EITKDKVNAYNTLYTVMYYMVKVSAPFLPAITE
SYI_EHRCJ       NNITKFF-EILNNWYIRRCRSRFWSS-EITQDKQDAYNTLYTVIYYMIKVSAPFLPIITE
SYI_ANAMM       AAIVQFS-DKLNNWYIRGCRGRFWMR-DKTADKSDAYNTLYTVLYHLARTIAPFLPFIAE
SYI_RICCN       HAVSAFF-EVLNNWYIRRSRARFWKS-AKDTDKQNAYNTLYSCLDTMAIAMSALVPMISE
SYI_RICFE       HAVSEFF-EVLNNWYIRRSRARFWKS-EKDADKQNAYNTLYSCLETMAIAMSALVPMISE
SYI_RICPR       HAVSEFF-EVLNNWYIRRSRARFWKN-EKDTDKQNAYNTLYSCLKIMTIAMSALIPMISE
SYI_RICTY       HAVSEFF-EVLNNWYIRRSRARFWKK-EKDTDKQNAYNTLYSCLETMTIAMSALVPMISE
SYI_WOLPM       KILIDFF-EVLNNWYIRRSRERFWKS-DLDQDKTDAYNVLYTVFYYILRAAAPLLPLITE
SYI_WOLTR       KILIDFF-EVLNNWYIRRSRERFWKS-NLDQDKTDAYNVLYTVFYYILRAAVPLLPLITE
SYI_COREF       DQVRWFC-DALTNWYVRRSRDRFWA---GDEAHPEAFNTLYTVLETLTRVAAPLLPMTTE
SYI_CORGL       DLVRNFC-DALTNWYVRRSRDRFWA---GDEAHPEAFNTLYTVLETLTRVAAPLLPMTTE
SYI_CORDI       DEVRTFC-DALTNWYVRRSRDRFWA---GDTEHPEAFYTLYTVLETLTRVTAPLLPMVSE
SYI_CORJK       DEIRWFC-DALTNWYVRRSRDRFWA---GDAVHPEAFNTLYTVLETLCRAAAPLLPMTTE
SYI_MYCBO       EHLRQFT-EALTNWYVRRSRSRFWA---EDA---DAIDTLHTVLEVTTRLAAPLLPLITE
SYI_MYCTU       EHLRQFT-EALTNWYVRRSRSRFWA---EDA---DAIDTLHTVLEVTTRLAAPLLPLITE
SYI_MYCPA       EQLRQFT-EALTNWYVRRSRSRFWS---EDA---DAIDTLHTVLEVTARLAAPLLPSVTE
SYI_MYCLE       EQLRQFT-EPLTNWYLRRSRARFWD---EDV---DAIDTLHTVLEVTARLAAPLLPLITE
SYI_NOCFA       EELRTFA-DALTNWYVRRSRSRFWS---EDR---DAVDTLHTVLEVATRLAAPLLPLISE
SYI_LEIXX       AKLRDFA-DLLTNWYVRRSRDRFWAGVDGEGAGAEAFDTLYTVLETLTRVAAPLLPLVTE
SYI_TROW8       LQLRDFV-AVLTNWYIRRSRDRFWD---GSD--TGAFDTLYTVLETLCRLGAVFVPMVSE
SYI_TROWT       LQLRDFV-AVLTNWYIRRSRDRFWD---GSD--TGAFDTLYTVLETLCRLGAVFVPMVSE
SYI_BIFLO       DAVSDFI-DVLTNWYIRNTRDRFWN---EDA---SAFNTLYTVLEAFMRVLAPLAPMEAE
SYI2_PSEFL      SRIEVFI-NVLSTWYLRLNKARIWRD-GLDDDKRQCYEVLHYALSNFARLLAPFMPFLAE
SYI_CHLAB       NPFVTFI-DDLTNWYIRRCRRRFWES-ADTPDRRAAFATLYEVLTVFCRVIAPFIPFISE
SYI_CHLCV       NPFVTFI-DDLTNWYIRRCRRRFWES-EDTPDRRAAFATLYEVLTVFCRVIAPFIPFISE
SYI_CHLPN       EPFVTFI-DDLTNWYIRRCRRRFWEA-EDTPDRRAAFSTLYEVLTVFCKVIAPFVPFLAE
SYI_CHLMU       SPFIDFI-EDLTNWYIRRSRRRFWES-EDSPDRRAAFATLYEVLMVFSKIIAPFIPFTAE
SYI_CHLTR       NPFVDFI-EDLTNWYIRRSRRRFWDA-EDSADRRAAFSTLYEVLVVFSKVIAPFIPFIAE
SYI_PARUW       EPFVNFV-DQLTNWYIRRSRRRFWDD-KESPNRTQAFETLYYVLIELTKISAPYVPFISE
SYI_BDEBA       PHLLQFI-EDLTNTYIRFNRSLFWQD-GMPETKRYAYETLHEVLVTLSRLMAPFAPFMSE
SYI_BORBU       ESLLEFI-DKLNNWYIRRSRRRFWKS-ENDKDKNDAYETLYYAIKTLMILLAPFIPFITE
SYI_BORBP       ESLLEFI-DKLNNWYIRRSRRRFWKS-ENDKDKNDAYETLYYAIKTLMILLAPFIPFITE
SYI_TREDE       PPMVEYI-DLLNNWYIRRSRRRFWKS-ENDGDKSQAYETLYRALKKFSLVAAPVVPFITE
SYI_TREPA       DPIVSYV-DQLNNWYIRRSRRRFWKS-INDEDKRCAYNTLYCVLKRCVLAIAPVVPFITE
SYI_DEHM1       RRIEDFV-GYLSNWYVRRSRRRFWKS-ENDADKLSAYQALYTCLVTLSRLLAPFTPFVAE
SYI_DEHMC       RRIEDFV-GYLSNWYVRRSRRRFWKS-ENDADKLSAYQALYTCLVTLSKLLAPFTPFVAE
SYI_THET2       RALRDFVVEDLSQWYVRRNRRRFWKN-EDALDREAAYATLYEALVLVATLAAPFTPFLAE
SYI_THET8       RALRDFVVEDLSQWYVRRNRRRFWKN-EDALDREAAYATLYEALVLVATLAAPFTPFLAE
SYI_DEIRA       RALEGFV-DDLSNWYVRRSRSRFWG--EGGTVDTAAYATLHEALLVVSQLTAPFTPFLAD
SYI_STRAW       KLLSAFV-DDLSNWYVRRSRRRFWQG------DKAALRTLHEVVETVTRLMAPLTPFITE
SYI_STRCO       KLLSAFV-DDLSNWYVRRSRRRFWQG------DKAALRTLHEVVETVTKLMAPLTPFITE
SYI_THEFY       RALTTFI-DDLSNWYVRRSRRRFWAG-AGTPEGAAAFATLFECLETLTLLMAPIVPFITD
SYI_CUTAK       NLIAQFV-DELSNWYVRRSRRRFWDG------DEGALWTLHETLETLTKLMAPMVPFITE
SYI_BACFN       RLISDFVNDNLSNWYVRLNRKRFWGG-GFTQDKLSAYQTLYTCLETVAKLMAPIAPFYAD
SYI_BACFR       RLISDFVNDNLSNWYVRLNRKRFWGG-GFTQDKLSAYQTLYTCLETVAKLMAPIAPFYAD
SYI_BACTN       RLISDFVNDNLSNWYVRLNRKRFWGG-EFTQDKLSAYQTLYTCLETVAKLMAPISPFYAD
SYI_PORGI       RAISDFVSENLSNWYVRLSRRRFWAG-DMTEDKLSAYQTLYTSLLTVSKLMAPISPFYAD
SYI_CHLTE       RLIGDFTVDDLSNWYIRRSRKRFWKG-EMGPDKLSAYQTLSTVLETLAKLMAPFVPFIAE
SYI_SULAC       NKVTAFIIDDISRFYLRVTRKRAWNE-ANDPDKIAMYYVLYHVLKGSLILLSTVIPFTAE
SYI_SULTO       NKMTSFIIDDISRFYLRLVRKRAWNE-SNDPDKIAMYYVLYEVLKGSLVLLSPVIPFTTE
SYI_AERPE       RALRSFIIEDVSHWYLRIIRRRVWEE-VDTPSKRAAYATLYKVLWEWLLMAAPLIPYTAE
SYI_METJA       WTLKDFILNDLSRWYIRLIRDRTWKE-KDDADKLAAYQTLYYVLLKLATILAPVAPHTAE
SYI_METMP       WALRDFILNDFSRWYIKLIRDRTWME-KNDVQKLSAYQTLYYVIMKLISIMAPVTPHLSE
SYI_PYRFU       RALYNFVVEDLSRWYVRLIRKRLWVE-GDDPDKLAAYYTLWKVFDVLLRLMAPFTPYITE
SYI_PYRHO       RALYNFVVEDLSRWYVRLIRKRLWVE-GDDPDKLAAYYTLWKVFDVLLRLMAPFTPYITE
SYI_PYRAB       RALYNFVVEDLSRWYVRLIRKRLWVE-GEDPDKLAAYYTLWKVFDVLLRLLAPFTPYIAE
SYI_THEKO       RGIYNFVVEDLSRWYIRLIRKRMWVE-GDDPDKLAAYYTVWKVFDVLLRLMAPFTPYIAE
SYI_METTH       REIHDFIVEDLSRWYIRLIRSRTWIE-RDDPDKLAAYHTLYTVLKTLIVTLSPMAPHVCE
SYI_METTM       REIHDFIVEDLSRWYIRLIRSRTWIE-RDDPDKLAAYHSLYTALKTLIVTLSPIAPHVCE
SYI_METKA       RALYRFVTEDLSRWYIRLVRERVWLE-GDDPEKLAVYAVLHYTFDRLVRLLAPIVPHVAE
SYI_METAC       REILEFALEDLSRWYIQLIRPRTWTE-ADDPDKLAAYCVLYEVYVTITKLISPFMPYLAE
SYI_METMA       REILDFTLEDLSRWYIQLIRPRTWTE-ADDPDKLAAYCVLYEVYVTITKLISPFMPYLAE
SYI_ARCFU       RAFFDFFVEDFSRWYIQIIRPRVWEE-RDSPSKLAAYYTMFRVIDRSLRAIAPFAPLIAE
SYI_HALMA       DELLEFVVEDVSRFYIQVVRERMWEE-EDSASKQAAYATLYRVLESVAALFAPFTPFVAE
SYI_NATPD       DELLAFIVEDVSRFYIQVVRERMWEE-ETSESKLAAYATLHHVLVETTKLLAPYAPFVAE
SYI_HALSA       DAVLEFVVEDLSRYYVQVVRERMWED-DASASKTAAYATMQRVLLEVVALLAPYAPFVTE
SYI_PYRAE       ALWREFVVETLSHRYIRLLRRRVWSE-EPSPDKYAAYAVLHDVLKKVLILGSILVPFITE
                          ..  *:   :   *               :               *   :

SYI2_BACAN      DVHLNLTG----------------------------------------------SSVHLE
SYI2_BACHK      DIHLNLTG----------------------------------------------SSVHLE
SYI2_BACCZ      DIHLNLTG----------------------------------------------SSVHLE
SYI2_BACC1      DIHLNLTG----------------------------------------------SSVHLE
SYI2_BACCR      DIHLNLEG----------------------------------------------SSVHLA
SYI2_OCEIH      DIYTNLQG----------------------------------------------DSVHVS
SYI2_STAAU      KIHYNLTG----------------------------------------------KSVHLQ
