CLUSTAL format seed alignment for MF_02004

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYV_MYCGA       -------------------------MKRLKKIDLN-QKYDHKTVSEGVVDFWLTTDYANQ
SYV_MYCGE       ---------------------------MKDKFSFQ-KNYDFNLVSDGLYEIWNNAGFFKP
SYV_MYCPN       ---------------------------MDKQFSFQ-GQYDFKTVSTGLYDSWSSASFFKP
SYV_MYCPE       ------------------------MSNIKNNNDLS-KKYDHKICEQQ-FSLWTTQKELNK
SYV_MYCS5       ---------------------------------MQ-KIYNHQNVEDGIESKWREKKYFID
SYV_MYCH2       ---------------------------------MK-NKYDFKLVEEKRNEKWQKKGFFIA
SYV_MYCH7       ---------------------------------MK-NKYDFKLVEEKRNEKWQKKGFFIA
SYV_MYCHJ       ---------------------------------MK-NKYDFKLVEEKRNEKWQKKGFFIA
SYV_MYCMO       ---------------------------------ME-KIYNHKIVEKDKNEKWIKKEYFST
SYV_MYCPU       ---------------------------------MD-SKYNHYEIEKDKNQKWIDKKYFIN
SYV_PARUW       ------------------------------MTELP-KAYEAKKIDEKWYQFWDAKRYFTA
SYV_CHLPN       ----------------------------MTTEDFP-KAYNFQDTEPELYVFWEKNGMFKA
SYV_CHLMU       ----------------------------MNEDQFP-KAYDPKSSESGVYSFWERSGMFIA
SYV_CHLTR       ----------------------------MNEDQFP-KAYDPKSSETGVYSFWERSGMFVA
SYV_CHLAB       ----------------------------MEEDAFP-KAYDPKGLEEKLYAFWEESTMFTA
SYV_CHLCV       ----------------------------MEEDEFS-KAYDPKGLEDKLYAFWEGSGMFTA
SYV_ONYPE       ---------------------------------MQ-TKYDFKKVEHQRYQQWLEKKYFCA
SYV_UREPA       -----------------------------MKKKLS-KKYSFKEVEANKLLFWQENNLFKA
SYV_PORGI       -------------------------------MEIA-SKYNPEEVESKWYNYWMEYGCFIS
SYV_BACFN       -------------------------------MELA-SKYNPADVEGKWYQYWLDHKLFSS
SYV_BACFR       -------------------------------MELA-SKYNPADVEGKWYQYWLDHKLFSS
SYV_BACTN       -------------------------------MELA-SKYNPADVEGKWYQYWLEHRLFSS
SYV_WIGBR       ---------------------------------MK-NPYDSKKIESYFFMFWKKNNLFKK
SYV_DEIRA       -------------------------MTDPHTTTLP-TQFDPTGIEPKWAARWRSEPFRAD
SYV_THET8       -------------------------------MDLP-KAYDPKSVEPKWAEKWAKNPFVAN
SYV_THETH       -------------------------------MDLP-KAYDPKSVEPKWAEKWAKNPFVAN
SYV_THET2       -------------------------------MDLP-KAYDPKSVEPKWAEKWAKNPFVAN
SYV_HELPJ       ------------------------------MKQEP-TTYQPEEIEKKIYEICSHRGYFEI
SYV_HELPY       ----------------------------MIMKQEP-TTYQPEEIEKKIYEICSHRGYFEI
SYV_CAMJE       -------------------------------------MY-DKNLEKEYYQICEERGYFEI
SYV_CAMJR       -------------------------------------MY-DKNLEKEYYQICEERGYFEI
SYV_HELHP       -----------------------MESKAQEKQEQK-KGYNPQDIESRFYAICEKRGYFEI
SYV_WOLSU       ----------MKSIQTPSKSHTNTKETPVMSQEET-KGYNPREIEESYYKIWETRGYFEV
SYV_BORBU       -----------------------------MNCRPL-EKYDPKAFEDEIYTKWLKNNVFLP
SYV_BORBP       -----------------------------MNFRLL-EKYDPKAFEDEIYNKWLKNNVFLP
SYV_MESFL       -----------------------------MKKELE-AKYSYEIVEENRYEWWIQNEYFKA
SYV_MYCMS       -----------------------------MKKQLN-PKYDHLQVEKDKYQYWLDKNLFKA
SYV_PELUB       ---------------------------------MSNDKYIHTDVEDKIYSYWEKNNLFKP
SYV_TREDE       ------------------------MSEKLQAIELE-KSYNPKEFEERIYSFWEANKCFSP
SYV_TREPA       ------------------------MTQKLQKIVLP-PVYGPADFEARVYACWEQRQAFSP
SYV_GLOVI       -----------------------------MARTLP-SQYDPFDAEPRWQRFWEEHRFFSP
SYV_PROMP       --------------------------MNESNDELTLNNYLPSQVEQKWQKRWDSLRAFSP
SYV_PROMA       -----------------MVDQPDSENLDHAVDALS-KRYDPLGTECRWQKIWEEEGAFHP
SYV_PROMT       ------------------MIERVKTTKLSEASGLP-KTYDPVGTENRWQKAWEEKGAFKP
SYV_PROMM       ----------------MTELSAADPAFVQAADALA-KTYDPAGTESRWQCAWEESGVFHP
SYV_SYNPX       ------------------------------MPELA-KTYDPVGTEARWQQAWEDQGAFHP
SYV_THEEB       ---------------------------MTDAITLP-SQYDPKQTEAKWQQLWESSGVFHA
SYV_SYNP6       --------------------------MTTSASQLQ-TQYSPAATEVRWQKLWEETSAFQA
SYV_NOSS1       --------------------------MTATITNLP-SLYDPFTTEAKWQKFWEENQIYKA
SYV_SYNY3       -----------------------------MTTSLP-PQYEPTVTEAKWQTAWEESHAFKA
SYV_LEPIC       -----------------------------MKKQIG-DRYEPKDVENKWISLWEKKKSFAP
SYV_LEPIN       -----------------------------MKKQIG-DRYEPKDVENKWISLWEKKKSFAP
SYV_STRAW       ------------------MTENSQQQPPASEPELP-TQYAPADVEGTLYERWVERGYFEA
SYV_STRCO       ------------------MTENSQQPQPAPSTELP-TQYTPAEVEGQLYERWVERGYFEA
SYV_CORJK       MPCLARLLDLADVSDSSSKANGSNPIGADRSAQLP-AAWDPAAVEENLYQGWVDSGYFKA
SYV_CORDI       ---------MVGSRSASHQKTVKIVPMTNRADKLP-KSWDPQAVEKDLYEGWVEKGYFTA
SYV_COREF       --------------MVCVTDQNNENPSQNRADKLP-KSWDPKAVEADLYQGWVDAGYFTA
SYV_CORGL       --------------MVCVTDQNNETTSQNRADKLP-KSWDPKAVEADLYQGWVDAGYFTA
SYV_NOCFA       ------------------MTSTAPDNSRNRADALP-KSWDPSAVEAEMYERWVSAGYFTA
SYV_MYCLE       ----------------------MTTSPSSSADLLP-KSWDPGAMESVIYQKWLNSGYFAA
SYV_MYCBO       ----------------------MTASPHPAADMLP-KSWDPAAMESAIYQKWLDAGYFTA
SYV_MYCTU       ----------------------MTASPHPAADMLP-KSWDPAAMESAIYQKWLDAGYFTA
SYV_MYCPA       -----------------------MTASRSPATDLP-KSWDPPAAEYAIYRQWVDAGYFTA
SYV_BUCBP       --------------------------------MIK-KYFDPLRMEKSLYEFWEKNGYFKP
SYV_BLOFL       ----------------------------MIINTID-KIYNPKNIEESIYNFWEKSNYFEP
SYV_BLOPB       ----------------------------MSNYIVE-KIYNPKNIEEPIYKFWEYGDYFSP
SYV_BUCAI       ---------------------------------ME-KIYNPKHIEESLYFFWEKNGFFKP
SYV_BUCAP       ---------------------------------MK-KNYNPKDIEEHLYNFWEKNGFFKP
SYV_FRATT       -----------------------------MTQEIN-KNYNPKEIEQANYQNWEASGKFAC
SYV_COXBU       ---------------------------------ME-KTYDPKAIEKKWADYWEKRQLSKP
SYV_XYLFA       ------------------------------MSQFT-SSYDPTSFEARLYAAWEAAGHFKP
SYV_XYLFT       ------------------------------MSQFT-SSYDPTSFEARLYAEWEAAGHFKP
SYV_XANC8       ------------------------------MTQLA-SSYDPSSFESRLYAQWESAGHFKP
SYV_XANCP       ------------------------------MTQLA-SSYDPSSFESRLYAQWESAGHFKP
SYV_XANOR       ------------------------------MTTLA-SSYDPSSFESRLYAQWEAAGYFVP
SYV_XANC5       ------------------------------MTTLA-SSYDPSSFESRLYAQWEAAGYFVP
SYV_XANAC       ------------------------------MTTLA-SSYDPSSFESRLYAQWEAAGYFVP
SYV_LEGPA       ---------------------------------MD-KTYSPEAIEKALYKKWESHHYFQP
SYV_LEGPH       ---------------------------------MD-KTYSPEAIEKALYKKWESHHYFQP
SYV_LEGPL       ---------------------------------MD-KTYSPEAIEKALYKKWESHHYFQP
SYV_METCA       ---------------------------------MD-KVYEPHAIEQRWYQHWEASGFFAP
SYV_NITOC       ---------------------------------MD-KNYNPQAIEQYWYQIWEQKGYFTP
SYV_ACIAD       ------------------MIFIMTDAHAQSAQNIA-TTYDPTDIERKWYQIWEEKGYFKP
SYV_PSYA2       ---------MSNPNNIESSKTNLTTSIQAALSQLE-NAYNPSEVEAGMYQGWEDSGYFQP
SYV_PSEAE       ---------------------------------MD-KTYQPHAIETSWYETWESNDYFAP
SYV_PSEPK       ---------------------------------MD-KTYQPHAIETSWYNTWESENYFAP
SYV_PSEF5       ---------------------------------MD-KTYQPHAIETSWYQTWESENYFAP
SYV_PSESM       ---------------------------------MD-KTYQPHAIETSWYQTWESENYFAP
SYV_PSE14       ---------------------------------MD-KTYQPHAIETSWYQTWESENYFAP
SYV_PSEU2       ---------------------------------MD-KTYQPHAIETSWYQTWESENYFAP
SYV_IDILO       ---------------------------------MD-KTYSPAAIEQDLYQQWEDKGYFKP
SYV_MANSM       ---------------------------MTQKLQMA-DRFDASAVEQALYNHWEQKGYFKP
SYV_PASMU       ---------------------------MTQNFEMA-DRFTPSAVEQALYKHWEESGYFKP
SYV_HAEDU       ---------------------------MTQKFEMA-DRFDASAVEQALYQHWEEQGYFKP
SYV_HAEI8       ---------------------------MTQKFEMA-DRFNPSAVEQALYQHWEESGYFKP
SYV_HAEIN       ---------------------------MTQKFEMA-DRFNPSAVEQALYQRWEESGYFKP
SYV_COLP3       ----------------MLQQNNEQLLNLLPDKMME-KTFNPTDIEQSLYTSWEEQGYFSP
SYV_PHOPR       ---------------------------------ME-KTYNPQSIEQALYQRWEEAGYFKP
SYV_ALIF1       ---------------------------------ME-KTYNPQSIEQTLYQTWEEKGYFKP
SYV_VIBCH       ---------------------------------ME-KTYNPTSIEQDLYKTWEEQGYFKP
SYV_VIBVU       ---------------------------------ME-KTYNPTSIEQDLYKTWEEQGYFKP
SYV_VIBVY       ---------------------------------ME-KTYNPTSIEQDLYKTWEEQGYFKP
SYV_VIBPA       ---------------------------------ME-KTYNPTSIEQALYQTWEEKGYFKP
SYV_PHOLL       -------------------MEKTPATQTQAEPSLD-KTYNPKEIEQPLYNHWEKSGYFKP
SYV_YERPE       -------------------MENTPSHINKTEPSLD-KTYSPQEIEQPLYEHWEKQGYFKP
SYV_YERPS       -------------------MENTPSHINKTEPSLD-KTYSPQEIEQPLYEHWEKQGYFKP
SYV_PECAS       ---------------------------------ME-TKYNPQDIEQPLYEHWEKQGYFKP
SYV_SHIDS       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_ECOL6       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_ECOLI       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_ECO57       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SHIBS       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SHISS       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SHIFL       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SALPA       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SALTI       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SALCH       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_SALTY       ---------------------------------ME-KTYNPQDIEQPLYEHWEKQGYFKP
SYV_PSEHT       ---------------------------------MD-KTYNPQDIEQSLYQGWEEKGYFKP
SYV_SHEON       ---------------------------------ME-KTYDPQSIEQTLYQNWEEKGYFKP
SYV_CHRVO       ------------------------------MEQLA-KSYEPGDLERRWYQHWEQAGYFKP
SYV_NEIG1       --------------------------------MLD--KYSPAEIESKHYQNWESQGYFRP
SYV_NEIMA       --------------------------------MLD--KYSPAEIESKHYQNWEEQGYFQP
SYV_NEIMB       --------------------------------MLD--KYNPAEIESKHYQNWEEQGYFQP
SYV_NITEU       -------------------------------MELA-KSFDPKEIETRWYSTWETAGYFSP
SYV_THIDA       -------------------------------MELA-KSFEPAEIEKRWYARWESAGYFKA
SYV_BORPE       ------------------MTDAAPNQPVNESQELS-KSFEPAEIETRWYDEWAKRGYFDA
SYV_BORBR       ------------------MTDAAPNQPVNESQELS-KSFEPAEIETRWYDEWAKRGYFDA
SYV_BORPA       ------------------MTDAAPNQPVNESQKLS-KSFEPAEIETRWYDEWAKRGYFDA
SYV_BURMA       ----------------------------MSDTTLA-KSFEPQTIESQWGPEWEKRGYATP
SYV_BURPS       ----------------------------MSDTTLA-KSFEPQTIESQWGPEWEKRGYATP
SYV_CUPPJ       --------------------------MTAQDQSLA-KSFEPAAIEAKWGPEWEKRGIAQP
SYV_RALSO       --------------------------MTDPNQSLA-KSFEPAAIEQKWSAAWEAMGISRA
SYV_AROAE       -------------------------------MELA-KSFEPAAIEARWYPEWESRGHFDA
SYV_DECAR       -------------------------------MELA-KAFEPADIERRWYPEWETQNYFAA
SYV_FUSNN       ------------------------------MNELD-KNYSPNEIEEKWYKIWEDSKYFAA
SYV_BDEBA       ---------------------------MKMSEQLS-DRYNPADVESRTYEWWEKNGYFKA
SYV_GLUOX       --------------------------------MLE-KSFVPADHENALYDAWEKSGAFRA
SYV_RHOS4       -------------------------------MPMD-KTFNAAEAEARLYDAWEKAGAFRA
SYV_RUEPO       -------------------------------MAME-KTFDAAEAEARITKAWEEAGAFKA
SYV_SPHEL       ------------------------------MTELP-KTFDPAEIESRWYAHWEDEGLFRP
SYV_ZYMMO       -------------------------------MTID-KTFDPAAIESRWYTHWEEEGLFHP
SYV_CAUVC       --------------------------------MLE-KTFDPQSVEPRLYAAWEASGAFKP
SYV_NITWN       --------------------------------MIE-KTYQPSDIESRMSRVWEEAGAFKA
SYV_BRADU       --------------------------------MIE-KNYQPADIEARMSVVWEDSLAFKA
SYV_RHOPA       --------------------------------MIE-KTYQPADIEARISRAWEDAEAFKA
SYV_BARHE       --------------------------------MLE-KNYDAASIEQRIAKKWEARGAFKA
SYV_BARQU       --------------------------------MLE-KNYDAASIEQKIAKRWEARGAFKA
SYV_AGRFC       --------------------------------MLE-KTYDSASVEPKIAKAWDEANAFRA
SYV_RHIME       --------------------------------MLD-KTYDSAAVEPKIAKAWDEADAFRA
SYV_RHILO       --------------------------------MLE-KTYDAKTVEPKIAKVWEEADAFRA
SYV_BRUME       --------------------------------MLE-KTYDAAATEPKIAERWEEAGAFKA
SYV_BRUSU       --------------------------------MLE-KTYDAAATEPKIAERWEEAGAFKA
SYV_DESPS       ---------------------------MAQDSLLS-KGYEFADVEEKWLSRWHKQNAFAT
SYV_DESVH       ----------------------------MAENALP-KGYEPRDVEERWRRHWEDNRTFTP
SYV_GEOSL       ----------------------------MAEKELA-KVYEPTAVERKWYETWEQEGYFRA
SYV_PELCD       ---------------MSQSCMFCPKDELPMEPKLP-KGYEPHDVEAKWYEFWTENGLFHA
SYV_DEHM1       ------------------------MAQCSGLPEMA-KAYEAAEVEKKWYQYWMEKGYFKP
SYV_DEHMC       ------------------------MAQCSDLPEMA-KAYEAAEVEKKWYQYWMEKSYFKP
SYV_SYMTH       ----------------------MSAEQKQGGTELA-PRYDAKLVEDEYYQYWMDGGFYRA
SYV_LACCA       -------------------------MEPVSDETLA-PKYDHKAVEEGRYQEWLDEDVFKP
SYV_LACAC       ------------------------------MTDLA-PKYNPNEVEKGRYQEWLDEDLFKP
SYV_LACJO       ------------------------------MADLA-PKYNPNEVEKGRYQEWLDEDLFKP
SYV_STAS1       -------------------------------MEMK-PKYNPREVESGRYDQWVNSGYFKA