SYI_CLOAB       QIYQSLVTSINE---------------------------------------GAEESVHLC
SYI_CLOTE       EIYNNLVRGLDK---------------------------------------NALESIHLC
SYI_CLOPE       EIYQNLVVNLDE---------------------------------------NALESIHLG
SYI_THEAC       FIYLNLGGDK--------------------------------------------ESVHLE
SYI_THEVO       YLYLSLHGPY--------------------------------------------ESIHLD
SYI_PICTO       YLYQKLSPGM--------------------------------------------PSVHME
SYI_EHRRG       AIWQKLNFQ-------------------------------------------EEESVHLS
SYI_EHRRW       AIWQKLNFQ-------------------------------------------EEESVHLS
SYI_EHRCJ       AIWQRLNFQ-------------------------------------------KEESVHLS
SYI_ANAMM       SIWLGLSFQ-------------------------------------------REKSVHLA
SYI_RICCN       AIYKGLRHCEERNDTALSGKSNIIARKDTSLDKAISGVSHKIATALSVPRND-AISVHLC
SYI_RICFE       AIYLGLCHK----------RPDVIARKDLSLDEAISGNSHEIATALSVPRNDGSISVHLC
SYI_RICPR       TIYQGLHNT-----------------AITQLNCLLSEGKHIVQNPMSD-TQDYNTSVHLC
SYI_RICTY       AIYQGLHNT-----------------AITQLNCLLLEGKHVVQNPMSG-TQDYNTSVHLC
SYI_WOLPM       NIWQGLKYE--------------------------------------------ETSVHLA
SYI_WOLTR       TIWQGLKYK--------------------------------------------EISVHLA
SYI_COREF       VIWRGLTGE---------------------------------------------RSVHLT
SYI_CORGL       VIWRGLTGE---------------------------------------------RSVHLT
SYI_CORDI       VIWRGLTGE---------------------------------------------RSVHLA
SYI_CORJK       VIWRGLTGE---------------------------------------------RSVHLA
SYI_MYCBO       IIWRGLTRE---------------------------------------------RSVHLT
SYI_MYCTU       IIWRGLTRE---------------------------------------------RSVHLT
SYI_MYCPA       LVWRGLTGG---------------------------------------------RSVHLT
SYI_MYCLE       IIWRSVTGG---------------------------------------------RSVHLT
SYI_NOCFA       VIWRGLTGG---------------------------------------------RSVHLA
SYI_LEIXX       RIWKDLTGG---------------------------------------------RSVHLT
SYI_TROW8       HVYKCLTNS---------------------------------------------RSVHLS
SYI_TROWT       HVYKCLTNS---------------------------------------------RSVHLS
SYI_BIFLO       SVWRGLTGG---------------------------------------------ESVHLA
SYI2_PSEFL      AVYTELGYA---------------------------------------------DSVHLQ
SYI_CHLAB       DIYQQIKTENS------------------------------------------LESVHLC
SYI_CHLCV       DIYQQIKTEHS------------------------------------------AESVHLC
SYI_CHLPN       DIYQKLKLEKE------------------------------------------PESVHLC
SYI_CHLMU       DMYQQLRVETD------------------------------------------PESVHLC
SYI_CHLTR       DMYQQLRGETD------------------------------------------PESVHLC
SYI_PARUW       AIYQNLRSCDM------------------------------------------PESVHLC
SYI_BDEBA       VTYKNLAQVLKD----------------------------------------KKDSVHLE
SYI_BORBU       EIYQNLKTDED------------------------------------------KQSIHLN
SYI_BORBP       EIYQNLKTDED------------------------------------------KQSIHLN
SYI_TREDE       SIWQNLRTESD------------------------------------------ALSIHLA
SYI_TREPA       SIWQNIRAADD------------------------------------------VQSVHLA
SYI_DEHM1       ELYQNLVLSADP---------------------------------------SALESVHLT
SYI_DEHMC       ELYQNLVLLVDQ---------------------------------------SALESVHLT
SYI_THET2       VLWQNLVRSVRP---------------------------------------EAKESVHLA
SYI_THET8       VLWQNLVRSVRP---------------------------------------EAKESVHLA
SYI_DEIRA       ALYRNLSG--------------------------------------------EESSVHLT
SYI_STRAW       RVWQDLVFPVTP---------------------------------------GAPESVHLA
SYI_STRCO       RVWQDLVVPVTP---------------------------------------GAPESVHLS
SYI_THEFY       HVWQALR---RP---------------------------------------DAPESVHLA
SYI_CUTAK       RVWQDLFVTTNP---------------------------------------HGPESVHLA
SYI_BACFN       RLYSDLIGVTGR---------------------------------------DNVVSVHLA
SYI_BACFR       RLYSDLIGVTGR---------------------------------------DNVVSVHLA
SYI_BACTN       RLYTDLTTATGR---------------------------------------DNVVSIHLA
SYI_PORGI       RLYRDLTGKDE--------------------------------------------SVHLA
SYI_CHLTE       KIWLDLKSVGGT---------------------------------------SKAESVHLA
SYI_SULAC       KIYLDFVQERLE-------------------------------------------SISME
SYI_SULTO       RIYQDFVVDKKD-------------------------------------------SVSME
SYI_AERPE       YLYIKVFREAEE---------------------------------------RPEESIHML
SYI_METJA       AIYQNLKTE-------------------------------------------DMEESIFM
SYI_METMP       EIYQNLKTE-------------------------------------------DMPESIFM
SYI_PYRFU       EIYQNIMRPF-----------------------------------------TGIESVHML
SYI_PYRHO       EIYQNLMRPF-----------------------------------------IGIESVHML
SYI_PYRAB       EIYQNLIRPF-----------------------------------------TNVESVHML
SYI_THEKO       EIYQNLIRPF-----------------------------------------VGVESVHML
SYI_METTH       DIYQNLVRGAEP---------------------------------------DSPESIHML
SYI_METTM       DIYQNLVRGAEP---------------------------------------DSPESIHML
SYI_METKA       RIYLDYVRAG-----------------------------------------DDPESVHLT
SYI_METAC       EMYQNLIRNVDP---------------------------------------NAPESVHMC
SYI_METMA       EMYQNLIRNVDP---------------------------------------KAPESVHMC
SYI_ARCFU       WFYQHVVKEFR----------------------------------------EGEESIFME
SYI_HALMA       QVYGALTGDAG------------------------------------------HPTVHMC
SYI_NATPD       EIYGTLTGDGG------------------------------------------HETVHMA
SYI_HALSA       ELYSHLTGDRG------------------------------------------YDTVHMA
SYI_PYRAE       YLWQAYVRKYEK---------------------------------------NAPESVHLA
                                                                          . 

SYI2_BACAN      DYPVVNESLL------------QPKLEAEMDAVLQVVELGRSNRNQHSLKVKQPLAELVL
SYI2_BACHK      DYPVVNESLL------------QPKLEAEMDAVLQVVELGRSNRNQHSLKVKQPLAELVL
SYI2_BACCZ      DYPVVNESLL------------QPKLEAEMNAVLQVVELGRSNRNQHSLKVKQPLAELVL
SYI2_BACC1      DYPVVNESLL------------QPKLEAEMDAVLQVVELGRSNRNQHSLKVKQPLAELVL
SYI2_BACCR      DYPVVNESLL------------QPKLEAEMDAVLQVVELGRSNRNQHSLKVKQPLAELVL
SYI2_OCEIH      DFPKVDEAAI------------DEKLEADMQGVLEVIEGARSLRNEVNIKTKQPLAELVV
SYI2_STAAU      DYPQYKESFI------------NQALEDEMHTVIKIVELSRQARKNADLKIKQPLSKMVI
SYI_CLOAB       KWPEYDESLI------------DSSLEEEMKLAISIVKLGRSARNGANIKNRQPLYEMRV
SYI_CLOTE       NWPKYDENLI------------QKELEREMDEAYKIVKLGRSARNSVNIKNRQPLSSMLV
SYI_CLOPE       AWPEVDEKAI------------DKKLEEKMDLAYKIVKLGRSARNGANIKNRQPLSKMLL
SYI_THEAC       AFPEFDSTLM------------DEKLESEMDRAYSVIETVRRLRQENSIKGRQPLREILI
SYI_THEVO       SFPEPDTSKI------------DHDLEKRMDQAYSVIETVRRIRQEINIKGRQPVKEILL
SYI_PICTO       SYPEAIERFI------------DNDLENEMEHAIEIMELSRRTRQELNIKGRQPVKEILI
SYI_EHRRG       LLPNIEHITLK---------DEDQKNIQYMKLIINICGCVLSIRNVRNIRVRQPLNKITI
SYI_EHRRW       LLPNIEHITLK---------DEDQKNIQYMKLIINICGCVLSIRNVRNIRVRQPLNKITI
SYI_EHRCJ       SLPNISNFILN---------NEDKQNIQYMKLITCICNYVLSIRSTHNIRIRQPLNKIVI
SYI_ANAMM       DFPDASSFSAV---------HQYKKNAEYMQLAMDVCSHVLSLRNAHNIRVRQPLRRMVV
SYI_RICCN       NYPTLSDFEI------------NHELVATMDNVLDICSNSLFIRSTENIRVRQPLASIAI
SYI_RICFE       NYPNLSSFEI------------NHELVATMDNVLDICSNSLFIRSTENIRVRQPLATITI
SYI_RICPR       NYPTLSDFEI------------NYELVSTMDNVLDICSNSLFIRSTENIRVRQPLACITI
SYI_RICTY       NYPTLSDFEI------------NHELVSTMDNVLDICSNSLFIRSTKNIRVRQPLACITI
SYI_WOLPM       NFPQLEKFD--------------SQLIAKMDLVREVCNSALSIRNTFNIRIRQPLGSMII
SYI_WOLTR       DFPQLERYD--------------SELIAKMDLVREICNSALSIRNTFNIRVRQPLGSMTV
SYI_COREF       DFPSADS------------FPADADLVRTMDEIRGVCSAASSIRKAHKLRNRLPLPNLTV
SYI_CORGL       DFPSAES------------FPADADLVRTMDEIRGVCSAASSVRKAHKLRNRLPLPGLTV
SYI_CORDI       DFPQADQ------------FPADDDLVRAMDEVRGVCSATSSVRKAHKLRNRLPLPKVTV
SYI_CORJK       DFPKSEN------------LPADAELVTAMDAVRAVSSATSSLRKAHKLRNRLPLPKLTV
SYI_MYCBO       DWPAPDL------------LPSDADLVAAMDQVRDVCSAASSLRKAKKLRVRLPLPKLIV
SYI_MYCTU       DWPAPDL------------LPSDADLVAAMDQVRDVCSAASSLRKAKKLRVRLPLPKLIV
SYI_MYCPA       DWPRSGE------------LPADPGLVAAMDQVREVCSAASSLRKAKKLRVRLPLPKLTV
SYI_MYCLE       DWPQANQ------------LPADPDLVAVMDQVRQVCSAASSLRKAKKLRVRLPLPKLVV
SYI_NOCFA       DWPAAAD------------LPADPELVSTMDEVRTVCSTVLSLRKAKNLRVRLPLAEVTI
SYI_LEIXX       DWPDAAE------------LPADDALVAAMDRVRAISSTALSLRKQAGLRVRLPLASLTV
SYI_TROW8       DWPDVAT------------FPNETGLVETMDRVRKICSTGLSLRKRLGIKARQPLSSAHI
SYI_TROWT       DWPDVAT------------FPNETGLVETMDRVRKICSTGLSLRKRLGIKARQPLSSAHI
SYI_BIFLO       EWPFVVDEKTGADTELGRVLVDDPALVDAMEKVREVVSGTLSLRKAAKIRVRQPLSKLTV
SYI2_PSEFL      DWPSIDRQYL------------SYELADEMSSLRNLIASVRNVRETNGVSQKFPLRSIRV
SYI_CHLAB       DFPYIDLAKV------------FPDLEQRMGDAREIVGLGHSLRKEHKLKVRQPLANFYV
SYI_CHLCV       DFPHIDLAKV------------FPDLEQRMSDAREIVGLGHSLRKEHKLKVRQPLANFYI
SYI_CHLPN       DFPQVEMDKI------------LPDLEKRMHDIREIVGLGHSLRKEHKLKVRQPLANFYV
SYI_CHLMU       DFPHVVLEKI------------LPDLEKKMQDIREIVALGHSLRKEHKLKVRQPLQHMYI
SYI_CHLTR       DFPHVVLEKI------------LPDLERKMQDIREIVALGHSLRKEHKLKVRQPLQNVYI
SYI_PARUW       DFPHYQQLSR------------HEKLEAEMEAVQVTVSLGHALRKEHKLKVRQPLATAQL
SYI_BDEBA       SFPTADLSML------------RPELEEAVKAMDTLVTLGRNHREKIGVKAKIPLNEIKI
SYI_BORBU       DYPKANENFI------------NKTIEEKINLARKITSMARSLRSLHNIKIRMPISTIYI
SYI_BORBP       DYPKANENFI------------DKTIEEKINLARKITSMARSLRSLHNIKIRMPISTIYV
SYI_TREDE       DYPDYNEKIR------------NSELEFKMKTVQKAVSMGRALRYQFNLKIRQPLKAVEI
SYI_TREPA       DYPVCTPMVR------------DDALEFKMETVQRVVSMARAIRAQCNLKVRQPLKAMQV
SYI_DEHM1       DFPVADTALI------------DEQLDNEIRLVMKVSSMGRSARSKAALKVRQPLAEVRV
SYI_DEHMC       DFPVADKALI------------DEQLDNEIRLVMKVSSMGRSARSKAALKVRQPLAEVRV
SYI_THET2       DWPEADPALA------------DEALVAQMRAVLKVVDLARAARAKSGVKTRTPLPLLLV
SYI_THET8       DWPEADPALA------------DEALVAQMRAVLKVVDLARAARAKSGVKTRTPLPLLLV
SYI_DEIRA       PWPTVRAERL------------DRKLTADMAAVMKVVELGRAVRGAHNLKTRQPLAGVQV
SYI_STRAW       SWPEADLSAI------------DPELSKQMVLVRRLVELGRATRAESGVKTRQPLSRALV
SYI_STRCO       SWPEADLTAI------------DPELSKQMVLVRRLVELGRATRAESGVKTRQPLSRALI
SYI_THEFY       SWPKADESLI------------DPALSEQMALVRRLVELGRAARVDSGQRVRQPLARALV
SYI_CUTAK       SWPVADDSLI------------DESLSESMDLARRIVELGRGARAEAKAKIRQPLSRALI
SYI_BACFN       KFPEYNEKMV------------DKELEAQMQMAQDVTSMVLALRRKVNIKVRQPLQCIMI
SYI_BACFR       KFPEYNEKMV------------DKELEAQMQMAQDVTSMVLALRRKVNIKVRQPLQCIMI
SYI_BACTN       EFPKYQEEMI------------DKELEARMQMAQDVTSMVLALRRKVNIKVRQPLQCIMI
SYI_PORGI       LFPRPDQSQV------------DRALEQSMQMAQQISSMVLALRRRVNLKVRQPLATLMI
SYI_CHLTE       DWPVADESCI------------DAALEERMKKAQIITSLVRTMREKAGIKVRQPLRRILL
SYI_SULAC       KIPEIKEEFI------------NSEIEEAFEVAKEIIDAGLNARAKAGIKLRWPLKEVYV
SYI_SULTO       SLPEVKEEFI------------NDKIEKEFELSKEIAEAGLNARAKAGIKLRWPIKNAYV
SYI_AERPE       DMPEPEDHLI------------DSTLEEDMEKARMVLEAILSARNEAGLKLRRPVRRVII
SYI_METJA       NKIEVDEEFI------------DEELERDMAIVRDVVDAIYRGRDRIKYTLRYPLKEITI
SYI_METMP       NKLTIESEFI------------NETLEKDTEIIREIVDSILKGRDKAKYTLRYPITKITL
SYI_PYRFU       DWPKPDESAV------------DEELEREMEFIRRIVEAGSAARQKAKIKLRYPVRKIII
SYI_PYRHO       DWPKVDESAV------------DEDLEKEMEFIRRIVEAGSAARQKARIKLRYPVRKIII
SYI_PYRAB       DWPKVDEKAI------------DEELEREMEFIRRIVEAGSAARQRAKIKLRYPVRRIII
SYI_THEKO       DWPEADEKAI------------DEELEKEMEYARKIVEAGSSARQKARIKLRYPVRRIII
SYI_METTH       DW-ILDEGAV------------DSQLEADMDIVREIIEACARARDTARYKLRWPVREMVV
SYI_METTM       DW-MVSEDAV------------DGKLEAEMDIVREIIEACARARDTARYKLRWPVREIVV
SYI_METKA       DWPEVDDRWV------------DEGLEKAMELVRKAAEAALSVRQRAGVKTRWPLRRLFV
SYI_METAC       DWPKVNDTYL------------DPELEVAMDTVRSIVEAASNARQKAGRKLRWPVSRIIV
SYI_METMA       DWPKVNEAYL------------DTKLEEAMNTARSIVEAASNARQKAGRKLRWPISRIVV
SYI_ARCFU       EYSTAEVEMI------------DGELEAAMKVAKEIVEAAANARNKAKRKLRWPLRELVI
SYI_HALMA       DWPEVDADLH------------DPALEREIEVVREVEEAGSNARQQAERKLRWPVTRVVV
SYI_NATPD       DWPDPDERFR------------DPQLETDVDIVAAVEEAGSNARQQAERKLRWPVTRVVV
SYI_HALSA       DWPTVEESLR------------APALEADVAVLRAAEEAGSHARQQAGRKLRWPVTRVVV
SYI_PYRAE       QYPAAGS--Y------------DKELIYAYRELFAVFSALAEARNKAGIKLRWPIREAYV
                                                           *       : *:    :