SYV_STAAR       -------------------------------MEMK-PKYDPREVEAGRYEEWVKNGYFKP
SYV_STAAC       -------------------------------MEMK-PKYDPREVEAGRYEEWVKNGYFKP
SYV_STAAN       -------------------------------MEMK-PKYDPREVEAGRYEEWVKNGYFKP
SYV_STAAS       -------------------------------MEMK-PKYDPREVEAGRYEEWVKNGYFKP
SYV_STAAW       -------------------------------MEMK-PKYDPREVEAGRYEEWVKNGYFKP
SYV_STAAM       -------------------------------MEMK-PKYDPREVEAGRYEEWVKNGYFKP
SYV_STAEQ       -------------------------------MEMK-PKYDPREVEKGRYEEWVSNGYFKP
SYV_STAES       -------------------------------MEMK-PKYDPREVEKGRYEEWVSNGYFKP
SYV_STAHJ       -------------------------------MNME-PKYNPREVEAGRYEEWVKNDYFKP
SYV_LACPL       -------------------------MSEEPTTDMP-TKYDPTAVEAGRYQTWLDQDLFKP
SYV_LACSS       ---------------------------MTDHKEMS-TKYDPNQVEDGRYQDWLKEDLFKP
SYV_ENTFA       ---------------------------MSEEKNLP-TKYQPTEIEAGRYQKWLDQDLFKP
SYV_LACLA       -----------------------------MTNELT-PKFNPTEVEAGRYEKWLEADVFKP
SYV_STRMU       -----------------------------MSTQLS-PKYNPAEVEADRYQKWLDADVFKP
SYV_STRA5       -----------------------------MSKELS-PKYNPAEVEEGRYQTWLDQDVFKP
SYV_STRA1       -----------------------------MSKELS-PKYNPAEVEAGRYQTWLDQDVFKP
SYV_STRA3       -----------------------------MSKELS-PKYNPAEVEEGRYQTWLDQDVFKP
SYV_STRT1       -----------------------------MSKELS-PKYNPAEVEAGRYQKWLDEDVFKP
SYV_STRT2       -----------------------------MSKELS-PKYNPAEVEAGRYQKWLDEDVFKP
SYV_STRP1       ------------------------------MTELS-PKYNPAEVEAGRYQKWLDADVFKP
SYV_STRPM       ------------------------------MTELS-PKYNPAEVEAGRYQKWLDADVFKP
SYV_STRP6       ------------------------------MTELS-PKYNPAEVEAGRYQKWLDADVFKP
SYV_STRP3       ------------------------------MTELS-PKYNPAEVEAGRYQKWLDADVFKP
SYV_STRP8       ------------------------------MTELS-PKYNPAEVEAGRYQKWLDADVFKP
SYV_STRPN       -----------------------------MSKELS-PKYNPAEVEAGRYQKWLDADVFKP
SYV_STRR6       -----------------------------MSKELS-SKYNPAEVEAGRYQKWLDADVFKP
SYV_LISIN       -------------------------MTEQNEINMP-TKYEPSNVEAGKYKWWLEKEFFKA
SYV_LISMF       ------------------------MTIEHNEINMP-TKYEPSNVEAGKYKWWLEKEFFKA
SYV_LISMO       ------------------------MTTEHNEINMP-TKYEPSNVEAGKYKWWLEKEFFKA
SYV_OCEIH       -----------------------MEQDKENKQSLP-SKYNPKEVEEGRYQFWLDGKFFEA
SYV_BACC1       --------------------------MSNTEKNLP-TKYDHMSVEEGLYQWWLEGKYFEA
SYV_BACCZ       --------------------------MSNTEKNLP-TKYDHMSVEEGLYQWWLEGKYFEA
SYV_BACCR       --------------------------MSNTEKNLP-TKYDHMSVEEGLYQWWLEGKYFEA
SYV_BACAN       --------------------------MSNTEKNLP-TKYDHMSVEEGLYQWWLEGKYFEA
SYV_BACHK       --------------------------MSNTEKNLP-TKYDHMSVEEGLYQWWLEGKYFEA
SYV_BACSK       ---------------------------MEEQHSMP-TKYDPSATEKKWYTYWLKGKFFEA
SYV_BACHD       --------------------------MTKQDQEMP-TKYHPQDIESKWYEYWIEGKFFEA
SYV_GEOSE       --------------------------MAQHEVSMP-PKYDHRAVEAGRYEWWLKGKFFEA
SYV_GEOKA       --------------------------MAQHEVSMP-PKYDHRAVEAGRYEWWLKGKFFEA
SYV_BACLD       --------------------------MDNQELTMP-TKYDPSAVEKDRYDYWVNGKFFEA
SYV_BACSU       --------------------------METNEQTMP-TKYDPAAVEKDRYDFWLKGKFFEA
SYV_THEMA       ------------------------------MAELS-TRYNPAEIETKWYRYWEEKGYFTP
SYV_CARHZ       -----------------------------MTVTLP-SVYSPQEVERKWYKYWEENGFFHT
SYV_CALS4       ------------------------------MKDIA-KTYNPKEFEDRIYSFWMEKGFFTP
SYV_CLOPE       ----------------------------MDNKNIS-TTYNPKEFEERLYSNWQEKKYFTP
SYV_CLOAB       ---------------------------MKEFDEMA-KTYDPKEFEDRIYKWWEEEGFFTP
SYV_CLOTE       ---------------------------MNDNINIA-KTYDPKEFEERIYKMWEEGEYFTP
                                                      :     .               

SYV_MYCGA       ----D-------------SDFCDP----NAKP--FSIIMPPPNLTGILHIGHAWNLSIQD
SYV_MYCGE       ----------------------KD----KNNS--FTAILPPPNLTGTLHIGHAFEVSITD
SYV_MYCPN       ----------------------QK----NKVP--FTAILPPPNLTGTLHIGHAFEVSITD
SYV_MYCPE       --KNL-----------------KA----NKNS--YSILLPPPNVTGNLHLGHALNGTIQD
SYV_MYCS5       ----H-----------------NL----DKKP--FSILLPPPNVTGKLHLGHALDSYIPD
SYV_MYCH2       ------------------P---KQ----TKKP--FSIISPPPNVTGQLHLGHSWNAFIQD
SYV_MYCH7       ------------------P---KQ----TKKP--FSIISPPPNVTGQLHLGHSWNAFIQD
SYV_MYCHJ       ------------------P---KQ----TKKP--FSIISPPPNVTGQLHLGHSWNAFIQD
SYV_MYCMO       ----H-----------------DL----TKKP--FSILLPPPNVTGKLHIGHAWNTTLQD
SYV_MYCPU       ----H-----------------DL----DKKP--FSIILPPPNVTGQLHLGHALNGYLQD
SYV_PARUW       ----N-------------P---LS----NKPT--YCIVIPPPNVTGVLHMGHALVNTVQD
SYV_CHLPN       ----E-------------A---SS----DKPP--YSVIMPPPNVTGVLHMGHALVNTLQD
SYV_CHLMU       ----D-------------A---NS----KKPA--YSIVMPPPNVTGILHMGHALVNTLQD
SYV_CHLTR       ----N-------------A---SS----EKPA--YSIVMPPPNVTGILHMGHALVNTLQD
SYV_CHLAB       ----Q-------------A---AS----DKPP--YAIIMPPPNVTGILHMGHALVNTLQD
SYV_CHLCV       ----Q-------------S---AS----DKPP--YAIIMPPPNVTGILHMGHALVNTLQD
SYV_ONYPE       ----N-------------P---NA----NKKT--FTVVIPPPNVTGKLHLGHAWNNTIQD
SYV_UREPA       ----Q-------------I---NS----TKKP--FTIVLPPPNVTGHLHIGHAYDFTLSD
SYV_PORGI       ----V-----------------PD----GRKP--YTVVIPPPNVTGVLHMGHMLNNTIQD
SYV_BACFN       ----K-----------------PD----GREP--YTIVIPPPNVTGVLHMGHMLNNTIQD
SYV_BACFR       ----K-----------------PD----GREP--YTIVIPPPNVTGVLHMGHMLNNTIQD
SYV_BACTN       ----K-----------------PD----GREP--YTIVIPPPNVTGVLHMGHMLNNTIQD
SYV_WIGBR       ----K-------------L---NS----NKDN--FCIILPPPNITGDLHVGHAFQQSIID
SYV_DEIRA       ----A-----------------TS----GKDP--FTIVIPPPNVTGNLHLGHALDNTLID
SYV_THET8       ------------------P---KS----GKPP--FVIFMPPPNVTGSLHMGHALDNSLQD
SYV_THETH       ------------------P---KS----GKPP--FVIFMPPPNVTGSLHMGHALDNSLQD
SYV_THET2       ------------------P---KS----GKPP--FVIFMPPPNVTGSLHMGHALDNSLQD
SYV_HELPJ       ----N-------------G---NEKIQEKGKR--FCLMMPPPNVTGILHIGHALTLSLQD
SYV_HELPY       ----D-------------G---NEAIQEKNKR--FCLMMPPPNVTGVLHIGHALTLSLQD
SYV_CAMJE       ----D-------------G---NKTIQEKDKN--FCIMMPPPNVTGVLHIGHALTFTLQD
SYV_CAMJR       ----D-------------G---NKTIQEKDKN--FCIMMPPPNVTGVLHIGHALTFTLQD
SYV_HELHP       ----E-------------G---NKSLWQGCAPKCFSIMMPPPNVTGVLHIGHALTFTLQD
SYV_WOLSU       ----E-------------G---NAQIQKPNQN--FAVMLPPPNVTGSLHIGHALNHTLID
SYV_BORBU       ----D-----------------NS----LFEK--FSMVAPPPNVTGVLHMGHALNFVLQD
SYV_BORBP       ----N-----------------NS----LFEK--FSMVAPPPNVTGVLHMGHALNFVLQD
SYV_MESFL       ----N-------------P---DS----KKPK--FSIVLPPPNVTGKLHIGHAWDGSLQD
SYV_MYCMS       ----D-------------I---NS----NKPK--FSIILPPPNVTGKLHIGHAWDTSLQD
SYV_PELUB       ----------------------TK----NKKQ--FSVVIPPPNVTGSLHMGHALNNSIQD
SYV_TREDE       --IKK-----------------KN----TKNT--FTVVIPPPNVTGVLHVGHALDETLQD
SYV_TREPA       --RARGSGTSDSEGCDGHSRQIEG----GART--FVIAIPPPNITGVLHMGHCLNTVLQD
SYV_GLOVI       ----A-------------A---DG----PGKP--FSLVLPPPNVTGSLHMGHALCFTLPD
SYV_PROMP       ----N-------------P---SD----NGDP--FCIVIPPPNVTGSLHMGHAFNTALID
SYV_PROMA       ----D-------------P---ND----EGEP--FSVVIPPPNVTGSLHMGHAFNTALID
SYV_PROMT       ----D-------------P---SA----PGDP--FSVVIPPPNVTGSLHMGHAFNTALID
SYV_PROMM       ----D-------------P---QA----AGEP--FSVVIPPPNVTGSLHMGHAFNTALID
SYV_SYNPX       ----D-------------P---KA----PGEP--FSVVIPPPNVTGSLHMGHAFNTALID
SYV_THEEB       ----D-------------P---NH----PGKP--YCIVIPPPNVTGSLHMGHAFEHALID
SYV_SYNP6       ----N-------------S---QS----SAEP--YCIVIPPPNVTGSLHMGHAFEASLID
SYV_NOSS1       ----D-------------P---NK----GGEP--YCVVIPPPNVTGSLHMGHAFESALID
SYV_SYNY3       ----D-------------P---DR----PGEP--YCVVIPPPNVTGSLHMGHAFESSLID
SYV_LEPIC       ----N-----------------SN----ARES--FSIVIPPPNVTGSLHIGHALNHTIQD
SYV_LEPIN       ----N-----------------SN----ARES--FSIVIPPPNVTGSLHIGHALNHTIQD
SYV_STRAW       ----D-------------A---KS----DKPP--FTVVIPPPNVTGSLHLGHAFEHTLID
SYV_STRCO       ----D-------------A---KS----DKPP--YTVVIPPPNVTGSLHLGHAFEHTLID
SYV_CORJK       ----D-------------P---SS----DKPP--FSIVLPPPNVTGQLHMGHALDHTLMD
SYV_CORDI       ----D-------------P---SS----SKPA--FSIVLPPPNVTGQLHMGHALDHTLMD
SYV_COREF       ----D-------------P---AS----EKPG--YSIVLPPPNVTGQLHMGHALDHTLMD
SYV_CORGL       ----D-------------P---AS----DKPG--FSIVLPPPNVTGQLHMGHALDHTLMD
SYV_NOCFA       ----D-------------P---AS----GKPA--YSIVLPPPNVTGTLHMGHALDHTLMD
SYV_MYCLE       ----D-------------P---AS----TKPG--YSIVLPPPNVTGSLHMGHALEHTMMD
SYV_MYCBO       ----D-------------P---TS----TKPA--YSIVLPPPNVTGSLHMGHALEHTMMD
SYV_MYCTU       ----D-------------P---TS----TKPA--YSIVLPPPNVTGSLHMGHALEHTMMD
SYV_MYCPA       ----N-------------P---AS----DKPG--YSIVLPPPNVTGSLHMGHALEHTMMD
SYV_BUCBP       ----Q-------------N---NK----GKPN--FCIVMPPPNITGNLHIGHAFQQTIMD
SYV_BLOFL       ----D------------II---NN----YKKN--YCIMMPPPNITGGLHLGHAFQQTIMD
SYV_BLOPB       ----H-------------G---NT----SQES--YCIMMPPPNITGQLHLGHAFQQTIMD
SYV_BUCAI       ----N-----------------HL----EKST--FCIMMPPPNITGSLHMGHAFQQTIMD
SYV_BUCAP       ----N-------------N---NL----NKPA--FCIMMPPPNITGNLHMGHAFQQTIMD
SYV_FRATT       ----G-------------N---TD----SKDT--YTIMLPPPNVTGTLHMGHGFQMSLMD
SYV_COXBU       ----T-------------A---QG------SP--YCIMLPPPNVTGTLHMGHGFQQTLMD
SYV_XYLFA       ----S-------------G---TG------QP--YTILLPPPNVTGTLHMGHAFQQTLMD
SYV_XYLFT       ----S-------------G---VG------QP--YTILLPPPNVTGTLHMGHAFQQTLMD
SYV_XANC8       ----S-------------G---SG------EP--YTVLLPPPNVTGTLHMGHAFQQTLMD
SYV_XANCP       ----S-------------G---SG------EP--YTVLLPPPNVTGTLHMGHAFQQTLMD
SYV_XANOR       ----S-------------D---TG------EP--YTVLLPPPNVTGTLHMGHAFQQTLMD
SYV_XANC5       ----S-------------G---KG------EP--YTVLLPPPNVTGTLHMGHAFQQTLMD
SYV_XANAC       ----S-------------G---KG------EP--YTVLLPPPNVTGTLHMGHAFQQTLMD
SYV_LEGPA       ----R-------------G---EG------KR--FCIMLPPPNVTGSLHMGHGFQHTIMD
SYV_LEGPH       ----R-------------G---EG------KR--FCIMLPPPNVTGSLHMGHGFQHTIMD
SYV_LEGPL       ----R-------------G---EG------KR--FCIMLPPPNVTGSLHMGHGFQHTIMD
SYV_METCA       ----V-------------G---EG------AP--YCIMIPPPNVTGSLHMGHAFQDTVMD
SYV_NITOC       ----Q-------------G---KD------SS--YCIMIPPPNVTGHLHMGHAFQSTIMD
SYV_ACIAD       ----S-------------G---QG------DS--FCIMIPPPNVTGSLHMGHGFNNAIMD
SYV_PSYA2       ----T-----------------FD----KDES--FSIALPPPNVTGSLHMGHGFNNAIMD
SYV_PSEAE       ----S-------------G---EG------QP--YTIMIPPPNVTGSLHMGHGFNNAIMD
SYV_PSEPK       ----Q-------------G---AG------ES--YTIMIPPPNVTGSLHMGHGFNNAIMD
SYV_PSEF5       ----Q-------------G---AG------DS--YTIMIPPPNVTGSLHMGHGFNNAIMD
SYV_PSESM       ----Q-------------G---AG------DS--YTIMIPPPNVTGSLHMGHGFNNAIMD
SYV_PSE14       ----Q-------------G---VG------DS--YTIMIPPPNVTGSLHMGHGFNNAIMD
SYV_PSEU2       ----Q-------------G---VG------DS--YTIMIPPPNVTGSLHMGHGFNNAIMD
SYV_IDILO       ----S-------------G---KG------DP--YSIMIPPPNVTGSLHMGHAFQHTIMD
SYV_MANSM       ----S-------------Y---DA----GRPS--YSIAIPPPNVTGSLHMGHAFQQTLMD
SYV_PASMU       ----S-------------E---DT----SKPS--YSIAIPPPNVTGSLHMGHAFQQTLMD
SYV_HAEDU       ----S-------------E---NP----AVPS--YCIAIPPPNVTGSLHMGHAFQQTLMD
SYV_HAEI8       ----S-------------E---NE----NAPS--YCIAIPPPNVTGSLHMGHAFQQTLMD
SYV_HAEIN       ----S-------------E---NE----NAPS--YCIAIPPPNVTGSLHMGHAFQQTLMD
SYV_COLP3       ----T-------------G---EG------DS--YSIAIPPPNVTGSLHMGHAFQQTIMD
SYV_PHOPR       ----H-------------G---DT----SKDA--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_ALIF1       ----H-------------G---DT----SKEA--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_VIBCH       ----H-------------G---DT----SKDA--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_VIBVU       ----H-------------G---DT----SKES--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_VIBVY       ----H-------------G---DT----SKES--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_VIBPA       ----H-------------G---DT----TKES--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_PHOLL       ----N-------------G---DT----SRES--FCIVIPPPNVTGSLHMGHAFQQTIMD
SYV_YERPE       ----N-------------G---DT----SKES--YCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_YERPS       ----N-------------G---DT----SKES--YCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_PECAS       ----H-------------G---NT----SKES--FSIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SHIDS       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_ECOL6       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_ECOLI       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_ECO57       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SHIBS       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SHISS       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SHIFL       ----N-------------G---DE----SQES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SALPA       ----N-------------G---DE----SKES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SALTI       ----N-------------G---DE----SKES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SALCH       ----N-------------G---DE----SKES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_SALTY       ----N-------------G---DE----SKES--FCIMIPPPNVTGSLHMGHAFQQTIMD