SYI2_BACAN      LEHNE--------------------------------------NDMDWESYRDIVMDELN
SYI2_BACHK      LEHNE--------------------------------------NDMDWESYRDIVMDELN
SYI2_BACCZ      LEHNE--------------------------------------NDMDWESYRDIVMDELN
SYI2_BACC1      LEHNE--------------------------------------NDMDWESYRDIVMDELN
SYI2_BACCR      LEHNE--------------------------------------NDMDWESYRDIVMDELN
SYI2_OCEIH      VPNDEQ-------------------------------------LQSGLQAYTSIIEEEIN
SYI2_STAAU      KPNSQL-------------------------------------NLSFLPNYYSIIKDELN
SYI_CLOAB       STKAL------------------------------------------PDYYGDIIRDELN
SYI_CLOTE       SIKTL------------------------------------------PEYYGRIIKDELN
SYI_CLOPE       STSEL------------------------------------------PEYYGDIIKDELN
SYI_THEAC       AGDME-------------------------------------------ESIIDVVKSELN
SYI_THEVO       SGNID-------------------------------------------PEIIPVVSQEVN
SYI_PICTO       YSDIKL-----------------------------------------RDDIIDIISPELN
SYI_EHRRG       YSYNNNNDLFNLPV-----------------------------------KYQNILLDEIN
SYI_EHRRW       YSYNNN-DLFNLPV-----------------------------------KYQNILLDEIN
SYI_EHRCJ       YSHNCP-DLLNLPA-----------------------------------EYQNILLEEVN
SYI_ANAMM       YPYNCE-SLLDMPQ-----------------------------------QYRDIILNEVN
SYI_RICCN       ISKHNN-NLKD---------------------------------------FEDLIKDEIN
SYI_RICFE       ISKHND-KLKS---------------------------------------FEDLIKDEIN
SYI_RICPR       ISKHNN-NLKD---------------------------------------FEDLIKDEIN
SYI_RICTY       ISKHNN-NLKD---------------------------------------FEDLIKDEIN
SYI_WOLPM       YHQSSC-SFLEGEPLSV-IPEFFPVIQVADTGIQ---------CAADSNEYQEMIKDEVN
SYI_WOLTR       YHQSSC-SFLESKPLSVVIPKFSPVIPMRDTGTQKEKKWSNAEMKTSMNEYQEMIKDEVN
SYI_COREF       ALPDSG----------------------------------------RLADFLSIIRDEVN
SYI_CORGL       ALPDSA----------------------------------------RLADFASIIRDEVN
SYI_CORDI       ALPESA----------------------------------------RLADFADIIRDEVN
SYI_CORJK       ALPNAS----------------------------------------ALEDFTKIIADEVN
SYI_MYCBO       AVENPQ----------------------------------------LLRPFVDLIGDELN
SYI_MYCTU       AVENPQ----------------------------------------LLRPFVDLIGDELN
SYI_MYCPA       AVENPQ----------------------------------------HLAPFVDLIADELN
SYI_MYCLE       AVYNSQ----------------------------------------RLKPYIDLIGDELN
SYI_NOCFA       AAPDAE----------------------------------------RLAPYADIVADEVN
SYI_LEIXX       VAEGAA----------------------------------------ALAPFEAILRDELN
SYI_TROW8       RVAQVG----------------------------------------SLAQYKDIISGELN
SYI_TROWT       RVAQVG----------------------------------------SLAQYKDIISGELN
SYI_BIFLO       VAGNVE----------------------------------------AVKAYDDLLKAELN
SYI2_PSEFL      AGIEQA----------------------------------------VLERYAQFLEEELN
SYI_CHLAB       VGPKDR--------------------------------------LDQLDSFKQLISEELN
SYI_CHLCV       VGPKDR--------------------------------------LDELTSFEQLIAEELN
SYI_CHLPN       VGSKDR--------------------------------------LSLLKTFEGLIAEELN
SYI_CHLMU       VGAKER--------------------------------------MAALAQVDSLIGEELN
SYI_CHLTR       VGSKER--------------------------------------KEALAQVGSLIGEELN
SYI_PARUW       ASADPKV-------------------------------------LDFLKEQQHLISEELN
SYI_BDEBA       IHRSAEL-------------------------------------LETLKKFEPFFVDELN
SYI_BORBU       VTKNQNE-------------------------------------QNMLMEMQEIILDEIN
SYI_BORBP       VTKNQNE-------------------------------------QNMLIEMQEIILDEIN
SYI_TREDE       VTLNPEE-------------------------------------KRVLLEMEESIIEELN
SYI_TREPA       ITRNPME-------------------------------------RSALLEMEEDVLDELN
SYI_DEHM1       VLASAG-------------------------------------ERTGLMRLAEQVLEELN
SYI_DEHMC       VLSSPA-------------------------------------ERTGLMRLAEQVLEELN
SYI_THET2       TAPTAL-------------------------------------EREGLKRFAHEIAEELN
SYI_THET8       TAPTAL-------------------------------------EREGLKRFAHEIAEELN
SYI_DEIRA       RAASPE-------------------------------------ALDALKRSQTQIMEELN
SYI_STRAW       AVAGFE-------------------------------------TLD--RELHAQITEELN
SYI_STRCO       AVAGFD-------------------------------------TLS--PELHSQITEELN
SYI_THEFY       GAPGFA-------------------------------------ELP--EQLRAQIAEELN
SYI_CUTAK       SGAALA-------------------------------------KLD--EDLQAEIRSELN
SYI_BACFN       PVVDEV-------------------------------------QKAHIEAVKALIMSEVN
SYI_BACFR       PVVDEV-------------------------------------QKAHIEAVKALIMSEVN
SYI_BACTN       PVADEE-------------------------------------QKAHIEAVKALIMNEVN
SYI_PORGI       PAIDDE-------------------------------------QRRCIESVQPLILSEVN
SYI_CHLTE       AAAEPG-------------------------------------SRAAYELVSDIIKEEVN
SYI_SULAC       FLVSDK-------------------------------------DRRSIEKITDVLSSLLN
SYI_SULTO       FLVSDI-------------------------------------DVEMANNVKEVIKFLLN
SYI_AERPE       AASNPG-------------------------------------VEGSLRRLEGLIRLMAN
SYI_METJA       AG-GEE-------------------------------------VKKAVERFEYIIKEQGN
SYI_METMP       P---EN-------------------------------------IAETVEKYGYIIKEQGN
SYI_PYRFU       ETQDDT-------------------------------------VKKAVERLNYILRDQLN
SYI_PYRHO       ETQDET-------------------------------------VKKAVERLNYILRDQLN
SYI_PYRAB       ETEDET-------------------------------------VKKAVERLNRILRDQLN
SYI_THEKO       ETEDET-------------------------------------VKKAVERINRILRDQLN
SYI_METTH       VSEDEG-------------------------------------VLKAAESLKNVIAEQAN
SYI_METTM       VSEDDK-------------------------------------VLEAAESLKGVIAEQAN
SYI_METKA       EVEDP----------------------------------------KRLEDLKDVLARVAN
SYI_METAC       SPESEA-------------------------------------AAKAVNRLGSVLMDQTN
SYI_METMA       SPESED-------------------------------------AARAVERLRSVLMDQTN
SYI_ARCFU       ESGSEK-------------------------------------VRKAVEMLEETILSQCN
SYI_HALMA       DVDSDD-------------------------------------VADAVRAQEAIIADRLN
SYI_NATPD       AADDDR-------------------------------------AAEAVDRHRDLLRDRLN
SYI_HALSA       DAAEDS-------------------------------------VVDALDAHGDLLADRLN
SYI_PYRAE       NG------------------------------------------AKYAERYTELLKYLGN
                                                                      .    *

SYI2_BACAN      VKAFHVELDETKYTSY-----QLKLNFKKAGPKFGKNVNAVNGWLKQLSQDEVQNFVS--