SYV_PSEHT       ----------------------SG----QGVP--YSIMIPPPNVTGSLHMGHAFQDTIMD
SYV_SHEON       ----H-------------G---DA----SQGN--YCIMIPPPNVTGSLHMGHAFQDTIMD
SYV_CHRVO       ----S-------------M---DT----SKPS--FAIQLPPPNVTGTLHMGHAFNQTIMD
SYV_NEIG1       ----D-------------M---DL----TKPS--FSIQLPPPNVTGTLHMGHAFNQTIMD
SYV_NEIMA       ----D-------------M---DL----TKPS--FSIQLPPPNVTGTLHMGHAFNQTIMD
SYV_NEIMB       ----D-------------M---DL----TKPS--FSIQLPPPNVTGTLHMGHAFNQTIMD
SYV_NITEU       ----T-------------D---HK----GADP--YCIMLPPPNVTGTLHMGHAFQHTLMD
SYV_THIDA       ----R-------------D---KP----DAPA--YCIMLPPPNVTGTLHMGHAFQHTLMD
SYV_BORPE       ----G------------RHVETGT----DPQP--YVIQFPPPNVTGTLHMGHAFNQTIMD
SYV_BORBR       ----G------------RHVETGT----DPQP--YVIQFPPPNVTGTLHMGHAFNQTIMD
SYV_BORPA       ----G------------RHVETGT----DPQP--YVIQFPPPNVTGTLHMGHAFNQTIMD
SYV_BURMA       ----A-------------L---DP----SRPD--FSIQLPPPNVTGTLHMGHAFNQTIMD
SYV_BURPS       ALD-P-----------------------SRPD--FSIQLPPPNVTGTLHMGHAFNQTIMD
SYV_CUPPJ       ----T-------------F---DP----AKPD--FAIQLPPPNVTGTLHMGHAFNQTIMD
SYV_RALSO       ----T-------------L---EA----GRPD--FCIQLPPPNVTGTLHMGHAFNQTIMD
SYV_AROAE       --GLD-----------------KS----NPNA--FCILLPPPNVTGTLHMGHGFNQTIMD
SYV_DECAR       --GVD-----------------AS----KADN--FCILLPPPNVTGTLHMGHGFNQTIMD
SYV_FUSNN       ----S-------------L---SS----EKEN--YSIVIPPPNVTGILHMGHVLNNSIQD
SYV_BDEBA       ----Q-------------D---QS----TKPP--FSIILPPPNVTGFLHMGHALDHTIQD
SYV_GLUOX       ----H-------------P---DQ----PGEP--FSIMFPPPNVTGTLHLGHSLNFVLQD
SYV_RHOS4       --GAN-----------------AS----RPET--FCIMIPPPNVTGSLHMGHAFNNTLQD
SYV_RUEPO       --GAN-----------------RS----RDES--FTIMIPPPNVTGALHVGHAFNNTLQD
SYV_SPHEL       ----E-----------------RT----GAEP--WTIVNPPPNVTGSLHIGHALDNTLQD
SYV_ZYMMO       ----E-----------------RP----GADP--FTLVIPPPNVTGSLHIGHALDDTLQD
SYV_CAUVC       ----A-------------E---DP----NAEP--FVIVIPPPNVTGSLHIGHALNNTLQD
SYV_NITWN       --GRP-------------E---RR----EAEP--FTIVIPPPNVTGSLHMGHALNNTLQD
SYV_BRADU       --GRP-------------D---RR----DAVP--FTIVIPPPNVTGSLHMGHALNNTLQD
SYV_RHOPA       --GRP-------------E---RR----DAVP--YSIVIPPPNVTGSLHMGHALNNTLQD
SYV_BARHE       --GMG-------------S---KS----AAQS--FCVMLPPPNVTGSLHMGHALNTTIQD
SYV_BARQU       --GMG-------------A---KS----GTEP--FCVMLPPPNVTGSLHMGHALNTTIQD
SYV_AGRFC       --GAN-------------A---KP----GAET--FTIVIPPPNVTGSLHMGHALNNTLQD
SYV_RHIME       --GVN-------------A---KP----DAET--FTIVIPPPNVTGSLHMGHALNNTLQD
SYV_RHILO       --GAG-------------A---EE----GAEA--FTIVIPPPNVTGSLHMGHALNNTLQD
SYV_BRUME       --GAG-------------A---KP----GADP--FAVVIPPPNVTGSLHMGHALNNTIQD
SYV_BRUSU       --GAG-------------A---KP----GADP--FAVVIPPPNVTGSLHMGHALNNTIQD
SYV_DESPS       ----K-------------M---ED----GKDA--FSIVIPPPNVTGVLHVGHALNNTLQD
SYV_DESVH       ----D-------------M---DA----PGEP--YSIVIPPPNVTGALHIGHALNHVLID
SYV_GEOSL       ----N-------------P---DS----GKPS--YSIVIPPPNVTGALHMGHALNNTLQD
SYV_PELCD       ----D-------------E---NS----PKNP--FSIVIPPPNVTGVLHMGHALNNTLQD
SYV_DEHM1       ----N-------------P---DS----DKKP--FVIIMPPPNVTGELHLGHALTATLED
SYV_DEHMC       ----N-------------P---NS----DKKP--FVIIMPPPNVTGELHLGHALTATLED
SYV_SYMTH       ----P-------------I---VE----GKQP--YTIVIPPPNVTGTLHLGHALNNTMID
SYV_LACCA       ----S-------------G---DK----KAKP--YSIVIPPPNVTGKLHMGHAWDTTLQD
SYV_LACAC       ----S-------------G---DK----KAHP--YSIVIPPPNVTGKLHLGHAWDTAIQD
SYV_LACJO       ----S-------------G---DK----KAHP--YSIVIPPPNVTGKLHLGHAWDTAIQD
SYV_STAS1       ----K-------------D---DQ----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAAR       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAAC       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAAN       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAAS       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAAW       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAAM       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAEQ       ----S-------------E---DK----SKEA--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAES       ----S-------------E---DK----SKEA--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STAHJ       ----S-------------E---DK----SKET--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_LACPL       ----S-------------G---DK----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_LACSS       ----N-------------A---NP----DAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_ENTFA       ----S-------------G---DK----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_LACLA       ----S-------------G---NP----DAEP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRMU       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLPD
SYV_STRA5       ----S-------------G---DT----EAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRA1       ----S-------------G---DA----EAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRA3       ----S-------------G---DT----EAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRT1       ----S-------------G---DK----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRT2       ----S-------------G---DK----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRP1       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRPM       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRP6       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRP3       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRP8       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRPN       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_STRR6       ----S-------------G---DQ----KAKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_LISIN       ----E-------------G---NS----DKKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_LISMF       ----E-------------G---NT----DKKP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_LISMO       ----E-------------G---NT----DKEP--YSIVIPPPNVTGKLHLGHAWDTTLQD
SYV_OCEIH       ----T-------------G---DP----DKEP--YSIVIPPPNVTGRLHLGHAWDTSMQD
SYV_BACC1       ----T-------------G---DE----KKQP--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_BACCZ       ----T-------------G---DE----KKQP--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_BACCR       ----T-------------G---DE----KKQP--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_BACAN       ----T-------------G---DE----KKQP--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_BACHK       ----T-------------G---DE----KKQP--YTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_BACSK       ----T-------------G---DP----DKQP--YSIVIPPPNVTGKLHLGHAWDATIQD
SYV_BACHD       ----T-------------S---DE----TKKP--YTIVIPPPNVTGKLHLGHAWDTALQD
SYV_GEOSE       ----T-------------G---DP----NKRP--FTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_GEOKA       ----T-------------G---DP----NKRP--FTIVIPPPNVTGKLHLGHAWDTTLQD
SYV_BACLD       ----K-------------N---DP----EKEP--YTVVIPPPNVTGKLHLGHAWDSTLQD
SYV_BACSU       ----G-------------S---DQ----TKEP--YSVVIPPPNVTGRLHLGHAWDTTLQD
SYV_THEMA       ----------------------KG----VGEK--FSIVIPPPNITGRIHMGHALNITLQD
SYV_CARHZ       ----E-----------------PD----EREP--FCIVMPPPNVTGQLHMGHALDNTMQD
SYV_CALS4       ----E-------------I---DP----EKKP--FTIVIPPPNVTGELHMGHALDNTLQD
SYV_CLOPE       ----V-------------I---DK----SKKP--YTIIMPPPNITGKLHLGHALDNTLQD
SYV_CLOAB       ----K-------------V---DK----NKKP--YTIMMPPPNITGKLHLGHALDCALQD
SYV_CLOTE       ----K-------------V---DK----DKKP--YTIVMPPPNITGKLHLGHALDNSMQD
                                                  :    ****:** :*:**     : *

SYV_MYCGA       LIVRYQKLVMGKINWIPGTDHAGIATQTKFESIQRTK--EINYKKDDRTTHFNNIYQWSQ
SYV_MYCGE       QIMRFKKMQGFSINWIPGFDHAGIATQTKYEKIALKE--NQKYFDADDDKKSEMIMNWAL
SYV_MYCPN       QIMRFKRLRGYGVNWIPGFDHAGIATQTKYEKLARET--NPEYFQAPRKQKVKMIMDWAL
SYV_MYCPE       CLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLREN--KISNKDKSRDEKVADLFEWSQ
SYV_MYCS5       TIIRFKKLSGYDVLWLPGMDHAGIATQSKVESELYKQ-NKLTRHDLGKEKFLAEVWKWKE
SYV_MYCH2       SLVRYHKLQGFDVLLLPSVDHAGIATQVKVEEDLAKK--GIKKSDLKREEFIKKCYHWKE
SYV_MYCH7       SLVRYHKLQGFDVLLLPSVDHAGIATQVKVEEDLAKK--GIKKSDLKREEFIKKCYHWKE
SYV_MYCHJ       SLVRYHKLQGFDVLLLPSVDHAGIATQVKVEEDLAKK--GIKKSDLKREEFIKKCYHWKE
SYV_MYCMO       FLIRLKRLQGYDVLWLPGTDHAGIATQAKVEKRLLDQ--KIFKSDLTKEELFEKAMDWKN
SYV_MYCPU       SVIRYKKLEGYDVLFLPAMDHAGIATQIKVEESLAKE--NLLKQDIGREKFLKFSYQWKD
SYV_PARUW       ILIRWKRMLGFETLWVPGTDHAGIATQMVVERHLIKT-EGKKRTDYTREEFLKHVWTWKE
SYV_CHLPN       VLVRYKRMSGFEVCWIPGTDHAGIATQAVVERHLQAS-EGKRRTDYSREDFLKHIWAWKE
SYV_CHLMU       MLIRYKRMKGFEVCWVPGTDHAGIATQTVVERHLRSS-LGKRRTDFSREEFLKHVWEWKE
SYV_CHLTR       TLIRYKRMQGFEVCWVPGTDHAGIATQTVVERHLKAS-LGKQRTDFSREEFLKHVWDWKE
SYV_CHLAB       VLIRYKRMSGFEVCWVPGTDHAGIATQTVVERHLYSS-LGKRRVDFSREEFLEHVWQWKE
SYV_CHLCV       VLIRYKRMSGFEVCWVPGTDHAGIATQTVVERHLYAS-LGKRRIDFSREEFIKHVWEWKE
SYV_ONYPE       IIIRFKKMQGFDVLFLPGMDHAGIATQNKVKEQLKQE--GLLTKTLSKEIFLKYAWQWKE
SYV_UREPA       ILMRYKKLKGYDSFIIPGTDHAGIATQTKFEKNLKVN-AQTNRFNLGRELFLEKLKIWKD
SYV_PORGI       ILVRRARMKGYNACWVPGTDHASIATEAKVVGRLAAQ--GISKQDLGREEFLRHAWDWTH
SYV_BACFN       ILVRRARMEGKNACWVPGTDHASIATEAKVVNKLAAQ--GIKKTDLSRDEFLKHAWAWTD
SYV_BACFR       ILVRRARMEGKNACWVPGTDHASIATEAKVVNKLAAQ--GIKKTDLSRDEFLKHAWAWTD
SYV_BACTN       ILVRRARMEGKNACWVPGTDHASIATEAKVVNKLAAQ--GIKKTDLTRDEFLKHAWDWTE
SYV_WIGBR       IFIRYNYMKGNNVLLQSGIDHAGISTQSILEKKIYFY-ENKNRFDYGRKNFIKEIWKWKE
SYV_DEIRA       TLIRYKRMAGFEALYLPGMDHAGISTQVVVERQLKDA--GTSRHDLGREAFLEKVWEWKG
SYV_THET8       ALIRYKRMRGFEAVWLPGTDHAGIATQVVVERLLLKE--GKTRHDLGREKFLERVWQWKE
SYV_THETH       ALIRYKRMRGFEAVWLPGTDHAGIATQVVVERLLLKE--GKTRHDLGREKFLERVWQWKE
SYV_THET2       ALIRYKRMRGFEAVWLPGTDHAGIATQVVVERLLLKE--GKTRHDLGREKFLERVWQWKE
SYV_HELPJ       ILVRYKRMDGYKTLYQPGLDHAGIATQNVVEKQLLSQ--GVKKEDLGREKFIQKVWEWKE
SYV_HELPY       ILARYKRMDGYKTLYQPGLDHAGIATQNVVEKQLLSQ--GIKKEDLGREEFIKKVWEWKE
SYV_CAMJE       IMTRYKRMDGYKVLYQPGLDHAGIATQNVVEKQLLTQ--GIKKEELGREEFIEKVWEWKE
SYV_CAMJR       IMTRYKRMDGYKVLYQPGLDHAGIATQNVVEKQLLAQ--GIKKEELGREEFIEKVWEWKE
SYV_HELHP       IITRFKRMEGFKTLYQPGLDHAGIATQNVVLKQLLAQ--GITKESLGREAFIAKVWEWKE
SYV_WOLSU       IMTRYKRMDGYKTLWQPGTDHAGIATQNVVEKRLLSK--GIKKEELGREAFLEKVWEWRE
SYV_BORBU       VLVRYKRMKRHNTLWLFGTDHAGIATQAVFERHLKKI--GKSKDDFEREELVQEIFKLKD
SYV_BORBP       ILVRYKRMKKHNTLWLFGTDHAGIATQTVFERNLKNI--GKSKNDFEREEFVKEIFKLKD
SYV_MESFL       AIIRFKKLNGFDVLYLPGMDHAGISTQVKVEAKLREQ--GISRFELGREKFLEQAWKWKH
SYV_MYCMS       AIIRFKKLTGYDTLFLPGMDHSGISTQVKVEAKLKQQ--GIDKNKLGREKFLLEAWKWKE
SYV_PELUB       LLVRYHRMNNYETLWQPGTDHAGIATQALVEKKLTAD--GIDKNEIGREKFIEKVWEWKE
SYV_TREDE       VIVRYHRMKGDETLWIPGTDHAGIATQSVVEKKLKAE--GKNRRDLGREAFIEKVWEVKN
SYV_TREPA       IVIRYQRMAGACTLWIPGTDHAGIATQHVVERALRKE--GIHKREVTREQFVARTQQIKD
SYV_GLOVI       VVVRYRRMKGFKTLWLPGTDHASIAVHTVLEKQLRQE--GKTRFDLGREAFLERAWAWKE
SYV_PROMP       VIIRFQRLLGKNVLCLPGTDHASIAVQTILEKQLKTE--GKNSEDIGREEFLKRAWIWKE
SYV_PROMA       TIVRFQRLQGKNVLCLPGTDHASIAVQTILEKQLKKE--GLTRDELGRSAFLERAWAWKS
SYV_PROMT       TVVRYKRLKGNNVLCLPGTDHASIAVQTILERQLKEE--GKNRRDLGRASFLEKAWEWKE
SYV_PROMM       TIVRFQRLQGKNVLCLPGTDHASIAVQTILEKQLKAE--AISRYDLGREAFLERAWAWKE
SYV_SYNPX       TIVRYQRLAGKNVLCLPGTDHASIAVQTILEKQLKQE--GKTRHHLGRDGFLERAWQWKA
SYV_THEEB       VLIRYHRMIGRNVLWLPGTDHASIAVSTILDQQLQAE--GTNRFALGREAYLKRAWAWKE
SYV_SYNP6       VLIRFQRMRGKNALWLPGTDHASIAVQTILDRQLREE--GLSRYDLGREKFLERAWQWKA
SYV_NOSS1       TLVRYHRMQGRNTLWLPGTDHASIAVHTILEKQLKAE--GKTRQELGREKFLERSWQWKA
SYV_SYNY3       TLVRYHRMRGDNTLWLPGTDHASIAVQTILERQLKAE--GKTRDDLGREKFLERAWQWKA
SYV_LEPIC       ILVRIERKKGKSTLWLPGMDHAGIATQMVVERELAKE--SKKRTDFTREEFIHKVWEWKN
SYV_LEPIN       ILVRIERKKGKSTLWLPGMDHAGIATQMVVERELAKE--SKKRTDFTREEFIHKVWEWKN
SYV_STRAW       ALTRRKRMQGYETLWQPGMDHAGIATQNVVERELGKE--GKSRHDLGRAAFVERVWQWKA
SYV_STRCO       ALTRRKRMQGYETLWQPGMDHAGIATQNVVERELGKE--GKSRHDLGREAFVERVWQWKS
SYV_CORJK       AMARRKRMQGFEVLWLPGSDHAGIATQTKVEANLKET-EGKDRFDYGRDAFVGKVWEWKD
SYV_CORDI       GIARRKRMQGYEVLWLPGMDHAGIATQTKVEAMLKET-EGKSRWDYSREEFIEHVWEWKR
SYV_COREF       ALARRKRMQGFEVLWLPGMDHAGIATQTKVEEMLKET-EGKSRYDYSREEFIEKVWEWKK
SYV_CORGL       ALARRKRMQGFEVLWLPGMDHAGIATQTKVEEMLKET-EGKTRYDYDREEFIAKVWEWKQ
SYV_NOCFA       TLARRKRMQGYEVLWLPGMDHAGIATQTVVEKQLAVD--GKTKEDFGRELFVEKVWDWKR
SYV_MYCLE       ALTRRKRMQGYEVLWQPGMDHAGIATQSVVEKQLAIN--GKIKEDFGRELFVDKVWDWKR
SYV_MYCBO       ALTRRKRMQGYEVLWQPGTDHAGIATQSVVEQQLAVD--GKTKEDLGRELFVDKVWDWKR
SYV_MYCTU       ALTRRKRMQGYEVLWQPGTDHAGIATQSVVEQQLAVD--GKTKEDLGRELFVDKVWDWKR
SYV_MYCPA       ALTRRKRMQGYEVLWQPGMDHAGIATQSVVEKQLAVD--GKTKEDFGRELFIEKVWDWKR
SYV_BUCBP       ILIRYNRMIGKNTFWQVGTDHAGIATQIVVEKKILKE-ENKTVQQLGKKEFLERIWKWKN
SYV_BLOFL       ILVRYQRMNGKNVLWASGLDHAGIATQILIEKNFYNK-KNSIKDNHDPHSLIKEVWLWKE
SYV_BLOPB       VLIRYQRMQGKNTLWQTGTDHAGIATQMLVEHKIYNN-TGKTRHDYTRDELIKNIWAWKS
SYV_BUCAI       ILIRYHRMQGKNTFWQVGTDHAGIATQILVERQIFEK-EQKTKKDYSRDDFIKKIWEWKK
SYV_BUCAP       ILIRYNRMQGKNTLWQVGTDHAGIATQILIERQIFSE-ERKTKKDYSRNDFIKKIWKWKK
SYV_FRATT       ILIRYNRMSGKDTLWQPGTDHAGIATQMVVERQLNAQ--GISRHDLGRENFVSKVWEWKE
SYV_COXBU       TLIRYHRMKGERTLWQGGTDHAGIATQMVVEQQLAQE--DLTREDLGRQAFIKRVWEWRE
SYV_XYLFA       ALVRYHRMCGDDTLWQVGTDHAGIATEMVVSRNVVLEGHGETRDSLGRDGFINKVWEWKQ
SYV_XYLFT       ALVRYHRMCGDDTLWQVGTDHAGIATEMVVSRNMALEGRGETRDSLGREGFINKVWEWKQ
SYV_XANC8       ALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGETRDTLGREGFIAKVWEWKA
SYV_XANCP       ALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGETRDTLGREGFIAKVWEWKA
SYV_XANOR       ALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGETRDSLGREGFIAKVWEWKA
SYV_XANC5       ALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGQTRDSLGREGFIAKVWEWKA
SYV_XANAC       ALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGQTRDSLGREGFIAKVWEWKA
SYV_LEGPA       ALTRYHRMLGDKTLWQPGTDHAGISTQLVVERQLEAQ--GVSRKDLTREQFLDKVWQWKE
SYV_LEGPH       ALTRYHRMLGDKTLWQPGTDHAGISTQLVVERQLEAQ--GVSRKDLTREQFLDKVWQWKE
SYV_LEGPL       ALTRYHRMLGDKTLWQPGTDHAGISTQLVVERQLEAQ--GVSRKELTREQFLDKVWQWKE
SYV_METCA       VLIRYHRMKGDRTLWQAGTDHAGIATQMVVERQLAGV--GQTRHDLGREAFIERVWQWKE
SYV_NITOC       ALIRYHRMRGDDTLWQVGADHAGIATQMVVENQLNAE--GKTRHDLGREAFIQRVWEWKE
SYV_ACIAD       ALTRYNRMMGKNTLWQPGTDHAGIATQMVVERQLAAQ--NISRHDLGREQFIDKVWEWKE
SYV_PSYA2       ALTRYHRMDGDNTLWQPGTDHAGIATQMVVERRLEAE--GIKRRDMSREDFIDKVWEWKE
SYV_PSEAE       ALIRYRRMQGRNTLWQPGTDHAGIATQMVVERQLGAQ--GVSRHDLGREKFLEKVWEWKE
SYV_PSEPK       ALIRFRRMQGRDTLWQPGTDHAGIATQMLVERQLEAK--GQNRHDLGREKFLEKVWEWKD
SYV_PSEF5       ALIRFRRMQGRNTLWQPGTDHAGIATQMLVERQIEAQ--GQNRHDLGREKFLEKVWEWKD
SYV_PSESM       ALIRFRRMQGRNTLWQPGTDHAGIATQMLVERRLEAQ--GVSRHELGREKFLDKIWEWKA
SYV_PSE14       ALIRFRRMQGRNTLWQPGTDHAGIATQMLVERRLEAQ--GISRHELGREKFLDKIWEWKA
SYV_PSEU2       ALIRFRRMQGRNTLWQPGTDHAGIATQMLVERRLEAQ--GVSRHELGREKFLDKIWEWKA
SYV_IDILO       TLTRYQRMDGLNTLWQVGSDHAGIATQMVVERQLAAQ--GQTRQELGRDAFIDKIWEWKE
SYV_MANSM       TLIRYHRMQGDNTLWQAGTDHAGIATQMVVERKIAAE-ENKTRHDYGREAFIEKIWDWKA
SYV_PASMU       ILIRFNRMEGHNTLWQTGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWDWKA
SYV_HAEDU       TLIRFNRMEGNNTLWQAGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFINKIWDWKA
SYV_HAEI8       TLIRFNRMEGHNTLWQAGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFINKIWDWKA
SYV_HAEIN       TLIRFNRMEGHNTLWQTGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFINKIWDWKA
SYV_COLP3       TLIRYQRMQGKNTLWQTGCDHAGIATQMVVERKIAAE-EDKTRHDYGREGFIDKIWEWKE
SYV_PHOPR       TLIRAERMKGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTKHDYGRDAFIDKIWEWKA
SYV_ALIF1       TLIRAERMKGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTKHDYGRDAFIDKIWEWKN
SYV_VIBCH       TLIRCQRMKGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTKHDYGRDAFIDKIWEWKA
SYV_VIBVU       TLIRCERMKGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTKHDYGREAFIDKIWEWKG
SYV_VIBVY       TLIRCERMKGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTKHDYGREAFIDKIWEWKG
SYV_VIBPA       TLIRCERMKGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTKHDYGRDAFIDKIWEWKG
SYV_PHOLL       TMIRYQRMQGKNTLWQSGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWQWKA
SYV_YERPE       TLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWEWKG
SYV_YERPS       TLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWEWKG
SYV_PECAS       TLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWQWKG
SYV_SHIDS       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_ECOL6       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_ECOLI       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_ECO57       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_SHIBS       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_SHISS       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_SHIFL       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGREAFIDKIWEWKA
SYV_SALPA       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWQWKA
SYV_SALTI       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWQWKA
SYV_SALCH       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWQWKA
SYV_SALTY       TMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAE-EGKTRHDYGRDAFIDKIWQWKA
SYV_PSEHT       TLTRFKRMQGNNTLWQVGTDHAGIATQMLVERKLHAE-EGKTRHDLGREDFINKIWEWKK
SYV_SHEON       TLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAE-EGKSRHDLGRDVFMEKVWEWKA
SYV_CHRVO       GLTRFYRMKGHNTLWVPGTDHAGIATQIVVERQLADQ--GLNRHDMGREAFTSKIWEWKE
SYV_NEIG1       GLTRYYRMKGCNTAWIPGTDHAGIATQIVVERQLAAQ--NVSRHDLGREKFLEKVWEWKE
SYV_NEIMA       GLTRYYRMKGCNTAWIPGTDHAGIATQIVVERQLAAQ--NVSRHDLGREKFLEKVWEWKE
SYV_NEIMB       GLTRYYRMKGCNTAWIPGTDHAGIATQIVVERQLAAQ--NVSRHDLGREKFLEKVWEWKE
SYV_NITEU       ALIRYHRMLGDNTLWQPGTDHAGIATQIVVERQLDQE--GKDRRQMGREAFLERVWQWKE
SYV_THIDA       ALTRYHRMSGDNTLWQPGTDHAGIATQIVVERQLDAQ--NISRHDLGREKFLEKVWEWKA
SYV_BORPE       GLVRYHRMLGDDTVFVPGTDHAGIATQIVVERQLDAQ--KVSRHDLGREKFVEKVWEWKE
SYV_BORBR       GLVRYHRMLGDDTVFVPGTDHAGIATQIVVERQLDAQ--KVSRHDLGREKFVEKVWEWKE
SYV_BORPA       GLVRYHRMLGDDTVFVPGTDHAGIATQIVVERQLDAQ--KVSRHDLGREKFVEKVWEWKE
SYV_BURMA       GLVRYHRMLGHNTLWVPGTDHAGIATQIVVERQLDAQ--GVSRHDLGREKFVERVWEWKE
SYV_BURPS       GLVRYHRMLGHNTLWVPGTDHAGIATQIVVERQLDAQ--GVSRHDLGREKFVERVWEWKE
SYV_CUPPJ       GLTRHARMLGANTLWVPGTDHAGIATQIVVERQLEAQ--GVSRHDLGREKFTEKVWAWKE
SYV_RALSO       GLARHARMQGANTLWVPGTDHAGIATQIVVERQLDAQ--GISRHDLGRPAFVDKVWEWKE
SYV_AROAE       ALTRYHRMRGFNTLWQPGTDHAGIATQIVVERQLDAK--GVSRHDLGREKFVEKVWEWKE
SYV_DECAR       ALTRYYRMRGHNTLWQPGTDHAGIATQIVVERQLDAQ--GISRHDLGREKFLEKVWEWKE
SYV_FUSNN       TLIRYNRMTGKNTLWMPGCDHAGIATQNKVERKLAED--GLKKEDIGREKFLEMTWDWKE
SYV_BDEBA       MMIRWKRMNGYNTMWLPGTDHAGIATQSVVERELKKD--GVTRHDLGREKFVEKVWDWKH
SYV_GLUOX       MLIRWKRQEGFNVLWQPGTDHAGIATQMVVERALDKE--GTSRTALGREGFLERVWDWKQ
SYV_RHOS4       ILTRWHRMRGFDTLWQPGQDHAGIATQMVVERELAKS-GQPGRREMGREAFLEKVWEWKE
SYV_RUEPO       ILTRWHRMRGFDTLWQPGQDHAGIATQMQVEKMLAAT-QQPSRRELGREEFLKKVWEWKG
SYV_SPHEL       ILVRHARLKGKDARWVVGTDHAGIATQMVVERQLNAA--GSKRTDFTREAFVDKVWEWKA
SYV_ZYMMO       ILVRHARLKGKDALWVVGTDHAGIATQMVVERNLAKI--GQKRTDMDRETFVNKVWEWKA
SYV_CAUVC       VLTRFHRMRGKAALWLPGTDHAGIATQMVVERQLAAA-GNIGRRDMGREAFVDKVWEWKA
SYV_NITWN       VLCRFERMRGRDVLWQPGTDHAGIATQMVVERQLMER-KEPGRREMGRARFLERVWQWKA
SYV_BRADU       ILCRFERMRGRDVLWQPGTDHAGIATQMVVERQLMER-QQPGRREMGREKFLERVWQWKA
SYV_RHOPA       ILCRFERMRGRDVLWQPGTDHAGIATQMVVERQLMER-QEPSRRDMGRAKFLERVWQWKA
SYV_BARHE       IVVRFQRMRGKNVLWQPGMDHAGIATQMVVERQLAER-QEPTRQEMGREKFVERIWEWRY
SYV_BARQU       IVVRFERMRGKNVLWQPGMDHAGIATQTVVERQLAEC-QEPTRQEMGRERFVERIWEWRH
SYV_AGRFC       ILVRFERMRGKDVLWQPGMDHAGIATQMVVERKLMEN-QLPGRREMGREAFVEKVWEWKA
SYV_RHIME       IMVRFERMRGKDVLWQPGMDHAGIATQMVVERQLMER-QLPSRRDMGREAFIERVWEWKA
SYV_RHILO       ILVRFERMRGKNVLWQPGMDHAGIATQMVVERQLMEK--QIHRRDLTREQFIEKVWEWKA
SYV_BRUME       IMVRFERMRGKNVLWQPGMDHAGIATQMVVERQLAER-KEPNRHAMGREKFIERIWQWKA
SYV_BRUSU       IMVRFERMRGKNVLWQPGIDHAGIATQMVVERQLAER-KEPNRHAMGREKFIERIWQWKA
SYV_DESPS       ILVRYHRMCGDNTMWIPGTDHAGIATQNVVERQLATE--GKGRHDLGREAFIERVWKWRE
SYV_DESVH       VLCRNARQQGKKVLWLPGTDHAGIATQNVVERALAKE--GLSRHDLGREAFIERVWQWKE
SYV_GEOSL       ILCRWKRMNGYEVLWMPGTDHAGIATQNVVERQLAGE--GTSRHELGREAFIERVWKWKA
SYV_PELCD       ILARWKRMDGHEVLWQPGTDHAGIATQNVVEKQLAAE--GSSRHDLGREGFVDRVWQWRT
SYV_DEHM1       IMIRWHRMLGEPALWLPGADHAGIAAQVVVERMLAKQ--GKTRQELGRELFLEKMWEWVN
SYV_DEHMC       IMIRWHRMQGEPTLWLPGVDHAGIAAQVVVERELAKQ--GKTRQQLGRELFLEKMWEWVN
SYV_SYMTH       ILIRWKRMQGHPTLYLPGTDHAGLATQIRVEEDLRKS-GGPTRHELGREAFVAKVWDWKE
SYV_LACCA       IVIRQKRIEGFDTLWLPGMDHAGIATQAKVEAKLRKE--GISRYDLGREKFVQKVWEWKD
SYV_LACAC       TLIRFKRMEGYDTLYLPGMDHAGIATQAKVEAKLRKQ--GKDRHEMGREAFVKQVWDWKD
SYV_LACJO       TLIRFKRMQGYDTLYLPGMDHAGIATQAKVEAKLRTQ--GKDRHEMGREAFVKQVWDWKD
SYV_STAS1       ILTRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GLSRHDLGREKFLEQAWDWKE
SYV_STAAR       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GITRYDLGREKFLEQAWDWKE
SYV_STAAC       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GITRYDLGREKFLEQAWDWKE
SYV_STAAN       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GITRYDLGREKFLEQAWDWKE
SYV_STAAS       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GITRYDLGREKFLEQAWDWKE
SYV_STAAW       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GITRYDLGREKFLEQAWDWKE
SYV_STAAM       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GITRYDLGREKFLEQAWDWKE
SYV_STAEQ       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GISRHDLGREKFLQQAWDWKE
SYV_STAES       IITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQ--GISRHDLGREKFLQQAWDWKE
SYV_STAHJ       IITRMKRMQGYDTLYLPGMDHAGIATQAKVDAKLKEQ--GISRHDIGREKFLEHAWSWKE
SYV_LACPL       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEAKLREQ--GISRYDLGREKFIQQVWDWKD
SYV_LACSS       MLIRQKRMQGYDVLWLPGMDHAGIATQAKVEAKLAEQ--GISRYDLGREKFIDQVWEWKD
SYV_ENTFA       MIIRQKRMQGFDTLWLPGMDHAGIATQAKVEEKLAQQ--GISRYDLGREKFVDQVWEWKE
SYV_LACLA       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVAARLAED--GILPQDLGREKFLDKVWEWKD
SYV_STRMU       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAED--GISRYDLGREKFLDKVWEWKD
SYV_STRA5       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGREKFLDKVWEWKD
SYV_STRA1       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGREKFLDKVWEWKD
SYV_STRA3       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGREKFLDKVWEWKD
SYV_STRT1       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAES--GISRYDLGREKFLDKVWEWKD
SYV_STRT2       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAES--GISRYDLGREKFLDKVWEWKD
SYV_STRP1       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGRDKFLDKVWEWKD
SYV_STRPM       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGRDKFLDKVWEWKD
SYV_STRP6       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGRDKFLDKVWEWKD
SYV_STRP3       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGQ--GITRYDLGREKFLDKVWEWKD
SYV_STRP8       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQ--GISRYDLGRDKFLDKVWEWKD
SYV_STRPN       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGE--GITRYDLGRESFLTKVWEWKD
SYV_STRR6       IIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGE--GISRYDLGRESFLTKVWEWKD
SYV_LISIN       IITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKEE--NISRYDLGREKFVDKTWEWKE
SYV_LISMF       IITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKES--NVSRYDLGRENFVDKTWEWKE
SYV_LISMO       IITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKES--NISRYDLGRENFVDKTWEWKE
SYV_OCEIH       TITRMKRMQGYDVLWLPGMDHAGIATQAKVEARLKES--GTNRYELGREKFLEKAWEWKE
SYV_BACC1       ILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREE--GISRYDLGREKFLEKAWEWKE
SYV_BACCZ       ILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREE--GISRYDLGREKFLEKAWEWKE
SYV_BACCR       ILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREE--GISRYDLGREKFLEKAWEWKE
SYV_BACAN       ILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREE--GISRYDLGREKFLEKAWEWKE
SYV_BACHK       ILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREE--GISRYDLGREKFLEKAWEWKE
SYV_BACSK       ILARTKRMQGYDTLWLPGMDHAGIATQAKVEGKLREQ--GISKYDLGREAFLEKSWEWKD
SYV_BACHD       ILSRLKRMQGYDTLWLPGMDHAGIATQAKVEAKLREE--GKSRYDLGREAFVEKTWEWKE
SYV_GEOSE       IITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRQQ--GLSRYDLGREKFLEETWKWKE
SYV_GEOKA       IITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRQQ--GLSRYDLGREKFLEETWKWKE
SYV_BACLD       IVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREE--GKTRYDLGREKFLEETWNWKE
SYV_BACSU       IVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREE--GKSRYDLGREKFLEETWKWKE
SYV_THEMA       IVVRYKRMKGYDVLWVPGEDHAGIATQNAVEKFLLQT-QGKTREEIGREKFLEITWEWAN
SYV_CARHZ       ILARYKRMQGFNTLWLPGTDHAGIATQAKVEEELRKE--GLTKDDLGREKFLERVWAWKE
SYV_CALS4       ILIRWRRMQGYAALWIPGTDHASIATEIKVLDKIREE-TGKTKKDLTREEFLEKAWEWKD
SYV_CLOPE       MLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKE--GLYKKEMGREAFLEKVWEWTD
SYV_CLOAB       FMIRAKRMQGYEALWLPGQDHASIATEVRVEKEILKE--GLNKKEMGREKFLERVWDWTK
SYV_CLOTE       FLIRVKRMQGYSTLWLPGQDHASIATEVKVENELLKT--GLKKKEMGREAFLERVWEWSE
                 . *             . **:.::.                                  