SYI2_BACHK      VKAFHVELDETKYTSY-----QLKLNFKKAGPKFGKNVNAVNGWLKQLSQDEVQNFVS--
SYI2_BACCZ      VKAFHVELDETKYTSY-----QLKLNFKTAGPKFGKNVNAVNGWLKQLSQDEVQNFVS--
SYI2_BACC1      VKAFHVELDETKYTSY-----QLKLNFKTAGPKFGKNVNAVNDWLKQLSQDEVQNFVT--
SYI2_BACCR      VKAFHVELDETKYTSY-----QLKLNFKTAGPKFGKNVNAVNGWLKQLSQEEVQNFVS--
SYI2_OCEIH      VKQVSFKKDTADFLDT-----EMKLNFPVAGPKLGKQVGQAKGKVENFTEQEKEAFLV--
SYI2_STAAU      IKNIELTDNINDYITY-----ELKLNFSSVGPKLGNKTKNIQTLIDSLSEYDKKSLIE--
SYI_CLOAB       VKKVEFGADLSKYVNF-----EIKPNLPVLGKSYGKLIPKIRKEISSMDQMKLAERVR--
SYI_CLOTE       IKDIIFGADLSSYVEF-----NIKPNLPVLGKAYGRYIPQIRKEITSMDQMKLAQKIK--
SYI_CLOPE       IKEVELGADLSKYVNF-----EIKPNLPVLGRAYGKLIPAIRKEIASRNQMELAQKIQ--
SYI_THEAC       AKDIKLIERDQEPIRL-----SADLRMDRAAPVLRSRVNAVRHKIRSMDGLEVQRQIS--
SYI_THEVO       AKEIRIVSSEQRPLKY-----TVDLKMETAAPILRSSVNSVREALKSIDGKAAFDAVQ--
SYI_PICTO       AESIRFIKSDEMPLKI-----TVRADISKVAKLLKSRINDFNLYLER-NNDLVYRELK--
SYI_EHRRG       VKSIVFKSNIEDIASF-----QLKLNFPELGKRIPEKMKNLISLLKSNQWKVLENGQL--
SYI_EHRRW       VKSIVFKSNIEDIASF-----QLKLNFPELGKRIPEKMKNLISLLKSNQWKILENGQL--
SYI_EHRCJ       VKSISFKSDISDIASF-----QLKLNFPELGKRIPDKVKRLIFLLKNDQWKILENDKL--
SYI_ANAMM       VKSLQIASTIGDMASF-----ELKLNFALLGQRVPEKVKQIITLARAGVWEVQSDGSL--
SYI_RICCN       VKAVIYRDDLENYASK-----KLSINFPMLGKRLPHKMKEIIAASKKGEWEAITGGLA--
SYI_RICFE       VKSVIYRDDLENYASK-----KLSINFPMLGKRLPAKMKEIIAASKKGEWEAIGGGLA--
SYI_RICPR       VKTVIYRDDLENYARK-----KLSLNFAILGKRLPHKMKAIIDAAKKGEWEATTLGLA--
SYI_RICTY       VKTVIYRDDLENYAHK-----KLSLNFAILGKRLPHKMKAIIDASKKGEWETSTLGLV--
SYI_WOLPM       VKSLELVNRLEGIASL-----ELKLNFPLLGKRIPDKIKKLVQYVKEGKWKQVENEQI--
SYI_WOLTR       VKELKLVNSLEGIASL-----ELKLNFPMLGKRIPDKVKKLVQYVKEGKWKQVDNEQV--
SYI_COREF       VKNVDLTSDVDAVGTF-----EVVVNAKVAGPRLGKDVQRVIKAVKAGNYE-RVGE----
SYI_CORGL       VKNVDLTSDVDSVGTF-----EVVVNAKVAGPRLGKDVQRVIKAVKAGNYT-REGD----
SYI_CORDI       VKEVALTSDVDSVGRF-----DVVVNAKVAGPRLCKDVQRAIKAVKSGNYE-RRGD----
SYI_CORJK       VKQVELTEDVAQVGGF-----EVVVNARVAGPRLGKDVQRVIKAVKSGNYTVDDAG----
SYI_MYCBO       VKQVELTDAIDTYGRF-----ELTVNARVAGPRLGKDVQAAIKAVKAGDGVINPDG----
SYI_MYCTU       VKQVELTDAIDTYGRF-----ELTVNARVAGPRLGKDVQAAIKAVKAGDGVINPDG----
SYI_MYCPA       VKSVELTDAIDTYGTF-----ELTVNARVAGPRLGKDVQAAIKAVKAGEGVVNADG----
SYI_MYCLE       VKQIELTDAIDTYGRF-----EFTVNARVAGPRLGRDVQAAIKVVKAGEGVANPDG----
SYI_NOCFA       VKKVDLTTDVAVHGRF-----ELAVNARAAGPRLGKDVQRVIKAVKAGDWTESADG----
SYI_LEIXX       VKAVCLVEGEHSGVDR-----ALTVKARQLGPRIGKRVQEVIRAAKSGDWS-EADG----
SYI_TROW8       VKTVSIEEG--SCTQR-----MLKILPRVAGPRLAGDVQTVIAAARRGDWT-DHDG----
SYI_TROWT       VKTVSIEEG--SCTQR-----MLKILPRVAGPRLAGDVQTVIAAARRGDWT-DHDG----
SYI_BIFLO       IKNIEFSTLQDAAAHGLKIVHELRVNARAAGPRLGKQVQFAIKASKSGDWHVDAASGA--
SYI2_PSEFL      VKQVQWAADADEWAQP-----VVVLIFSLLGKRLGPAMKAVTTAVKAGEYVIDEQG----
SYI_CHLAB       VKNIVFYKEAPSFVKT-----TVKPNFRSLGRRVGEKIKDIQKALASLSQAQIQQLL---
SYI_CHLCV       VKNIVFYKETPSFVKT-----TVKPNFRSLGRKVGEKIKDVQRALSNLSQDQIQQLL---
SYI_CHLPN       VKNVIFYEEAPSFIYT-----TVKPNFRMLGKKVGSKMKEVQKALSELPNNAIDKLI---
SYI_CHLMU       VKEVHFCSETPEYVTT-----LVKPNFRSLGKRVGNRLPEIQKALAGLSQEQIQAFM---
SYI_CHLTR       VKDVHFCSETPEYVTT-----LIKPNFRTLGKKVGNRLPEIQRALAGLPQEQIQAFM---
SYI_PARUW       VKEITFSSNEKDFVSL-----KAKPNFRVLGKKVGKLMKLAQLTIEQFGQKELTELL---
SYI_BDEBA       FRKVVYNPNEDQFVQV-----TAKANFPVLGKRLGPKMKAVGAGIMSMSLENILKLE---
SYI_BORBU       AKEMKIKANEEELITY-----KAKANFKELGKKLGKDMKAVSTEISKLKNEDIIKII---
SYI_BORBP       VKEMKIKSNEEELITY-----KAKANFKELGKKLGKDMKTVSIEISKLKNEDIIKII---
SYI_TREDE       VKEVIFHEKEDELVEY-----SAKANFKVLGKELGPLMKKAAAIIEQMNSSEIQNIM---
SYI_TREPA       VKELVFHEKEDEIVEY-----RAKANFRVLGKELGSKTKRAALSIERLSSAEIQEIL---
SYI_DEHM1       VKALAVEE-PGTVIPE--------------------------------------------
SYI_DEHMC       VKALVAEE-PGTAIPQ--------------------------------------------
SYI_THET2       VKEVRVLE-PGEEILSY----RVLPNLKLLGRKYGKLVPKIREALQRERERAAALALK-G
SYI_THET8       VKEVRVLE-PGEEILSY----RVLPNLKLLGRKYGKLVPKIREALQRERERAAALALK-G
SYI_DEIRA       VKAVTFLE-GDTDLVQY----SLRPNLPVVGKQYGKQLPVLKKALTEADARAVATAVQAG
SYI_STRAW       VTSLAALSEVGGSLVDT----TAKANFRALGKRFGKGVQAVAKAVAGADAAALSLALR-E
SYI_STRCO       VASLASLSEVGGSLVDT----TAKANFRALGKRFGKRVQDVAKAVAAADAAALSLALR-E
SYI_THEFY       VVQLDPLSVVGGDLVDY----SVKPNFRALGKRFGKTTPRVAQAIREADAKTLVERLRAD
SYI_CUTAK       VMALDSFT-AAGDLVDH----CAKGNFRALGKKYAKATPKVAAAIAAADPEWLASELAIK
SYI_BACFN       VKEIKFVDGAAG-VLVK----KVKCDFKKLGPKFGKQMKAVAAAVAEMSQEAIAELEK-N
SYI_BACFR       VKEIKFVDGAAG-VLVK----KVKCDFKKLGPKFGKQMKAVAAAVAEMSQEAIAELEK-N
SYI_BACTN       VKDIKFVDGAAG-VLVK----KVKCDFKKLGPKFGKQMKAVAAAVAEMSQEAIAELEK-N
SYI_PORGI       VKELRFVDDSMG-ILVK----RIKPDFKRLGPRYGKVMKALAEAVTAMTQEEIRSLEK-A
SYI_CHLTE       VQKIEYVEDEDGSVISK----KAKPNFKTLGPRFGKDMKLLAEEIRIMSHKQISRLEK-E
SYI_SULAC       SKSIIIEGIDGYKRFSK---IRATPNTGSIGPTFKRLSVKVAEYIQNNSDKVAQDIVS-K
SYI_SULTO       TKDVEIGGIEGYRRFSK---IKATPNRGTIGPDFKRLTNKIVEYIENNSEKVASDIIA-K
SYI_AERPE       AKEIEFAPASALEATRI---YRVEPDYGRLGPKYKRDMPKVLRLIEEKGGEIGRVLAE-K
SYI_METJA       VKNIKFGEVEGSK-------YIIKPNYRELGKRYRSEVPKVVEALNKADAKELMERLK--
SYI_METMP       VKEIELKEFEGN--------ITVKPNFKELGKIFRSDVPKVVAAINSVAPNELKEKLK--
SYI_PYRFU       AKEVVVGNVERE--------ITVKPNFAKVGPEFKGDARLVAKWISEHGLELYEKGEV--
SYI_PYRHO       AKEVVIGKVERE--------LTVKPNFAKVGPEFKGDSRLVAKWINEHGLELYEKGEV--
SYI_PYRAB       AKEVKVGRVERE--------LTIKPNFAKLGPEFKGDAKIIAKWINENGRELYEKGEL--
SYI_THEKO       AKEVVVGKVERE--------LIIKPNFAKVGPEFKGDAKKVIAWISEHGRELYEKGEM--
SYI_METTH       AKSIKTSTEFPDMK------IIARPNPATLGPRLRQDIPLVMRELEGADGSAVKAALDSD
SYI_METTM       AKSIRTSTEFPDMR------IIAKPNPATLGPKLRQDMPPVMRKLEEADGAEVKAALESE
SYI_METKA       VKEVELGEEFPEKV------PVAEPRPDKIGPEFRSLAGRVIEHVKDRAEEVARSILK-D
SYI_METAC       SKAIVLTGVGKSWDELG---LEVIPDPGKIGPVFKKDAGRVIPALQKVEGFTLKKAFAET
SYI_METMA       SKDIVLTGVGKSWDELG---LEVIPDPGKIGPVFKRDAGKVVPALQKVDGFALKKAFAEA
SYI_ARCFU       VKQVRVVDS----FEKE---IEIKPNYKYIGPLLKEKAGEFAKYVASLKEIPEKLVF---
SYI_HALMA       ARAVEVVGADDEWGELQ---YSAEADMSELGPAFGDDAGRVMNALNEARVTEQSLDTLEG
SYI_NATPD       AREIELVEPGSDWEELS---YTARADMSVLGPTFGDEAGEVMNAINAVSVTDTAVEALEA
SYI_HALSA       TRAIEVVEPGAAWDELA---YSARADMSELGPAFGDDAGAVMNALNDARVTDRDIDALAE
SYI_PYRAE       VKEVKVGRR---------------------------------------------------
                   .                                                        

SYI2_BACAN      ---------TERAVYEVAPGEEIVVTTEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEEL
SYI2_BACHK      ---------TERAVYEAASGEEVVVTTEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEEL
SYI2_BACCZ      ---------TERAVYEVASGEEIVVTTEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEEL
SYI2_BACC1      ---------TERAVYEAASGEEVVVTTEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEEL
SYI2_BACCR      ---------TGRAVYEATPEGEVVVTGEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEEL
SYI2_OCEIH      ---------NGTINVELQDGSEVTLEKEDIIVEKKGQEGYQLFEGNRFVLLLDTNLTEKL
SYI2_STAAU      ---------SNNFKSLSSDAE---LTKDDFIIKTLPKDSYQLSEDNDCVILLDKNLSPEL
SYI_CLOAB       ---------SGEAVKIDVDGTEIELNSENLLVTMQGLEGFAFAGIGEIGIVLETTITDEL
SYI_CLOTE       ---------QGEKVIINIDGNEIELNEENLLVTMKGLEGFAFAGEGNIGVVLNTTITDEL
SYI_CLOPE       ---------NGGVEVITVDGNEIELNAENLLVTMQGLEGFAFAGEGSVGVVLDTTITDEL
SYI_THEAC       ---------EKG--FVEIDGVRLDPDMVEISRVPDPNYAYSQTEKYGIDVFINKNIDRDG
SYI_THEVO       ---------NGG--KLRVLDHELTGEMLNISTIPDPDYGYSRDEKNGIDVFVNKRIDRNE
SYI_PICTO       ---------SKG--KINFDGIYLTDDMFIMNEEVNGNYGFNKDERSGIYLFINREIDNDL
SYI_EHRRG       -----MLGIREGEYYILEDNEYTLNLKVHSEFASTITLG----PNLLGVLVLDNTLTDEL
SYI_EHRRW       -----MLGIREGEHYILEDNEYTLNLKVHSEFASTITLG----PNLLGVLVLDNTLTDEL
SYI_EHRCJ       -----LLGTIEAEHYVINNNEYTLALKVHNDFACTINLD----QHLLGVVLLDNELSNEL
SYI_ANAMM       -----LLGAPGCEQCVIQKDEFSLNLKVHSEYACQIISG----GVPVGVLHIDHELTREL
SYI_RICCN       -----ICGE------TLNSDEYKLVLEPYSHIKGAASFE----NNS-SLLILDLELTPEL
SYI_RICFE       -----ICDE------TLNSDEYKLVLEPHVHIKGAASFE----NNS-SLLILDLELTAEL
SYI_RICPR       -----ICGE------ILNSDEYTLILEPYSHIKGTANFD----NNS-SLLILNLELTSEL
SYI_RICTY       -----ICGE------ILNSNEYKLVLEPHSHIKGTANFE----NNS-SLLILDLELTSEL
SYI_WOLPM       -----FLGDES-ENYIIEKGEYELLLKANSEY--SSVFD----NNK-GIVILNTELNDEL
SYI_WOLTR       -----FLGNES-ESYIIEKDEYELLLKTNSEY--SSVFG----DNK-GIVILNTALDDAL
SYI_COREF       --------TVVADGIELQDGEYTERLVAANPDSTAQID------DVDGLVVLDMEVTPEL
SYI_CORGL       --------VVVADGIELNEGEFTERLVAANPDSTAQID------GVDGLVVLDMEVTEEL
SYI_CORDI       --------TVVADGIELVAGEFTERLVAADPDSTTQID------GVDGLVVLDMTLTEEL
SYI_CORJK       --------VVTADGIELQDGEFTRKLVAAEPEHTAEVS------GQDGLVVLDTQTTPEL
SYI_MYCBO       --------TLLAGPAVLTADEYNSRLVAADPESTAALP------DGAGLVVLDGTVTAEL
SYI_MYCTU       --------TLLAGPAVLTPDEYNSRLVAADPESTAALP------DGAGLVVLDGTVTAEL
SYI_MYCPA       --------TLTAGPAVLRPEEYSSRLVAADPEFTAALP------NGAGLVVLDGTVTPEL
SYI_MYCLE       --------TLTAGPVVLQPDEYSSRLVAANPEFTAELP------DGSGLVVLDDTVTPEL
SYI_NOCFA       --------VVSAAGITLLPEEYTQRLVAAEPESTAALP------GNAGLVVLDSVVTEEL
SYI_LEIXX       --------VVTAGGVELEPGEYELAVVISAP--TARFE------NGV-YIELDTALTPEL
SYI_TROW8       --------HVTAGGIPLLENEYQLVAGAQDSKNSQPL-------PFGGSVTLDTRIDETL
SYI_TROWT       --------HVTAGGIPLLENEYQLVAGAQDSKNSQPL-------PFGGSVTLDTRIDETL
SYI_BIFLO       -----PVVSTPSGDLALVEGEYELINRVEEENATEAAASVSAALPTGGFVILDTALDADL
SYI2_PSEFL      --------GLVAAGQTIQPHEFERRLTVRDTLNNVGIVE-------NMVVWLDLDIDASL
SYI_CHLAB       ---------TQEYLSLNLGSEEIVLHMEDVLISWETDPGYVARSSSLFTVVLDCQLTEEL
SYI_CHLCV       ---------KQQYLLLNLGFEEITLGIDDVVISWETDPGYVARSSSLFTVVLDCQLTEDL
SYI_CHLPN       ---------QEETWVLTIDDREIALDGDDVVICRHTDPGYIARSSALFSVILDCQLREPL
SYI_CHLMU       ---------HNGFMVLSLGEETISLNEEDITVSWEAAPGFVARSSASFVAILDCQLTSPL
SYI_CHLTR       ---------HKGQMVVSLGEETISLDKEDITVSWASAEGFVARSSASFVAVLDCQLTEPL
SYI_PARUW       ---------NHRSVEIILEGHPVLLTSEDVQVERIVREGIIAANQGTITIALNTNLNKEL
SYI_BDEBA       ---------GGG--VVVIEGEEISLSDVEIRRAPKGDNANLSVHQ-IVSIEVDPTVTPEQ
SYI_BORBU       ---------NGTSYEIKVANAKHYLSLNDIILEREEKENLKVINEESITIGIDSLITKEL
SYI_BORBP       ---------NGISHEIKVDNAKYYLSLNDIILERDEKDNLKVINEESITIGIDSLITQEL
SYI_TREDE       ---------EGATLSIDIEGKSVEITADKIVINRIEKASLKIVNEGTLTVGLNTELTEEL
SYI_TREPA       ---------EGTTLYLDVDGDRLELTEEKILVQRIERESLKAINEGTLTVALDTTLTEDL
SYI_DEHM1       -----------------------------KNYAASTEG--------AYTVAVYTGLSPEL
SYI_DEHMC       -----------------------------ENYVASTEG--------AYTVAVYTGLSPEL
SYI_THET2       EAIPLEVE---GEALTLLPEEVLLEAEAPKGYQALEKD--------GYVAALKVEVTEAL
SYI_THET8       EAIPLEVE---GEALTLLPEEVLLEAEAPKGYQALEKD--------GYVAALKVEVTEAL
SYI_DEIRA       QGFSVQAD---GVTFDLTPGSVLVDAKAPEGVAAAEDA--------GYLVAFDTALTPEL
SYI_STRAW       GTASVEVD---GETVTLAPDEVIITETPREGWSVASDS--------GATVALDLEITEEL
SYI_STRCO       GTASVEVD---GETVTLAPDEVIITETPREGWSVASDS--------GATVALDLELTEEL
SYI_THEFY       NAATVDVD---GEQVVLSADEVVVTEQPREGWTVASEA--------GETVALDLELTPEL
SYI_CUTAK       GSVEMDVPEVEGGKAVVTADDVIVSERPREGWSVVNEQ--------GETVALDLEITPEL
SYI_BACFN       GKYTFDLG---GAEAVIESADVEIFSEDIPGWLVANEG--------KLTVALEVTVTDEL
SYI_BACFR       GKYTFDLG---GAEAVIESADVEIFSEDIPGWLVANEG--------KLTVALEVTVTDEL
SYI_BACTN       GKYALNLD---GAEAVIEAADVEIFSEDIPGWLVANEG--------KLTVALEVTVTEEL
SYI_PORGI       GTFRMEVA---GTPVELELADVEIVSEDIPGWLVANEG--------NLTVALDITVTDEL
SYI_CHLTE       GSIEIDLG---GRICTVLREDVDIVHEDIEGWLVAADDA------HRIMVALDTEITEEL
SYI_SULAC       GY---HEFNVDSENLRLDISHVNLVEEVEKGYVSARFSK--------GVVLLKQEMSKEE
SYI_SULTO       GY---HEVVIEGEPVQIKVNHVNILEETEEGYISARFNK--------GVVVLKKEISKEE
SYI_AERPE       GV---YEGEYEGLPVKLTLEDVSLKAEYPEWLKVRDTPL--------GLVAVDTRLTKEE
SYI_METJA       ------EGAVILDGYEIKPEYVEIRLEIPEHIAGVEFSK--------GTVFINTEITDDL
SYI_METMP       ------SGNFEVSEYEIKPEYVEFRVEIPENIVGVEFSK--------GNVYINIEMNDEV
SYI_PYRFU       ------DVEIEGKKFHLTREHIIVEENIPDFLVAEDFEG--------GRVYVDKTLTREL
SYI_PYRHO       ------DVEIEGKKFHLTREHIIVEEKLPDFLVAEDFEG--------GRVYVDKTLTREL
SYI_PYRAB       ------TVEIDGKTFHLTREHIIVEEKLPDFFVSEEFEG--------GRVFVDKTLTREL
SYI_THEKO       ------DVEIEGKTFHITREHVTIEEKLPDFFVAEEFDG--------GRVFVDKTLTREL
SYI_METTH       GE---FTVETDGKKFKLTSEDIVFETELPENIVSAQFDG--------GSVFIDTELTPEI
SYI_METTM       GS---FRVDLDGRIIVLEPDDIIFETELPENIVNAQFEG--------GSVFVDTELTPEI
SYI_METKA       GE---YRTELDGEDVVLTEEHVKVTEDLPEGWEAEEFEG--------GRVYVFVELDEEL
SYI_METAC       GEF--ELTLADGTTVPVTSGMANFKETLPEGTASAESDA--------GLVYVDANLTPEL
SYI_METMA       GEF--ELTLADGSTVKVTPEMANFKETLPEGTASAESDA--------GPVYVDANLTPEL
SYI_ARCFU       ----------DGVELDPKQAIV-VDYRLPEGYEYAEFSG--------GVVYIYKELDDEL
SYI_HALMA       T----VREALGED-VDLTEEMVEFRRETPEGVTGTEFTA----LDGGGVVYVDTALTEDI
SYI_NATPD       A----VETELGRD-IELTDEMVSFNTETPEGVEGTAFTVD---GDDRGVVYVDTALTEDI
SYI_HALSA       Q----VAADLGRDDIELTTEMVEFVEETPEHVAGAAFET----ETAAGTVYVDTELNEDV
SYI_PYRAE       ----------------------------PDYLCVKEGEL---------EVCVPDKIEPEL
                                                                   .        