SYV_MYCGA       ESSQTIKNQAKSLGLALNWKKEKFTLS-------------QESNKYVLDVFVKLYQQGYI
SYV_MYCGE       NQSEIIKNQLKSLGVCLNWSETKFTLS-------------EQANKIVNNCFKNLYENGFI
SYV_MYCPN       TQGDTIQSQIKSLGASLNWNQVNFTLS-------------KKASQIVNDSFIQLFEQGFI
SYV_MYCPE       NVGNNIRNQWKNMGFFLDYENEHFTLE-------------KKSNEMVNQVFVKMYNDGLI
SYV_MYCS5       IHEKLFRQQWQTLGLALDYSNEAFTLS-------------KEVNEKVIKIFVELYNRGYI
SYV_MYCH2       KQYLKIKEQWDKLGICYDFSKERFTLD-------------QDAQIAVSDFFIKLWEKNLI
SYV_MYCH7       KQYLKIKEQWDKLGICYDFSKERFTLD-------------QDAQIAVSDFFIKLWEKNLI
SYV_MYCHJ       KQYLKIKEQWDKLGICYDFSKERFTLD-------------QDAQIAVSDFFIKLWEKNLI
SYV_MYCMO       EYANEIKKQWSKLGLALDYKKERFTLD-------------ELSNKAVNDIFVMLYKDGYI
SYV_MYCPU       KYANIIKSQWNKLGLALDYSSERFTLD-------------QDSKDTVNKVFIDLYNAGII
SYV_PARUW       KSENRIIEQLKRLGNSCDWTRLRFTMD-------------ENNSLAVRTMFKKLFDDGLI
SYV_CHLPN       KSEKVVLSQLRQLGCSCDWDRKRFTME-------------PLANRAVKKAFKTLFENGYI
SYV_CHLMU       KSQNVILSQLRQLGCSCDWSRQRFTMD-------------PEANRAVKKAFKVLFDKGVI
SYV_CHLTR       KSQNVILSQLRQLGCSCDWSRQRFTMD-------------PGANRAVKKAFKILFDKGVI
SYV_CHLAB       KSEGVILSQLRQLGCSCDWSRLRFTME-------------PLANRAVKKAFKILFDKGHI
SYV_CHLCV       KSEGVILSQLRQLGCSCDWSRLRFTME-------------PLANRAVKKAFKALFDKGHI
SYV_ONYPE       EHAQNIRQQWQVLGLHLDYNFEKFTLD-------------PDLSQQVQEVFGKLFQKKLI
SYV_UREPA       EQINYIHKQWNALGLGLDYSNYLFTLD-------------PIVVQTVREVFVKMFNEHII
SYV_PORGI       EHGGIILEQLKRLGASCDWTRTAFTMD-------------ESRSESVIKVFVDLYNKGLI
SYV_BACFN       EHGGIILKQLRKLGASCDWDRTAFTMD-------------EKRSESVLKVFVDLYNKGLI
SYV_BACFR       EHGGIILKQLRKLGASCDWDRTAFTMD-------------EKRSESVLKVFVDLYNKGLI
SYV_BACTN       EHGGIILKQLRKLGASCDWDRTAFTMD-------------EERSKSVLKVFVDLYNKGLI
SYV_WIGBR       ESEKKICYQINKLGCFTDLNKIRFTMD-------------KDSCKAVNNVFLKLYKDKLI
SYV_DEIRA       KSGGMILDQLTRLGVSADWTRERFTMD-------------EGLSRAVRTQFVKLYHDGLA
SYV_THET8       ESGGTILKQLKRLGASADWSREAFTMD-------------EKRSRAVRYAFSRYYHEGLA
SYV_THETH       ESGGTILKQLKRLGASADWSREAFTMD-------------EKRSRAVRYAFSRYYHEGLA
SYV_THET2       ESGGTILKQLKRLGASADWSREAFTMD-------------EKRSRAVRYAFSRYYHEGLA
SYV_HELPJ       KSGGAILEQMKRLGVSTAFSRTRFTMD-------------KGLQRAVKLAFLKWYEKGLI
SYV_HELPY       KSGGAILEQMKRLGVSAAFSRTRFTMD-------------KGLQRAVKLAFLKWYEKGLI
SYV_CAMJE       QSGGKILDQMRTLGITPAWSRLRFTMD-------------EGLVNAVKKAFVELYDKRLI
SYV_CAMJR       QSGGKILDQMRTLGITPAWSRLRFTMD-------------EGLVNAVKKAFVELYDKRLI
SYV_HELHP       QSGGEILNQMRHLGITPAWSRLRFTMD-------------KGLQKAVKKAFVQWYNQGLI
SYV_WOLSU       ESGGTILSQMRKLGTSPAWSRTRFTMD-------------EGLKNSVARAFVKLYEEGYI
SYV_BORBU       RHRGIIVNQINKLGASYDHSRERFTLD-------------ENLCKAVNKVFKDLYFKGLI
SYV_BORBP       KHRGVIVNQIKKLGASYDHSRERFTLD-------------ESLCKAVNKVFKDLYSKGLI
SYV_MESFL       EYAAIIRQQWSKLGLAFDYSMEKFTLD-------------DDINKIVTEIFVDFYNKGLI
SYV_MYCMS       EYANIIRKQWAKLGLSLDYSTEKFTLD-------------EDINQIVKEIFVKFYNDQII
SYV_PELUB       EHGDIILNQLKKLGCSCDWSRNAFTMD-------------ENLSKSVLKVFVELHKKGLI
SYV_TREDE       EHHSIITKQLRKMGVSVDWDRERFTLD-------------EGLSQAVREVFVSLYEQGLI
SYV_TREPA       SHQDTIRMQLRKMGASCDWTCERFTLD-------------AGMSASVREAFVTLYERGLL
SYV_GLOVI       RSQDTIRGQLRRLGLSLDWTRESFTLD-------------EKRNRAVVKVFVDLHRKGLI
SYV_PROMP       QSGGKIISQLKRIGYSVDWERERFTLD-------------EKLNEAVVEAFNILHEKKLI
SYV_PROMA       ESGGRIVEQLRRLGYSVDWKRERFTMD-------------TRLSKAVSEAFVRLHQQGLI
SYV_PROMT       KSGGRIVDQLKRLGYSVDWSRERFTLD-------------EGLSKAVSEAFVRLHEKGLI
SYV_PROMM       ESGGRIVDQLRRLGYSVDWQRQRFTLD-------------EGLSAAVREAFVRLHEQGLI
SYV_SYNPX       ESGGRIVGQLRRLGYSVDWQRQRFTLD-------------EGLSEAVKEAFVRLHEQGLI
SYV_THEEB       SSGKTIVGQIRRLGLSVDWSRERFTMD-------------EGLSRAVLTAFNRLYEAGLI
SYV_SYNP6       ESGGTIVGQLRRLGVSVDWSRERFTMD-------------EGLSKAVLEAFIQLYEEGLI
SYV_NOSS1       ESGGTIVNQLRRLGVSVDWSRERFTLD-------------EGLSKAVAEAFVSLYDEGLI
SYV_SYNY3       ESGSTIVNQLRRLGVSVDWTRERFTMD-------------EGLSQAVKTAFIKLYEEGLI
SYV_LEPIC       HSGGMITKQQKLLGESVDWSRERFTLD-------------EGLSKAVFKVFKSLYDEGLI
SYV_LEPIN       HSGGMITKQQKLLGESVDWSRERFTLD-------------EGLSKAVFKVFKSLYDEGLI
SYV_STRAW       ESGGQISGQMRRLGDGVAWSRERFTMD-------------EGLSQAVQTIFKKLYDDELI
SYV_STRCO       ESGGQISGQMRRLGDAVAWSRERFTMD-------------EGLSQAVQTIFKRLYDDELI
SYV_CORJK       RYGGVIQRQMRAIGDSVDWSRERFTLD-------------DGLSRAVQTMFKELFDAGLI
SYV_CORDI       KFGGTIGTQMRAIGDSVDWSRERFTLD-------------EGLSRAVQTIFKQMYDRGMI
SYV_COREF       EYGGKIGEQMRAIGDSVDWSRERFTLD-------------EGLSRAVQTIFKKLYDSGMI
SYV_CORGL       EYGGKIGEQMRAIGDSVDWSRERFTLD-------------DGLSRAVQTIFKKLFDAGLI
SYV_NOCFA       ESGGAIQWQMRALGDGVDWSRDRFTMD-------------EGLSRAVQTMFKRLYDAGLI
SYV_MYCLE       ESGGAIAGQMRRLGDGVDWSRDRFTMD-------------DGLSRAVRMIFKRLYDAGLI
SYV_MYCBO       ESGGAIGGQMRRLGDGVDWSRDRFTMD-------------EGLSRAVRTIFKRLYDAGLI
SYV_MYCTU       ESGGAIGGQMRRLGDGVDWSRDRFTMD-------------EGLSRAVRTIFKRLYDAGLI
SYV_MYCPA       ESGGAIGGQMRRLGDGVDWSRDRFTMD-------------EGLSRAVRTIFKRLYDAGLI
SYV_BUCBP       TSKNVITSQMRRLGISVDWTHEKFTLD-------------PQISFAVRKVFMTLYDECLI
SYV_BLOFL       KSEKFINYQIKRLGHSVSWKNKHFTMD-------------PEISLAVKEAFIQLYTNNLI
SYV_BLOPB       QSEQFITYQMKRLGNSVDWKRQRFTMD-------------TEMSYAVTEAFIRLYRKNLI
SYV_BUCAI       QSSNIITKQMRRLGISVDWDYEKFTLD-------------PDISNSVREAFIILYKNNLI
SYV_BUCAP       KSNFSVKKQMKRLGNSVDWDREKFTLD-------------PDISNSVKEAFIILYKNNLI
SYV_FRATT       LSGGTITSQMRRIGASPDWDRERFTMD-------------KGLSDAVKKCFIKLYEDGLA
SYV_COXBU       RSGGKITHQMRRLGVSIDWSRERFSMD-------------EGLSRATTEAFIRLHHEGLI
SYV_XYLFA       QSGDTIERQMRRLGVSADWSRSTFTMD-------------PQPSAAVTEAFVRWYEAGLI
SYV_XYLFT       QSGDTIERQMRRLGVSADWSRSTFTMD-------------AQPSAAVTEAFVRWYEEGLI
SYV_XANC8       QSGDTIERQMRRLGTSSDWSRSTFTMD-------------PQPSAAVTEAFVRWYEQGLI
SYV_XANCP       QSGDTIERQMRRLGTSSDWSRSTFTMD-------------PQPSAAVTEAFVRWYEQGLI
SYV_XANOR       ASGDTIERQMRRLGTSSDWSRSTFTMD-------------PQPSAAVNEAFVRWYEQGLI
SYV_XANC5       ESGDTIERQMRRLGTSSDWSRSTFTMD-------------PQPSAAVNEAFVRWYEQGLI
SYV_XANAC       ESGDTIERQMRRLGTSSDWSRSTFTMD-------------PQPSAAVNEAFVRWYEQGLI
SYV_LEGPA       ESGNTITQQMRRLGASVDWSRERFTMD-------------EGLSAAVQKVFVQLYEEGLI
SYV_LEGPH       ESGNTITQQMRRLGASVDWSRERFTMD-------------EGLSAAVQKVFVQLYEEGLI
SYV_LEGPL       ESGNTITQQMRRLGASVDWSRERFTMD-------------EGLSAAVQKVFVQLYEEGLI
SYV_METCA       TSGGTITRQLRRMGASLDWSRERFTLD-------------EGLSRAVREVFVRLYEEGLI
SYV_NITOC       HSGGTITRQLRRMGTSVDWSRERFTMD-------------EGLSQAVGEVFVRLYDEGLL
SYV_ACIAD       QSGGTITKQIRRLGSSVDWSRERFTMD-------------DGLSNAVKEVFVKLHEDGLI
SYV_PSYA2       ESGGNITRQIRRLGSSVDWSRERFTMD-------------DGLSNAVKEVFVRLFDDGLI
SYV_PSEAE       QSGGNITRQIRRLGSSVDWSRERFTMD-------------DGLSEAVKEAFVRLHEDGLI
SYV_PSEPK       QSGGNISRQIRRLGSSVDWSRERFTMD-------------DGLSEAVKEAFVRLHEDGLI
SYV_PSEF5       QSGGNISRQIRRLGSSVDWSRERFTMD-------------DGLSEAVKEAFVRLHEDGLI
SYV_PSESM       ESGGNISRQIRRLGSSVDWSRERFTMD-------------DGLSDAVKEAFVRLHEDGLI
SYV_PSE14       ESGGNISRQIRRLGSSVDWSRERFTMD-------------DGLSDAVKEAFVRLHEDGLI
SYV_PSEU2       ESGGNISRQIRRLGSSVDWSRERFTMD-------------DGLSEAVKEAFVRLHEDGLI
SYV_IDILO       QSGGTITQQMRRLGDSVDWDRERFTMD-------------EGLSDAVREVFVKLHEDNLI
SYV_MANSM       YSGGTISQQMRRLGNSIDWERERFTMD-------------EGLSEAVKEVFVRLHEEGLI
SYV_PASMU       YSGGTISQQMRRLGNSIDWERERFTMD-------------EGLSDAVKEVFVRLHEEGLI
SYV_HAEDU       YSGGTISQQMRRLGNSIDWQRERFTMD-------------DGLSNAVKEVFVRLHEQGLI
SYV_HAEI8       YSGGTISQQMRRLGNSIDWERERFTMD-------------DGLSNAVKEVFVRLHEEGLI
SYV_HAEIN       YSGGTISQQMRRLGNSIDWERERFTMD-------------DGLSNAVKEVFVRLHEEGLI
SYV_COLP3       ESGGTIGKQMRRLGNSIDWSRERFTMD-------------DGMSEAVQEVFVRLFEDDLI
SYV_PHOPR       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGLSAATQEVFVRLFEEDLI
SYV_ALIF1       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGLSAATQEVFVRLYEEDLI
SYV_VIBCH       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGFYKAVQEVFVRLYKDDLI
SYV_VIBVU       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGLSNAVQEVFVRLYEDDLI
SYV_VIBVY       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGLSNAVQEVFVRLYEDDLI
SYV_VIBPA       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGLSNAVQEVFVRLYEDDLI
SYV_PHOLL       ESGGTITNQMRRLGNSVDWERERFTMD-------------EGLSNAVKEAFVRLYQENLI
SYV_YERPE       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLHKEDLI
SYV_YERPS       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLHKEDLI
SYV_PECAS       ESGGNITNQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SHIDS       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_ECOL6       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_ECOLI       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_ECO57       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SHIBS       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SHISS       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SHIFL       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SALPA       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SALTI       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SALCH       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_SALTY       ESGGTITRQMRRLGNSVDWERERFTMD-------------EGLSNAVKEVFVRLYKEDLI
SYV_PSEHT       ESGGTITKQLRRLGASVDWDRERFTMD-------------DGLSEAVKEVFVRLHKENLI
SYV_SHEON       QSGGTITKQLRRMGASVDWDRERFTMD-------------EGLSKAVQEVFVRLYEDDLI
SYV_CHRVO       KSGGTITSQMRRVGCSVDWDREYFTMD-------------DVRAEVVTEVFVRLYEQGLI
SYV_NEIG1       VSGGTITQQMRRVGCSADWTREYFTMD-------------GVRAETVTEVFVRLYEQGLI
SYV_NEIMA       VSGGTITQQMRRVGCSADWTREYFTMD-------------DVRAETVTEVFVRLYEQGLI
SYV_NEIMB       VSGGTITQQMRRVGCSADWTREYFTMD-------------DVRAETVTEVFVRLYEQGLI
SYV_NITEU       ESGSTITRQMRRMGASCDWSRERFTMD-------------ETLSRAVTEVFVRLYREGLI
SYV_THIDA       HSGSTITRQMRRLGTSPDWSRERFTMD-------------AGLSKAVTEVFVRLYREGLI
SYV_BORPE       QSGSTITGQVRRLGASADWPREYFTMD-------------ARMSRGVAETFVRLYQQGLI
SYV_BORBR       QSGSTITGQVRRLGASADWPREYFTMD-------------ARMSRGVAETFVRLYQQGLI
SYV_BORPA       QSGSTITGQVRRLGASADWPREYFTMD-------------ARMSRGVAETFVRLYQQGLI