SYI2_BACAN      LQEGVAREFIRAVQEYRKQLNLPVNLRVDVILDTE------EELQQTLTNHKELLEENLL
SYI2_BACHK      LQEGVAREFIRAVQEYRKQLNLPVNLRVDVILDTE------EELQQTLTNHKELLEENLL
SYI2_BACCZ      LQEGVAREFIRAVQEYRKQLNLPVNLRVDVILDTE------EELQQTLTNHKELLEENLL
SYI2_BACC1      LQEGVAREFIRAVQEYRKQLNLPVNLRVDVILDTE------EELQQTLTNHKQLLEENLL
SYI2_BACCR      LQEGVAREFIRAVQEYRKQLNLPVNLRVDIILDTE------EELQRTLTNHKDLLEENLL
SYI2_OCEIH      KEEGFVREFIRAVQTYRKELDLPVEQRVDIYVNSD------ENAERILSEFDALIHDGLI
SYI2_STAAU      IREGHARELIRLIQQLRKKKNLPINQRIDIYIGVT------GELLESIKTNKNMFKENFV
SYI_CLOAB       REEGYLREVLSKVQNMRKESGFEVADKIEIYVSGN------EKLENVIRKFEDTIKKETL
SYI_CLOTE       KEEGQLREILSKIQNMRKEKEFEVADRIKLYVSGN------RMLESVVEKFEDIIRKETI
SYI_CLOPE       REEGHVREIISKIQNMRKESGFEVADKITLYVAEN------DMLLDVIKKFEDVIKKETL
SYI_THEAC       YLEGLARELVRRIQVMRKEMNLNYTDRIITHLDLS------DDFLEALNKHAEYIKNETQ
SYI_THEVO       YLEGLAREIVRRIQLMRKEMNLDYTDRINVWIDPV------GDFSDAIDKFESYIKAETQ
SYI_PICTO       LLEGYAREIIRRIQVMRKDLNLEYSEKIKTYIDAD------EDIRSAVERYMEKIKNETL
SYI_EHRRG       IMEGIARDIVRIIQQSRKDNKFNVSDKIDVVICTQ-----DKMVKNSVQAWYEYIVQQTL
SYI_EHRRW       IMEGIARDIVRIIQQSRKDNKFNVSDKIDVVICTQ-----DKMVKNSVQAWYEYIVQQTL
SYI_EHRCJ       IMEGIARDIIRTIQHSRKDNKFNISDKIDVIIHTK-----DNIVKDSIKTWSQYIIQQTL
SYI_ANAMM       LLEGIARDVMRLIQQARKDCGLEMLDHAEVIINTD-----AAEIIEAISIWYDFIKQQTF
SYI_RICCN       IEEGYARDIVRFIQQARKDADFSITDRILIEIISE-----FN-LSKIIDNYGDFIKEQTL
SYI_RICFE       IEEGYARDIVRFIQQARKDADFSITDRILIEIISE-----FD-LSKIIDNYGDFIKEQTL
SYI_RICPR       IEEGYARDIVRFIQYARKEADFSITDRILIEIISE-----FD-LSKIIDHYGDFIKEQTL
SYI_RICTY       IEEGYARDIIRFIQHARKEADFSITDKILIEIISE-----FD-LSKIIENYGDFIKEQTL
SYI_WOLPM       ILEGLARDVVRLIQETRKQADFHISDRIRVIIKTE-----EEKIKEAINTWFEYIKEQTL
SYI_WOLTR       VLEGLARDVVRLIQEARKQADFHISDRIRVIIKTE-----DEKIKRAINTWGEYIREQTL
SYI_COREF       EAEGWAADVIRGLQDARKSSGFEVSDRIQVTLSVP------GDKQEWATRHADHIAGEVL
SYI_CORGL       EAEGWAADAIRGLQDARKNSGFEVSDRISVVVSVP------EDKKEWITTHADHIAAEVL
SYI_CORDI       EAEGWAADVIRGLQDARKASGFEVSDRIEVKLVVP------EEKKEWALRHTDMIAGEVL
SYI_CORJK       EAEGWAADRVRGLQEARKAADLQISDRIHLTLSVP------AEKEEWARTHADSIAKEVL
SYI_MYCBO       EAEGWAKDRIRELQELRKSTGLDVSDRIRVVMSVP------AEREDWARTHRDLIAGEIL
SYI_MYCTU       EAEGWAKDRIRELQELRKSTGLDVSDRIRVVMSVP------AEREDWARTHRDLIAGEIL
SYI_MYCPA       EAEGWAKDRIRELQELRKSTGLDVSDRISVVMSVP------AGRAEWARTHRDLIAGEIL
SYI_MYCLE       EAEGWAKDRIRELQELRKLIGLDVSDRIRVLMSVP------AERADWARVHRDFIAREIL
SYI_NOCFA       EAEGWARDLVRELQETRKSLGLDVSDRIHVVLEVP------EARRSWAQTHRDLIAGEIL
SYI_LEIXX       EAEGLARDIIRAVQDTRKAAGLGVSDRIALTLAFEN----GGDARVLGLATEVDIASETL
SYI_TROW8       RSEGVARDTVRQIQIARKEKDLNITDRISLEVCVPD-----EQVKNNLLAFSELICKETL
SYI_TROWT       RSEGVARDTVRQIQIARKEKDLNITDRISLEVCVPD-----EQVKNNLLAFSELICKETL
SYI_BIFLO       LAEGYARDVIRSVQDARKAADLDIADRISLVLTVP------AVDVAKVEQFRDLIAHETL
SYI2_PSEFL      KREGAVRELNRRLQDLRKKAKLGYTEKVDIAVLGG------AYVDEILVHHEDWLKSQLL
SYI_CHLAB       VVEAISRELVNKINTMRRNQKLHVSDRIVLRMQT------SEEVRKAFLHYADYICEETL
SYI_CHLCV       IVEAISRELVNKINTMRRNHKLHVSDRILLQIHS------SEDVEKAFLHYEDYICEETL
SYI_CHLPN       IVEGIARELVNKINTMRRNQQLHVSDRIALRIKT------TEAVHRAFLDYENYICEETL
SYI_CHLMU       IMEGIAREIVNKINTMRRNGKLHVSDRIAIRLHA------PKIVQEAFSQYEEYICEETL
SYI_CHLTR       IMEGIARELVNKINTMRRNRKLHVSDRIAIRLHA------PVIVQEAFALHKEYICEETL
SYI_PARUW       LLEGLAREIVNKVNTMRREANFAVTDRIQLYMQT------TTRVIECFDQYKNYICQEVL
SYI_BDEBA       EREGLAREIMRKIQVARKTADFQMDDKITLEIAC------DGALLDALNAHKDMITGETL
SYI_BORBU       YLEGLTREFVRQIQNLRKEKNFDVSDRINLYIE------NNETLKEMLNKFEKYIKTETL
SYI_BORBP       YLEGLTREFVRQIQNLRKEKNFDVSDRINLYIE------NNATLEEILNKFEKYIKTETL
SYI_TREDE       LMEGYIRDLVRGIQTLRKECGLDVTDRIKLYLSASQKNADNKELEKAFELFKDYVCDETL
SYI_TREPA       LLEGAIRDLVRGVQNLRKERGFSLVDRICLRVFSSDQ--DIVCARKAYDLHRSYIVGETL
SYI_DEHM1       LAEGTAREIVHRLQTMRKSAGFEIADYINTHYQAD-----EYL-DSVIRMHSEYIKKETL
SYI_DEHMC       LAEGSAREIVHRLQTMRKSAEFEIADYINTHYQAD-----EYL-ESVIRTHAEYIKKETL
SYI_THET2       RMEGLARDLIRLLQQARKDMGLKVSDRIRVGYEAE-----GPY-LEALKRHGPWIAEEVL
SYI_THET8       RMEGLARDLIRLLQQARKDMGLKVSDRIRVGYEAE-----GPY-LEALKRHGPWIAEEVL
SYI_DEIRA       VREGLARDLVRAIQEARKAAGFEVQDRIALALELD-----GEA-LEAAQAWQDFIAGEVL
SYI_STRAW       RQAGLARDAIRLIQEARKNSGLDVADRIALRWTST-----DPEVIAALSEHSELIADEVL
SYI_STRCO       RRAGLARDAIRLIQEARKNSGLDVADRIALRWTAT-----DPATIAALTDHSGLISDEVL
SYI_THEFY       RRAGVAREVIRLVQDARKSSGLNISDRIHLWWSAT-----DEMTAQAMAEHAEAISSEVL
SYI_CUTAK       ARAGQAREVIRFVQDSRKKAGLDVSDRITLAWSAS-----ADL-ATAIEEHAEQISQEVL
SYI_BACFN       RREGIARELVNRIQNIRKSSGFEITDKIKLTLSKN-----PQT-DDAVNEYNSYICNQVL
SYI_BACFR       RREGIARELVNRIQNIRKSSGFEITDKIKLTLSKN-----PQT-DDAVNEYNSYICNQVL
SYI_BACTN       RREGIARELVNRIQNIRKSSGFEITDKIKITISKN-----TQT-DDAVNEYNTYICNQVL
SYI_PORGI       RSEGLARELVNRVQNIRKQSGFEVSDKVDVLLLSN-----DIM-DKVVAEHHDYIAQQIQ
SYI_CHLTE       EMLGLARELVSRIQTLRKESGLEITDRIALTIAGS-----EKL-LAAARKSESYIMDETL
SYI_SULAC       EEEGIIRDLIRRIQFMRKQLSLNVNEYILLSIRAP-----DDKVD-LIKKWEQYIKNETR
SYI_SULTO       EEEGIVRDIIRRIQFMRKQLNVQINDYILLYIKAP-----EERTE-MLKKWTDYIKSETR
SYI_AERPE       VLEGLARDIVRRIQAMRKEAGYSVEDYVEVWIQGG-----EDVVE-AVNALKEYIKRETR
SYI_METJA       IKEGLMREVIRRIQAMRKDMDLDIEEKIKIKVEGI-----DLD---EFKEIIEREVRGQF
SYI_METMP       IKEGLVREVVRRIQSMRKDMDLDINEKINVKLEGI-----DFSS--DYLSHIANEVRGNF
SYI_PYRFU       LAEGLAREFVRRIQEMRKRLDLDVNDRIVVTIETT-----EENRE-LLQENLEYIMRETR
SYI_PYRHO       LAEGLAREFVRRIQEMRKRLDLDVNDRIVVTIETT-----DDNRE-LLQENLDYIMRETR
SYI_PYRAB       IAEGLAREFVRRIQEMRKRLDLDVNDRIIVTIETT-----DENVE-LLKENLDYIMRETR
SYI_THEKO       LAEGLAREFVRRIQEMRKRLDLDVNDRIVVTIETT-----DENRE-LLQENLDYIMRETR
SYI_METTH       MSEAMARELVRRIQDMRKDLDLDVEASIEVSVKCS-----EEFRE-LTEPQREFIENEVR
SYI_METTM       MSEAMARELVRRIQDMRKDLDLDVEARIEVSVKCS-----PEFRE-LTEPQREFVENEVR
SYI_METKA       KSEAWAREVVRRVQEMRKELDLNLEERIRVWIETD-----EEIAE-AVEEHSEYVRGETR
SYI_METAC       EAEGYAREVIRRLQDMRKELDLVVDENIRVSVRIE-----AEKVLALVETLKDLIAEEVR
SYI_METMA       EAEGYAREVIRRLQDMRKELDLVVDENIQVSVRIE-----DERVLKLVETLKGLIAEEVR
SYI_ARCFU       VREAFAREVIRRIQEMRKELDLDVEEFIETTVEMD-----AE----LVKGWEDYIKSETR
SYI_HALMA       ESEGYAREVIRRIQEMRKDLELDIEERIAVDLTID-----DERVDSLVREHEALIKEEVR
SYI_NATPD       ESEGYAREVIRRVQEMRKDLDLDIEAEIRVDLDIA-----DERVATLVDEHEGLIADEVR
SYI_HALSA       ESEGYAREVVRRVQEMRKEMDLAMDAEIRLDVLVF-----DERVGELVARHEPLITAETR
SYI_PYRAE       YYEALARELIRRIQVMRKETGLEISDEIHVVVETN-----SDDIKKAVEQYRDYIARETR
                   .   :    ::  *:                                          

SYI2_BACAN      VKQFTFGHLTNEDDELSLGETKVRIKLSTAQ--------------------
SYI2_BACHK      VKQFTFGHLTNEDDELSLGETKVRIKLSAAQ--------------------
SYI2_BACCZ      VKQFTFGHLTNEDDELSLGETKVRIKLSATK--------------------
SYI2_BACC1      VKQFTFGHLTNEDDELSLGETKVRIKLSATK--------------------
SYI2_BACCR      VKQFTFGHLTNEDDELSLGETKLRIKLSAAN--------------------
SYI2_OCEIH      INSVQFAEKE-DMKQVTVNDTEMGLSIV-----------------------
SYI2_STAAU      IKNIHLNVIDEYENTIHFNNKEIKISLLY----------------------
SYI_CLOAB       ATDIIYSENK-EAAIYNINGEELNVFVKKNC--------------------
SYI_CLOTE       AEEVIYNEER-EYVDCKINGEDFKIEVEAIK--------------------
SYI_CLOPE       TEEIVYNGNA-DYSEAKVNGEILKMAVSKRA--------------------
SYI_THEAC       SDSIITDKVE-GMKLWEINGEPVRIKIDLAR--------------------
SYI_THEVO       CDSLNVGHTD-DLRKWEIGDETIGIRIEKVVPK------------------
SYI_PICTO       SSEILFKNDP-EARAWDIDDKTVYIKIVK----------------------
SYI_EHRRG       SLSLVIH------ENL-DANNVAEYCKTT-------MKDRNLTLFIKKL--
SYI_EHRRW       SLSLVIY------ENL-DANNVAEYCKTT-------MKDRNLTLFIKKL--
SYI_EHRCJ       STSFAIH------EEISDIQDINEYYKTT-------MKDKEVSVFLKKSHT
SYI_ANAMM       SHTLEHR------PAQAVVEDCSKYTKIS-------GKDFDIFLCKSALCS
SYI_RICCN       GEFAKNF------TPDYVSKVALENHQIQ-------LKVKKS---------
SYI_RICFE       GEFSKNF------TPDYVSKVELENHQIQ-------LKVKRS---------
SYI_RICPR       GEFAKNF------TPDYVSKVALENNQIQ-------LKVKRL---------
SYI_RICTY       GEFAKNF------MPDYVSKVALENNLIQ-------LKVKRL---------
SYI_WOLPM       ALSLDIN------TEIGTNFYSKEYQDLS-------VSIER----------
SYI_WOLTR       SLSLEIN------IEIGDNFYSKEYQDLI-------VGIELNC--------
SYI_COREF       ATSFEVT------QDDLGEDAHEVLKGVT-------ASVARV---------
SYI_CORGL       ATSFEIV------TDALDGETHDIVAGVT-------AKVTKN---------
SYI_CORDI       ATSFEVV------TGEPAE--HDIVAGVT-------ATVQKV---------
SYI_CORJK       ATDVKVV------VGEQLS--HDVADDCS-------ADIVVASVAS-----
SYI_MYCBO       ATDFEF--------ADLADGVA-IGDGVR-------VSIEKT---------
SYI_MYCTU       ATDFEF--------ADLADGVA-IGDGVR-------VSIEKT---------
SYI_MYCPA       ATRFEF--------GEPADPVA-IGDGVR-------VSISKV---------
SYI_MYCLE       ATSFEF--------GEPADSVA-IGDGVR-------VSLLKV---------
SYI_NOCFA       ATSLEF--------GTAGEPAAELAGGVR-------ASVRKA---------
SYI_LEIXX       ARTVQVAAAAGAFVKTFGAGQFANVGDFT-------VGITKIEEADE----
SYI_TROW8       CDRLDIL-------------VKKGIDGIT-------VSLEKFRQ-------
SYI_TROWT       CDRLDIL-------------VKKGIDGIT-------VSLEKFRQ-------
SYI_BIFLO       ATSFEVK----------------EGAELG-------VEVVKA---------
SYI2_PSEFL      VQSLLRSDLEAPLAVDEVELPEGDPVRIQ-------LRRSVLA--------
SYI_CHLAB       TTQSEFADV------LEGEEWDINGHPTV-------IAIEVAARPH-----
SYI_CHLCV       TVQFEFKDS------VEGEEWDINGHPTV-------IALTVASKAN-----
SYI_CHLPN       IIAYDFTQDSD----FQGENWDINGHATQ-------IEITVSSIDS-----
SYI_CHLMU       TTSVSFIDD------KEGEEWDVNGHAVS-------LSLEVIGH-------
SYI_CHLTR       TTSVSVIDY------KEGEEWDINGHAVS-------FVLERVER-------
SYI_PARUW       ATDVQFGPY-------EGTDWDLNGEPTK-------IIIKKSEY-------
SYI_BDEBA       TKNLNILALTAEPNGKHTETSDIDGQVIK-------IGVTNLPR-------
SYI_BORBU       ALNIILNKSK-----LEKKINLADDIFTL-------IGIEKC---------
SYI_BORBP       ALNIILNKSK-----LEKKINLDNDIFTI-------IGIEKC---------
SYI_TREDE       TVQSSWLKTG-----ELTKLGSIKTSLVEAGDYEWEIGIEKNN--------
SYI_TREPA       AAHVQWARVR-----DGASAVYVKSDAVL-----WEVSIDKA---------
SYI_DEHM1       SNQLIKGNAPEGAYAESLDIDGHSLSLWVAR--------------------
SYI_DEHMC       SNQIVNGNAPEGAYTESLDIDGHPLSLWVVR--------------------
SYI_THET2       ATAFGEGLFGGFEARVEDEEGKAVFHLARAE--------------------
SYI_THET8       ATAFGEGLFGGFEARVEDEEGKAVFHLARAE--------------------
SYI_DEIRA       AEQVAYGSGEGFRAEVEG----GAVTLKKL---------------------
SYI_STRAW       ATDFAQGEADDTYGEPFTDESLSLTFRLRKA--------------------
SYI_STRCO       ATDFAQGEADDSYGAPFTDEGLSLVFRLRKQ--------------------
SYI_THEFY       AVSFTEGTGDADAYEVVSEE-FGITLRLRKA--------------------
SYI_CUTAK       AVQMSR---EPRADDWAVEPDLGLAVKVVKV--------------------
SYI_BACFN       GTSLTLA--DEVKDGTELNFDDFSLFVNVVKE-------------------
SYI_BACFR       GTSLTLA--DEVKDGTELNFDDFSLFVNVVKE-------------------
SYI_BACTN       GTSLDLA--DEVKDGTELNFDDFSLFVNVIKD-------------------
SYI_PORGI       AESLEIS--DAVSDGVELDFDDFVLSIQVVKHQG-----------------
SYI_CHLTE       ATSIVLLPLDDSQPGDGVEQVNNELCRLSLEKSGS----------------
SYI_SULAC       AKELRIGD-VSG--DLIQDWDVEEE-TYTIGVSKADVSVS-----------
SYI_SULTO       AKEVIIGE-VKG--DLILPWEIEDE-EYIIGVSKS----------------
SYI_AERPE       ALKLEVGE-PPSGVEVLREWELDGE-KVVIALKRAAASG------------
SYI_METJA       VDEIKADY----EKDWEIKTPNGEKYNVKIAIERINK--------------
SYI_METMP       VESLKSDY----NQKWTIKTPNEETYDISIDIEKNK---------------
SYI_PYRFU       AIEVRFEE----AKGYVVEWPEVQ---AKIGIEKIE---------------
SYI_PYRHO       AIEVRFEE----AKGYVVEWPEVQ---AKIGIEKVE---------------
SYI_PYRAB       ADKIVFGK----AKGYVVEWPEVQ---AKIGIEKVEE--------------
SYI_THEKO       AVEVRFEE----AKGYVVEWPEVQ---AKIGIEKV----------------
SYI_METTH       ASTLSFDY---SELEYTKEWKISDE-NLIISIKPAKV--------------
SYI_METTM       ASHLSFDY---TELEYTKEWKISDE-NLIISIKPSDKV-------------
SYI_METKA       ADELHVNEGWPEEVDLEREWEVEDR-TIRIAVVVSG---------------
SYI_METAC       ADVFDLGSSIEVSGTLVKDWDVEGT-AMKMGIAKK----------------
SYI_METMA       ADVFDIGSGVNVSGDLVKDWDVEGI-AMKMGIAKK----------------
SYI_ARCFU       SQKLVFGK----AEGYVREWNIEGK-KVKIGIKRLRG--------------
SYI_HALMA       ADELDGVE-----DGHRKTWEVEGT-DMEIAIAPCEADQREASEQASGD--
SYI_NATPD       AAEFADLN-----AGHERVWDVEST-DITITIDPVSER-------------
SYI_HALSA       ARELGEVE-----DGHREEWDVEGT-TMILEVEAV----------------
SYI_PYRAE       AVKLIIDA-----VSQGKEWDISGE-KVKIEIRKAQA--------------