SYV_BURMA       RSGSTITGQVRRIGASPDWSREYFTMN-------------DKMSEAVREVFVRLYEQGLI
SYV_BURPS       RSGSTITGQVRRIGASPDWSREYFTMN-------------DKMSEAVREVFVRLYEQGLI
SYV_CUPPJ       ESGSTITRQVRRMGASIDWTREYFTMS-------------PDMSKAVTEVFVRLHEQGLI
SYV_RALSO       QSGSTITRQIRRMGASIDWEREYFTMD-------------PKMSRAVSDVFVRLYEQGLI
SYV_AROAE       YSGGTITRQMRRLGTSPDWKRERFTMD-------------EGLSKTVTETFVRLYNEGLI
SYV_DECAR       YSGNTITKQMRRMGTSPDWKRERFTMD-------------AGLNKVVTETFVRLFNEGLI
SYV_FUSNN       KYGGIITKQLRKLGASLDWDRERFTMD-------------EGLSYAVRKIFNDLYHDGLI
SYV_BDEBA       QYGNRIYGQMRRLGDSCDWDRAVFTLD-------------EGVSKAVRKVFVSLHKKGLI
SYV_GLUOX       EYGGTIVKQLRKLGASADWERERFTMD-------------DGLSRAVRKVFVTLYNEGLI
SYV_RHOS4       QSGGTIVNQLKRLGASCDWSRNAFTMD-------------PNFQRAVLKVFVDLYEKGFI
SYV_RUEPO       QYGGTIVEQLKRLGASCDWSRNAFTMAGAAGDPRTGHENSPNFHDAVIKVFVDMYNKGLI
SYV_SPHEL       ESGGQITRQLRRLGCSMDWANERFTMD-------------EGFSKAVLKVFVELYRQGLV
SYV_ZYMMO       ESGGTITRQLRRLGASCDWAHERFTMD-------------EGFSKAVIKVFVSLYNEGLI
SYV_CAUVC       ESGGAITNQLRRLGASCDWSRERFTLD-------------EGLSAAVRKVFVQLYKQNLL
SYV_NITWN       ESGGVIVNQLKRLGASCDWSRERFTMD-------------EGLSRAVAKVFVELHRAGLI
SYV_BRADU       ESGDTIINQLKRLGASCDWSRERFTMD-------------EGLSKAVIKVFVELHRDGLI
SYV_RHOPA       ESGGVIVNQLKRLGASCDWSRERFTMD-------------EGLSRAVAKVFVELHRQGLI
SYV_BARHE       ETGGVIANQLRRLGVSCDWSRERFTMD-------------DGLSEAVREVFVTLYKQGLI
SYV_BARQU       ETGGVIANQLRRLGVSCDWSRERFTMD-------------EGLSHAVREVFVTLYKQGLI
SYV_AGRFC       ESGGLIFNQLKRLGASCDWSRERFTMD-------------EGLSEAVLEVFVTLYKQNLI
SYV_RHIME       ESGGLIFNQLKRLGASCDWSRERFTMD-------------EGLSEAVIEVFVSLYKEGLI
SYV_RHILO       ESGGTIFNQLKRLGASADWSRERFTMD-------------EGLSKAVLEVFVTLYKEGLI
SYV_BRUME       ESGGMISNQLRRLGASCDWSRERFTMD-------------EGLSRAVLEVFVTLYKQGLI
SYV_BRUSU       ESGGMISNQLRRLGASCDWSRERFTMD-------------EGLSRAVLEVFVTLYKQGLI
SYV_DESPS       DKGGTIVNQLKKIGSSCDWERERFTMD-------------EGLSTSVREVFVRLYKEGLI
SYV_DESVH       EYGNRILNQIRMLGDSVDWTRERFTMD-------------EGLSKAVRKVFVDLYNGGYI
SYV_GEOSL       ESGGQIIGQLKRLGASCDWGRERFTMD-------------EGLSRAVREVFVRLYEEGLI
SYV_PELCD       ESGGQIINQLKRLGASCDWERERFTMD-------------EGLSRAVREVFVTLYEEGLI
SYV_DEHM1       PCRERIRHQHMRLGASCDWDRETFTLD-------------PGPVKAVREIFTNLYQKGLI
SYV_DEHMC       PCREKIRHQHMRLGASCDWDRETFTLD-------------AGPVKAVREIFTNLYEKGLI
SYV_SYMTH       RYHATITSQLRKLGVSVDWSREAFTMD-------------ERLSRAVRAFFVQLYKKGLI
SYV_LACCA       EFAKTIHGQWAKMGLSLDYSRERFTLD-------------KGLNQAVRRVFVDLYNQGLI
SYV_LACAC       EYANIIKSQWSKLGLSLDYSRERFTLD-------------KGLSKAVKKVFVQLYNEGLI
SYV_LACJO       EYASIIKSQWAKMGLSLDYSRERFTLD-------------KGLSKAVRKVFVQLYNEGLI
SYV_STAS1       EYANFIRQQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDMYNKGLI
SYV_STAAR       EYASFIRAQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDLYNKGII
SYV_STAAC       EYASFIRAQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDLYNKGII
SYV_STAAN       EYASFIRAQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDLYNKGII
SYV_STAAS       EYASFIRAQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDLYNKGII
SYV_STAAW       EYASFIRAQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDLYNKGII
SYV_STAAM       EYASFIRAQWAKLGLGLDYSRERFTLD-------------EGLSKAVKKVFVDLYNKGII
SYV_STAEQ       EYATFIRQQWAKLGLGLDYSRERFTLD-------------DGLSKAVRKVFVDLYNKGII
SYV_STAES       EYATFIRQQWAKLGLGLDYSRERFTLD-------------DGLSKAVRKVFVDLYNKGII
SYV_STAHJ       EYASFIRQQWAKLGLGLDYSRERFTLD-------------DGLSKAVRKVFVDLYNKGII
SYV_LACPL       EYASIIKQQWAKMGLSLDYSRERFTMD-------------DGLSDAVKKVFVDLYNKGLI
SYV_LACSS       EYAATIHDQWAKMGLSLDYSRERFTLD-------------DGLSDAVRKVFVNLYNKGLI
SYV_ENTFA       EYASHIREQWAKMGLSLDYSRERFTLD-------------EGLSEAVRKVFVSLYEKDLI
SYV_LACLA       EYATTIKEQWGKMGISVDYSRERFTLD-------------EGLSQAVRKVFVQLYNKGWI
SYV_STRMU       EYAATIKEQWGKMGISVDYSRERFTLD-------------EGLSKAVRKVFVELYKKGWI
SYV_STRA5       EYAATIKSQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYNKGWI
SYV_STRA1       EYAATIKSQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYNRGWI
SYV_STRA3       EYAATIKSQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYNKGWI
SYV_STRT1       EYAATIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVELYKKGWI
SYV_STRT2       EYAATIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVELYKKGWI
SYV_STRP1       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYKKGWI
SYV_STRPM       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYKKGWI
SYV_STRP6       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYKKGWI
SYV_STRP3       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYKKGWI
SYV_STRP8       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYKKGWI
SYV_STRPN       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVNLYKKGWI
SYV_STRR6       EYATTIKEQWGKMGLSVDYSRERFTLD-------------EGLSKAVRKVFVDLYKKGWI
SYV_LISIN       EYADFIREQWEKLGLGLDYSRERFTLD-------------AGLSDAVKKVFVTLYNKGLI
SYV_LISMF       EYAEFIREQWEKLGLGLDYSRERFTLD-------------DGLSDAVKKVFVTLYNKGLI
SYV_LISMO       EYAEFIREQWEKLGLGLDYSRERFTLD-------------DGLSDAVKKVFVTLYNKGLI
SYV_OCEIH       EYAAFIRSQWEKLGLGLDYSRERFTLD-------------EGLSDAVREVFVKLYEKGLI
SYV_BACC1       EYASHIRQQWGKVGLGLDYSRERFTLD-------------EGLSDAVNKVFVQLYEKGLI
SYV_BACCZ       EYASHIRQQWGKVGLGLDYSRERFTLD-------------EGLSDAVNKVFVQLYEKGLI
SYV_BACCR       EYASHIRQQWGKVGLGLDYSRERFTLD-------------KGLSDAVNKVFVQLYEKGLI
SYV_BACAN       EYASHIRQQWGKVGLGLDYSRERFTLD-------------KGLSDAVNKVFVQLYEKGLI
SYV_BACHK       EYASHIRQQWGKVGLGLDYSRERFTLD-------------KGLSDAVNKVFVQLYEKGLI
SYV_BACSK       EYAKFIREQWAKVGISVDYSRERFTLD-------------QGLSDAVKEVFVSLYNKGLI
SYV_BACHD       EYADFIRQQWAKLGLSLDYSRERFTLD-------------EGLSKAVREVFVKLYEKGLI
SYV_GEOSE       EYAGHIRSQWAKLGLGLDYTRERFTLD-------------EGLSKAVREVFVSLYRKGLI
SYV_GEOKA       EYAGHIRSQWAKLGLGLDYTRERFTLD-------------EGLSKAVREVFVSLYRKGLI
SYV_BACLD       EYADFIRSQWAKLGLGLDYSRERFTLD-------------EGLSKAVREVFVKLYEKGLI
SYV_BACSU       EYADFIRSQWAKLGLGLDYSRERFTLD-------------EGLSKAVREVFVKLYEKGLI
SYV_THEMA       KYRREIREQIKALGASVDWTRERFTLD-------------EGLSRAVRKVFVELYRKGLI
SYV_CARHZ       NYGNRITEQLRTLGASCDWKRERFTLD-------------EGCSEAVKEVFLRLYEKGLI
SYV_CALS4       KYENRILSQLKKLGSSCDWTRTAFTMD-------------EKRSKAVREVFVSLYEKGLI
SYV_CLOPE       EYRERIREQLKKMGCSADFTREAFTMD-------------ENLSKAVRHVFVKLYKEGLI
SYV_CLOAB       EYRERIKGQQKKLGVSADFTRESFTMD-------------EKLNKAVRTVFVKLYEDGLI
SYV_CLOTE       EYRGRIRDQLKKLGSSADFTRESFTMD-------------DNLDKAVRAVFVKLYEEGLI
                     .  *   :*         *::                    .   *         

SYV_MYCGA       VKKYTLVNWDTKLNTAISNIEVINKETTQKLHYIKYY-L-------KDS-----------
SYV_MYCGE       YQAYTLVNWDTKLNTAISNIEVINKPVNQHLHYVVYK-L-------ANDS----------
SYV_MYCPN       YQAETLVNWDTKLNTAISNIEVINKPVDQQLYYIAYK-L-------ANNP----------
SYV_MYCPE       YRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYY-L-------SNS-----------
SYV_MYCS5       YKKNRAVSWDINLQTAISNIEVINKETPQKMYYIKYF-F-------ENS-----------
SYV_MYCH2       YRGQKAINWDIKLQTAISNIEVINKPVEQKMYYLKYF-L-------ENS-----------
SYV_MYCH7       YRGQKAINWDIKLQTAISNIEVINKPVEQKMYYLKYF-L-------ENS-----------
SYV_MYCHJ       YRGQKAINWDIKLQTAISNIEVINKPVEQKMYYLKYF-L-------ENS-----------
SYV_MYCMO       YRGNRAIYYDTFLQTSLSNIEVINVEKESKMYYLKYF-L-------ENSN----------
SYV_MYCPU       YQGVKGINWDPLQKTALSNVEVINKETPQKMYYIKYF-L-------ENS-----------
SYV_PARUW       YRGDYLVNWDPHTQTALADDEVEYEDKQSFLWYFKYP-L-------RDE-----------
SYV_CHLPN       YRGYYLVNWDPVLQTALADDEVEYEEKDGWLYYIRYR-M-------VGS-----------
SYV_CHLMU       YRGYYLVNWDPILQTALADDEVEYEEREGWLYYIRYP-V-------VNS-----------
SYV_CHLTR       YRGYYLVNWDPILQTALADDEVEYEERDGWLYYIRYQ-V-------VNS-----------
SYV_CHLAB       YRGNYLVNWDPVLQTALADDEVEYEEKDGWLYYIRYR-V-------VGS-----------
SYV_CHLCV       YRGYYLVNWDPVLQTALADDEVEYEEKDGWLYYIRYK-V-------VDS-----------
SYV_ONYPE       YRDYKIINWDPETKTALSNVEVNYHETEGKLYYIKYF-L-------VDFPTNSNLSDASL
SYV_UREPA       YRDKKLVNWDIQLKTAISNIEVIHKEVEQKLYYIKYL-S-------QDQ-----------
SYV_PORGI       YRGIRVVNWDPKALTALSDEEVIYKETNGKLYYLRYF-V-------ENEP----------
SYV_BACFN       YRGVRMVNWDPKALTALSDEEVIYKEEHGKLFYLRYK-I-------EGE-----------
SYV_BACFR       YRGVRMVNWDPKALTALSDEEVIYKEEHGKLFYLRYK-I-------EGE-----------
SYV_BACTN       YRGVRMVNWDPKALTALSDEEVIYKEEHGKLFYLRYK-V-------EGDPE---------
SYV_WIGBR       YKKKKLMHWDVKLRTVISDLEIENREINGKLWYIKYF-F-------SENSNKNSK-----
SYV_DEIRA       YRGERIVNWDPASQTTLSELEIDREVRKGKMYTLSYK-L-------ENSAERGSNGE---
SYV_THET8       YRAPRLVNWCPRCETTLSDLEVETEPTPGKLYTLRYE-V-------EGG-----------
SYV_THETH       YRAPRLVNWCPRCETTLSDLEVETEPTPGKLYTLRYE-V--------EG-----------
SYV_THET2       YRAPRLVNWCPRCETTLSDLEVETEPTPGKLYTLRYE-V-------EGG-----------
SYV_HELPJ       VQDNYMVNWCTKDG-ALSDIEVEYEERKGALYYIRYY-L-------ENQ-----------
SYV_HELPY       IQDNYMVNWCTKDG-ALSDIEVEYEERKGALYYIRYY-L-------ENQ-----------
SYV_CAMJE       VRGNYMINWCTHDG-ALSDIEVEYKENKGKLYHIKYF-L-------KDS-----------
SYV_CAMJR       VRGNYMINWCTHDG-ALSDIEVEYKENKGKLYHIKYF-L-------KDS-----------
SYV_HELHP       VQDNYMVNWCVNDG-ALSDIEVEYEQNHGKLYYLRYP-I-------KDS-----------
SYV_WOLSU       IRGNYMVNWCTHDG-ALSDIEVEYDANKGKLYHLRYF-F-------KDS-----------
SYV_BORBU       YRGEYLVNLDPGSGSVVSDEEIEYKEVDGKLYFVKYF-I--------DN-----------
SYV_BORBP       YRGEYLVNLDPGSGSVVSDEEIEYKEVDGKLYFVKYF-I--------DD-----------
SYV_MESFL       YKGKRIVNWDPMQKTAISNVEVIYKEVEGFMYHFKYM-I-------QGT-----------
SYV_MYCMS       YKDKQIVNWDPEQKTAISNVEVIYKETQSKMYYFKYI-L-------EDS-----------
SYV_PELUB       YKDKKLVNWDTVLKTAISDLEVDQREVNSKIYYIQYP-I-------EAS-----------
SYV_TREDE       YQGNYLVNWCPSCGTAISDDEVEHEDRKGGMYHIYYK-L-------ADGAVLQNEAGEK-
SYV_TREPA       YRSMYLVNWCPRCGTALSDDEVFHQEKDGALYYVRYP-LLPRTEEEGNGVPPPLGTAQV-
SYV_GLOVI       YRGKYLVNWCPASQTAVSDLEVDDKEEKGHLWQLRYP-V-------ADS-----------
SYV_PROMP       YRGEYLVNWCPASQSAVSDLEVEMQEVNGYLWHFKYP-L-------ISDQGQIL------
SYV_PROMA       YRGEYLVNWCPASSSAVSDLEVETKEVDGYLWHFQYP-L--SKINDSNG-----------
SYV_PROMT       YRGEYLVNWCPASGSAVSDLEVEMKEVDGHLWHFRYP-LVTSSVSSAKQ-----------
SYV_PROMM       YRGEYLVNWCPASGSAVSDLEVEMKEVDGHLWHLRYP-L--TGGPAADG-----------
SYV_SYNPX       YRGEYLVNWCPASGSAVSDLEVEMKEVDGHLWHFRYP-L-------SSG-----------
SYV_THEEB       YRGQYLVNWCPASQSAVSDLEVENREVQGHLWYLRYP-L-------TDG-----------
SYV_SYNP6       YRGQYLVNWCPASQSAVSDLEVEMKEVDGSLWYFRYP-L-------TDG-----------
SYV_NOSS1       YRGEYLVNWCPATQSAVSDVEVESKEVEGNLWHFRYP-L-------TDG-----------
SYV_SYNY3       YRGNYLVNWCPASQSAVSDLEVENQEVDGHLWYFRYP-L-------TDG-----------
SYV_LEPIC       YRGERIINWCPASQTAISDLEVEFRETKGKLYHIKYP-I-------HGKK----------
SYV_LEPIN       YRGERIINWCPASQTAISDLEVEFRETKGKLYHIKYP-I--------HGKK---------
SYV_STRAW       YRAERIINWCPRCLTAISDIEVEYQDDDGELVSMKYG----------EG-----------
SYV_STRCO       YRAERIINWCPRCLTAISDIEVEYQDDDGELVSMKYG-----------EG----------
SYV_CORJK       YRANRMVNWSPVLQTAISDIEVVYSDDEGELVSIRYGSL-------EDS-----------
SYV_CORDI       YQANRLVNWSPILETAVSDIEVVYKDVEGELVSIRYGSL-------NDD-----------
SYV_COREF       YQANRLVNWSPVLETAVSDIEVVYKDVEGELVSIRYGSL-------NDD-----------
SYV_CORGL       YQANRLVNWSPVLETAVSDIEVIYKDVEGELVSIRYGSL-------NDD-----------
SYV_NOCFA       YRAERLVNWSPELRTAISDIEVKHEDVEGELVSLRYGSL-------NDD-----------
SYV_MYCLE       YRAERLVNWSPVLRTALSDIEVIYDEIEGELISFRYGSL-------DDD-----------
SYV_MYCBO       YRAERLVNWSPVLQTAISDLEVNYRDVEGELVSFRYGSL-------DDS-----------
SYV_MYCTU       YRAERLVNWSPVLQTAISDLEVNYRDVEGELVSFRYGSL-------DDS-----------
SYV_MYCPA       YRAERLVNWSPVLQTALSDIEVNYEEVEGELVSFRYGSL-------DDS-----------
SYV_BUCBP       YKRKKLVNWDPVLKTVISDLEVKNRNVIGNMWYIKYY-L-------VKNHS------IKI
SYV_BLOFL       YKGKQLVNWDSKLQTAISDLEVSHKQKSDFIWYIQYQ-L-------EYNTSHINNQKKN-
SYV_BLOPB       YRGKRLVNWDCKLQTAISDLEVINKKTKGSIWYIYYK-L-------DNATISSN------
SYV_BUCAI       YQKKKLVHWDSKLETVISDLEVEHRLIKGKKWFIRYP-I-------IENDMSLRSK----
SYV_BUCAP       YQKKRLVHWDSKLETVISDLEVEHRLIKSKKWFIRYP-I-------IKNIKNIN------
SYV_FRATT       YRGERLVNWDPKLKTAVSDLEVAQVDKQGSLWHFIYP-V-------ADS-----------
SYV_COXBU       YRGKRLVNWDPKLNTAISDLEVVTEEVEGHLWHIRYP-L-------AEG-----------
SYV_XYLFA       YRGQRLVNWDPVLKTAISDLEVENVAEEGMLWSIRYP-L-------SDGVTYEHVEHDAA
SYV_XYLFT       YRGQRLVNWDPVLKTAISDLEVENVQEEGMLWSIRYP-L-------SDGVTYEHIEHDAA
SYV_XANC8       YRGQRLVNWDPVLKTAISDLEVENVEEDGFLWSIRYP-L-------ADGVTYEHVEHDAD
SYV_XANCP       YRGQRLVNWDPVLKTAISDLEVENVEEDGFLWSIRYP-L-------ADGVTYEHVEHDAD
SYV_XANOR       YRGQRLVNWDPVLKTAISDLEVENVEEDGFLWSIRYP-L-------ADGVTYEHIEHDAD
SYV_XANC5       YRGQRLVNWDPVLKTAISDLEVENVEEDGFLWSIRYP-L-------ADGVSYEHVEHDAD
SYV_XANAC       YRGQRLVNWDPVLKTAISDLEVENVEEDGFLWSIRYP-L-------ADDVSYEHVEHDAD
SYV_LEGPA       YRGTRLVNWDPKLGTAVSDLEVLSEEEDGFLWHIRYP-V-------VDS-----------
SYV_LEGPH       YRGTRLVNWDPKLGTAVSDLEVLSEEEDGFLWHIRYP-V-------VDS-----------
SYV_LEGPL       YRGTRLVNWDPKLGTAVSDLEVLSEEEDGFLWHIRYP-V-------VDS-----------
SYV_METCA       YRGKRLVNWDPVLHTAVSDLEVISEEEQGHLWHMRYP-L-------ADG-----------
SYV_NITOC       YRGKRLVNWDSVLHTAISDLEVISEEENSHLWHMRYP-L-------SDG-----------
SYV_ACIAD       YRGKRLVNWDPKLQTALSDLEVESVEEKGSLWHFKYF-FEDKSLKTQDG-----------
SYV_PSYA2       YRGKRLVNWDPKFQTALSDLEVENVDEKGSLWHFRYH-FTDTDITTQDG-----------
SYV_PSEAE       YRGKRLVNWDTKLHTAISDLEVENHDEKGHLWHLRYP-L-------VNGAKTSEG-----
SYV_PSEPK       YRGKRLVNWDTKLHTAISDLEVENHDEKGHLWNLRYP-L-------ADGAKTAEG-----
SYV_PSEF5       YRGKRLVNWDTKLHTAISDLEVENHDEKGFLWNLKYP-L-------ADGAKTAEG-----
SYV_PSESM       YRGKRLVNWDTKLHTAISDLEVENHDEKGHLWNLRYP-L-------ADGAKTAEG-----
SYV_PSE14       YRGKRLVNWDTKLHTAISDLEVENHDEKGHLWNLRYP-L-------ADGAKTAEG-----
SYV_PSEU2       YRGKRLVNWDTKLHTAISDLEVENHDEKGHLWNLRYP-L-------ADGAKTAEG-----
SYV_IDILO       YRGKRLVNWDPALQTAISDLEVENKEQQGYIWYLRYP-L-------ADGEKTEDG-----
SYV_MANSM       YRGKRLVNWDPKLHTAISDLEVENKESKGSLWHFRYP-L-------AKGAKTAEG-----
SYV_PASMU       YRGKRLVNWDPKLHTAISDLEVENKESKGSLWHFRYP-L-------ANGAKTADG-----
SYV_HAEDU       YRGKRLVNWDPKLHTAISDLEVENKESKGSLWHFRYP-L-------SNGVKTADG-----
SYV_HAEI8       YRGKRLVNWDPKLHTAISDLEVENKESKGSLWHFRYP-L-------ANGAKTADG-----
SYV_HAEIN       YRGKRLVNWDPKLHTAISDLEVENKESKGSLWHFRYP-L-------ANDAKTADG-----
SYV_COLP3       YRGKRLVNWDPKFHTAISDLEVENKDKKGHMWHLRYP-L-------ANGAKTAEG-----
SYV_PHOPR       YRGKRLVNWDPKLHTAISDLEVESKDKKGFMWHFRYP-L-------ADGVKTADG-----
SYV_ALIF1       YRGKRLVNWDPKLHTAISDLEVENKDKKGFMWHFRYP-L-------ANGVKTADG-----
SYV_VIBCH       YRGKRLVNWDPKLHTAISDLEVENKETKGHMWHFRYP-L-------ADGVKTADG-----
SYV_VIBVU       YRGKRLVNWDPKLHTAISDLEVENKDTKGHMWHFRYP-L-------ADGVKTADG-----
SYV_VIBVY       YRGKRLVNWDPKLHTAISDLEVENKDTKGHMWHFRYP-L-------ADGVKTADG-----
SYV_VIBPA       YRGKRLVNWDPKLHTAISDLEVENKDTKGHMWHFRYP-L-------ADGVKTADG-----
SYV_PHOLL       YRGKRLVNWDPKLHTAISDLEVENREVKGSMWHLRYP-L-------ADGVTTAEG-----
SYV_YERPE       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHLRYP-L-------ADGAKTAEG-----
SYV_YERPS       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHLRYP-L-------ADGAKTAEG-----
SYV_PECAS       YRGKRLVNWDPKLRTAISDLEVENRDVKGSMWHLRYP-L-------ADGVKTAEG-----
SYV_SHIDS       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKAADG-----
SYV_ECOL6       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_ECOLI       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_ECO57       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SHIBS       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SHISS       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SHIFL       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SALPA       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SALTI       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SALCH       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_SALTY       YRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYP-L-------ADGAKTADG-----
SYV_PSEHT       YRGKRLVNWDPKLHTAISDLEVENKDKQGHMWNLRYP-L-------ADGVKTQDG-----
SYV_SHEON       YRGKRLVNWDPKLHTAISDLEVENKEKQGHMWHLRYP-L-------ADGELTADG-----
SYV_CHRVO       YRGKRLSNWDAKLGTAISDLEVVSEEEDGHMWHIKYP-V-------VGS-----------
SYV_NEIG1       YRGKRLVNWDPVLGTAVSDLEVESMEEQGSMWHIRYP-L-------ADNP----------
SYV_NEIMA       YRGKRLVNWDPVLGTAVSDLEVESVEEQGSMWHIRYP-L-------ADNP----------
SYV_NEIMB       YRGKRLVNWDPVLGTAVSDLEVESVEEQGSMWHIRYP-L-------ADNP----------
SYV_NITEU       YRGKRLVNWDPVLQTAVSDLEVVSVEEQGSLWHILYP-F----EQLEGGSE---------
SYV_THIDA       YRGKRLVNWDPVLGTAVSDLEVVSTEEDGFIWEINYP-L-------EDG-----------
SYV_BORPE       YRGKRLVNWDPKLLTAVSDLEVQSEEVDGHMWHILYP-F-------VDGPQTITDQDGNT
SYV_BORBR       YRGKRLVNWDPKLLTAVSDLEVQSEEVDGHMWHILYP-F-------VDGPQTIIDAEGNT
SYV_BORPA       YRGKRLVNWDPKLLTAVSDLEVQSEEVDGHMWHILYP-F-------VDGPQTITDQDGNT
SYV_BURMA       YRGKRLVNWDPVLLTAVSDLEVVSEEENGHLWHIRYP-L-------ADG-----------
SYV_BURPS       YRGKRLVNWDPVLLTAVSDLEVVSEEENGHLWHIRYP-L-------ADG-----------
SYV_CUPPJ       YRGKRLVNWDPVLGTAVSDLEVDSVEEDGFLWHIRYP-L--VEADAKGG-----------
SYV_RALSO       YRGKRLVNWDPVLGTAVSDLEVVSEEEDGALWHIRYP-L-------AQP--------DAK
SYV_AROAE       YRGKRLVNWDPKLGTAVSDLEVVSEEEDGFLWHITYP-F-------SDGPVGD-------
SYV_DECAR       YRGKRLVNWDPKLNTAVSDLEVVQEEEDGFMWHIRYP-L-------ADG-----------
SYV_FUSNN       YQGEYMVNWCPSCGTALADDEVDHEEKDGHLWQIKYP-V-------KDS-----------
SYV_BDEBA       YRGQRLVNWSGPLETAISDLEVEHKQIKGSLYHVKYP-L-------EDG-----------
SYV_GLUOX       YRDRRLVNWDPKFRSAISDLEVENHETKGSMWYIRYP-L-------EDG-----------
SYV_RHOS4       YRGKRLVNWDPHFETAISDLEVEQVEVNGNMWRLRYQ-L-------ADGATYRHPVAFDE
SYV_RUEPO       YRGKRLVNWDPHFETAISDLEVENIEVAGHMWHFKYP-L-------AGGATYTYVEKDED
SYV_SPHEL       YRDKRLVNWDPGLGTAISDLEVETKEVRGNFWHLRYP-L-------ADG-----------
SYV_ZYMMO       YRDKRLVNWDPHLGTAISDLEVENREVQGHFWHFRYP-L-------EDG-----------
SYV_CAUVC       YRDKRLVNWDPQFQTAISDLEVEQKEVDGAYWHFAYP-L-------ADGVTYQHPIAFDE
SYV_NITWN       YKDKRLVNWDPKLLTAISDLEVKQVEVKGSLWHLRYP-IEGKAFDPSDP-----------
SYV_BRADU       YKDKRLVNWDTKLLTAISDLEVQQTEVKGSLWYLRYP-IEGKTFSPEDP-----------
SYV_RHOPA       YKDKRLVNWDPKLLTAISDLEVQQIEVKGNLWHLRYP-IEGKTFDPADP-----------
SYV_BARHE       YRDKRLVNWDPKLLTAISDLEVEQKEVKGHLWHFRYP-LEGKLFDPSDA-----------
SYV_BARQU       YKDKRLVNWDPKLLTAISDLEVEQREIKGHLWHFRYP-L--------EGKVFDPGDP---
SYV_AGRFC       YKAKRLVNWDPKLQTAISDMEVEQIEVKGNLWHFRYP-L-------EKGVTYEYPVAFDA
SYV_RHIME       YRDTRLVNWDPKLQTAISDIEVEPVEVNGHLWHLRYP-L-------EEGVTYQHPVAFDE
SYV_RHILO       YKDKRLVNWDPRLLTAISDLEVEQHEVNGNLWHFRYP-LEGETFDPENP-----------
SYV_BRUME       YRDKRLVNWDPKLLTAISDIEVESREIKGHLWHFRYP-LENVPFDPENP-----------
SYV_BRUSU       YRDKRLVNWDPKLLTAISDIEVESREIKGHLWHFRYP-L-------EN-------VPFDP
SYV_DESPS       YKGDYIVNWCPRCQTALADDEVEHEDSKGKLYHIRYP-F-------ADG-----------
SYV_DESVH       YRGNYIINWCNRCHTALADDEVDHMPEQGHLYHVRYD-F-------EDG-----------
SYV_GEOSL       YRDNRLINWCPRCHTALSDIEVEHEDKAGNLWHIRYP-V-------VGEP----------
SYV_PELCD       YRDNRLINWCPRCHTALSDLEVEHQDQKGNLWHLRYP-V-------VGT-----------
SYV_DEHM1       YRGERIINWCPRCATAVSDLEVDHKDLAGHIWHLRYP-L-------EDG-----------
SYV_DEHMC       YKGERIINWCPRCGTAVSDLEVDHKDLAGHIWHLRYP-L-------EDG-----------
SYV_SYMTH       YQGTRITHWCPKDQTALSDIEVEYEERQGHMWHFRYP-L-------ADG-----------
SYV_LACCA       YRGEYIVNWDPQARTALSDIEVIHKDDKGAFYHVKYP-F-------ADG-----------
SYV_LACAC       YRGEYIINWDPTLETALSDIEVIHKDDKGAFYHVKYP-F-------ADG-----------
SYV_LACJO       YRGEYIINWDPKLETALSDIEVIHKDDKGAFYHIKYP-F-------ADG-----------
SYV_STAS1       YRGEYIINWDPIARTALSDIEVIHEDVQGKFYHFKYP-Y-------ADG-----------
SYV_STAAR       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADV-----------
SYV_STAAC       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAAN       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAAS       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAAW       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAAM       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAEQ       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAES       YRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYP-Y-------ADG-----------
SYV_STAHJ       YRGERIINWDPEARTALSDIEVIHEDVQGHFYHFKYP-Y-------ADG-----------
SYV_LACPL       YRGEYIINWDPQARTALSDIEVIHKDDKGAFYHVKYP-F-------ADKDYTFNG-----
SYV_LACSS       YRGEYIINWDPKARTALSDIEVLHQDDEGAFYHVSYP-L-------TDG-----------
SYV_ENTFA       YRGEYIINWDPKAKTALSDIEVIHKDIEGAFYHMSYP-L-------SDG-----------
SYV_LACLA       YRGEKLINWDPKAMTALSDIEVIHKEIDGAFYHITYQ-I-------EGS-----------
SYV_STRMU       YRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRA5       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRA1       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRA3       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRT1       YRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRT2       YRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRP1       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRPM       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRP6       YRGEFIINWDPAARTALSDIEVVHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRP3       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRP8       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDD-----------
SYV_STRPN       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_STRR6       YRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYM-L-------EDG-----------
SYV_LISIN       YRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYP-L-------TDG-----------
SYV_LISMF       YRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYP-L-------TDG-----------
SYV_LISMO       YRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYP-L-------TDG-----------
SYV_OCEIH       YRGEYIINWDPSTKTALSDIEVIYEEIQGKFYHMRYP-I-------KGS-----------
SYV_BACC1       YRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYP-L-------TDG-----------
SYV_BACCZ       YRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYP-L-------TDG-----------
SYV_BACCR       YRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYP-L-------TDG-----------
SYV_BACAN       YRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYP-L-------TDG-----------
SYV_BACHK       YRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYP-L-------TDG-----------
SYV_BACSK       YRGEYIINWDPQTKTALSDIEVIYKDVQGAFYHMSYP-L-------SDG-----------
SYV_BACHD       YRGEYIINWDPVTKTALSDIEVIYKDVQGYFYHMKYP-L-------ADG-----------
SYV_GEOSE       YRGEYIINWDPVTKTALSDIEVVYKEVKGALYHMRYP-L-------ADG-----------
SYV_GEOKA       YRGEYIINWDPVTKTALSDIEVVYKEVKGALYHLRYP-L-------ADG-----------
SYV_BACLD       YRGEYIINWDPATKTALSDIEVIYKDVQGAFYHMRYP-L-------KDG-----------
SYV_BACSU       YRGEYIINWDPATKTALSDIEVIYKDVQGAFYHMSYP-L-------ADG-----------
SYV_THEMA       YRGKYIVNWCPRCKTVLSDEEVEHKEHKSKLYYVKYP-V-------KDS-----------
SYV_CARHZ       YRDYYITNWCPHCKTTISDIEVEHLEREGKLYYINYP-L-------EDG-----------
SYV_CALS4       YKGNRIINWCPSCNTALSDAEVEHKEHKGHLWYIKYP-V-------KGE-----------
SYV_CLOPE       YQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYP-V-------VGS-----------
SYV_CLOAB       YQGNRITNWCPKCQTALSDAEIEYKEDQGFFWHIKYP-V-------EGE-----------
SYV_CLOTE       YKGNRIVNWCPKCMTALSDAEIEYEENYGNFWHVKYP-L-------VDS-----------
                 .              ::: *:           . *                        

SYV_MYCGA       ---------NDYLVIATTRPETIYADVAVFVNPNDQRYLKYHNQMVINPL----N-N---
SYV_MYCGE       ---------KQELIVATTRPETIFADVCLLVNPKDKRYTNFWNKLVVNPL----T-G---
SYV_MYCPN       ---------KKRLVVATTRPETIFVDVCLFVHPKDKHYHSFVKQKVVNPL----T-G---
SYV_MYCPE       ---------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPL----T-N---
SYV_MYCS5       ---------SEYLTIATTRVETMLSDVAVIANPKDKRYKNLKIKFLIHPI----T-K---
SYV_MYCH2       ---------NEFLTVATTRIETISSDVALAINPKDKRYLHLVGKKVVHPL----T-K---
SYV_MYCH7       ---------NEFLTVATTRIETISSDVALAINPKDKRYLHLVGKKVVHPL----T-K---
SYV_MYCHJ       ---------NEFLTVATTRIETISSDVALAINPKDKRYLHLVGKKVVHPL----T-K---
SYV_MYCMO       ---------SEYVLVATTRPETLASDVALIINPNDKKNSHYLGKNFVNPL----T-K---
SYV_MYCPU       ---------DEFVEIATVRTETLYSDRAIGINPNDLRAKNYVNKFVIHPL----T-K---
SYV_PARUW       ---------SEFISIATTRPETMLGDTAVAVSPNDERFKHLIGKEIRLPL----M-N---
SYV_CHLPN       ---------QESIVVATTRPETSLGDTGIAVSPNDERYASWIGASVEVPF----V-N---
SYV_CHLMU       ---------EEFITVATTRPETLLGDTAIAVSPEDERYSHLIGAKVIVPF----V-D---
SYV_CHLTR       ---------EEFITVATTRPETLLGDTAIAVSPEDLRYSHLIGAKVVVPF----V-N---
SYV_CHLAB       ---------SEHIVVATTRPETLLGDTAIAISPDDERYSHLLGAKVHLPF----V-D---
SYV_CHLCV       ---------SEEIIVATTRPETLLGDTAIAISPDDERYSHLLGAKVHLPF----V-D---
SYV_ONYPE       V--------PSFLEIATTRPETMFADQALMVNPNDPRYQSFIGKKVFIPD----T-N---
SYV_UREPA       ---------KDFVVVATSRPETMFGDKYLVINPKDKRYFHLHNKIFINPI----N-N---
SYV_PORGI       ---------DKYIIVATTRPETIMGDTAVCVNPNDERYRWLRGKRVIVPT----V-G---
SYV_BACFN       ---------DGYAVVATTRPETIMGDTAMCINPNDPKNQHLKGKKVIVPL----V-G---
SYV_BACFR       ---------DGYAVVATTRPETIMGDTAMCINPNDPKNQHLKGKKVIVPL----V-G---
SYV_BACTN       ---------GRYAVVATTRPETIMGDTAMCINPNDPKNAWLKGKKVIVPL----V-N---
SYV_WIGBR       ---------LNFLEIATTRPETIFGDVAVAVNPLDARYNNLIGKYIKVPL----T-N---
SYV_DEIRA       ---------TGEIRIATVRPETIFADQAIAVHPEDERFRHLVGQKARIPL----T-D---
SYV_THET8       ----------GFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPL----T-E---
SYV_THETH       ---------GGFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPL----T-E---
SYV_THET2       ----------GFIAIATVRPETVFADQAIAVHPEDERYRHLIGKRARIPL----T-E---
SYV_HELPJ       ---------KDYLVVATTRPETLFGDSAIMVNPNDERYKHLVGQQVILPL----I-N---
SYV_HELPY       ---------KDYLVVATTRPETLFGDSALMVNPNDERYKHLVGQKAILPL----I-H---
SYV_CAMJE       ---------DEFLVVATTRPETFFGDTAVMVHPDDERYAKFVDKEVILPI----S-K---
SYV_CAMJR       ---------DEFLVVATTRPETFFGDTAVMVHPDDERYAKFVDKEVILPI----S-K---
SYV_HELHP       ---------AQSLIVATTRPETFFGDTGVMVNPNDERYKHLIGKSVILPL----L-G---
SYV_WOLSU       ---------SDYIVVATTRPETFFGDTAVMVHPEDERYAHLIGQTLVLPL----I-G---
SYV_BORBU       ---------SSFIEVATTRPETMFGDTAIAVNPNDERYKSLVGKEVTIPL----T-T---
SYV_BORBP       ---------SSFIEIATTRPETMFGDTAIAVNPNDERYKSLVGKEVTIPL----T-T---
SYV_MESFL       ---------NEFLNVATTRPETMFADQCLVVNPKDERYTSFIGKKAINPV----N-N---
SYV_MYCMS       ---------NEYLTVATTRPETMFADQCLVVNPNDSRYQKYINKKVINPV----N-K---
SYV_PELUB       ---------SDFITIATTRPETMLGDTAIAVNPKDDRFKHLVGKFVTVPI----V-G---
SYV_TREDE       ---------IQEIEIATTRPETLLGDTAIAVHPEDPRYASIIGKEVILPL----A-N---
SYV_TREPA       ---------GETIIIATTRPETILADVAVAVHPDDARYQSLIGRKVCVPM----V-N---
SYV_GLOVI       ---------DEFLVVATTRPETMLGDTGVAVHPEDPRYKHLIGREAELPI----L-G---
SYV_PROMP       ---------DKYLEVATTRPETLLGDTALAVNPNDERYKKYIDKKVKVPF----V-D---
SYV_PROMA       ---------IRFLEVATTRPETMLGDVAVAVNPSDSRYSNIVGQTLTLPF----L-G---
SYV_PROMT       ---------ISYLEVATTRPETMLGDVAVAVNPSDERYKDLIGEKLTLPL----V-G---
SYV_PROMM       ---------TTHLEVATTRPETMLGDVAVAVNPADERYRHLVGQTLILPL----L-G---
SYV_SYNPX       ---------DGHLEVATTRPETMLGDTAVAVNPTDERYAHLVGQTLTLPF----V-G---
SYV_THEEB       ---------SGYLEVATTRPETMLGDTAVAVHPEDDRYRHLIGKTLRLPL----M-N---
SYV_SYNP6       ---------SGHLEVATTRPETMLGDTAVAVNPQDKRYQHLIGKTITLPL----V-Q---
SYV_NOSS1       ---------SGYVEVATTRPETMLGDTAVAVNPNDDRYKHLIGKTLTLPI----T-Q---
SYV_SYNY3       ---------SGELVVATTRPETMLGDTGVAVNPHDERYAAMVGKTITLPL----V-N---
SYV_LEPIC       ---------DQFLVVATTRPETMLGDVAVCANPEDERYTSLKDVVLDLPL----T-N---
SYV_LEPIN       ---------DQFLVVATTRPETMLGDVAVCANPEDERYTSLKDVVLDLPL----T-N---
SYV_STRAW       ---------DDTIVVATTRAETMLGDTAVAVHPDDERYKHLVGKTIRLPL----T-E---
SYV_STRCO       ---------DETIVVATTRAETMLGDTAVAVHPEDERYKHLVGKLIKLPL----T-D---
SYV_CORJK       ---------EPHVVVATTRVETMLGDVAVAVHPEDERYTDLVGKSLPHPF----LPD---
SYV_CORDI       ---------EPHVIVATTRVETMLGDVAVAVHPDDERYADLVGTTLPHPF----LPD---
SYV_COREF       ---------EPHVVVATTRVETMLGDVAVAVHPDDERYRHLVGTTLPHPF----RDD---
SYV_CORGL       ---------EPHVIVATTRVETMLGDVAVAVHPDDERYKDLVGQTLPHPF----RDD---
SYV_NOCFA       ---------EPHVVVATTRVETMLGDTAVAVHPDDPRYRDLIGTTLEHPI----T-G---
SYV_MYCLE       ---------EPHIVVATTRVETMLGDTGIAVHPDDKRYQHLVGTTLPHPF----I-D---
SYV_MYCBO       ---------QPHIVVATTRVETMLGDTAIAVHPDDERYRHLVGTSLAHPF----V-D---
SYV_MYCTU       ---------QPHIVVATTRVETMLGDTAIAVHPDDERYRHLVGTSLAHPF----V-D---
SYV_MYCPA       ---------GPHIVVATTRVETMLGDTAIAVHPDDERYRHLVGSSLPHPF----V-D---
SYV_BUCBP       SQ-------EYYLVIATTRPETLFGDTAIAVHPNDSRYKKYIGCYALVPI----I-N---
SYV_BLOFL       ---------ADYLTIATTRPETILGDVAIAVNPEDPRYSHLIGKYVFTPI----T-N---
SYV_BLOPB       ---------SHHLIVATTRPETMLGDTAVAVHPEDTRYKNYIGQYVIAPI----T-N---
SYV_BUCAI       ---------VKYLIVSTTRPETLLGDTAIAVNPEDYKYNQFIGNHVSCPL----T-N---
SYV_BUCAP       ---------IEYLLVATTRPETLLGDTALAINPKDDKYNHLIGQSVICPI----V-N---
SYV_FRATT       ---------DEKIIIATTRPETMLGDMAVAVHPEDERYTHLVGKMINLPL----T-D---
SYV_COXBU       ---------SGHLIIATTRPETLLGDVAIAVHPQDERYQPFVGKKVRLPL----T-D---
SYV_XYLFA       GNEILRET-RDSLIVATTRPETLLGDTAVMVHPEDRRYTALIGKTVTLPL----T-G---
SYV_XYLFT       GNETLRET-RDSLIVATTRPETLLGDTAVMVHPEDRRYTALIGKTVTLPL----T-G---
SYV_XANC8       GVETLRET-RDYLVVATTRPETMLGDTAVMVHPDDARYATLHAAQIVLPL----T-G---
SYV_XANCP       GVETLRET-RDYLVVATTRPETMLGDTAVMVHPDDARYATLHAAQIVLPL----T-G---
SYV_XANOR       GNETLRET-RDYLVVATTRPETMLGDTAVMVHPEDARYLTLHTARIVLPL----T-G---
SYV_XANC5       GNETLRET-RDYLVVATTRPETMLGDTAVMVHPEDARYLTLHDARIVLPL----T-G---
SYV_XANAC       GNETLRET-RDYLVVATTRPETMLGDTAVMLHPEDARYLTLHNARIVLPL----T-G---
SYV_LEGPA       ---------EEFLIVATTRPETLLGDCAVAIHPDDSRFRHLIGKQVHLPL----C-D---
SYV_LEGPH       ---------EEFLIVATTRPETLLGDCAVAIHPDDSRFRHLIGKQVHLPL----C-D---
SYV_LEGPL       ---------EEFLIVATTRPETLLGDCAVAVHPDDSRFRHLIGKQVHLPL----C-D---
SYV_METCA       ---------SGHLVVATTRPETMLGDTAVAVHPEDERYRHLIGHSVRLPL----T-G---
SYV_NITOC       ---------SGHLVVATTRPETMLGDTAVAVHPEDPRYQHLIGKTVALPL----T-D---
SYV_ACIAD       ---------HDFLVVATTRPETLLGDTAVAVHPEDERYAHLIGKNIVLPI----T-G---
SYV_PSYA2       ---------KNYLVVATTRPETSLGDTAVAVNPKDERYAHLIGKTITLPI----T-G---
SYV_PSEAE       ---------LDYLVVATTRPETLLGDAAVAVHPEDERYAKLIGQFAELPI----V-G---
SYV_PSEPK       ---------QDYLVVATTRPETLLGDAAVAVNPNDERYQALIGKFVELPL----V-G---
SYV_PSEF5       ---------NDYLIVATTRPETMLGDSAVAVNPEDERYKALIGKFVELPL----V-G---
SYV_PSESM       ---------LDYLIVATTRPETMLGDAAVAVNPQDERYKALIGKFVELPL----V-G---
SYV_PSE14       ---------LDYLIVATTRPETMLGDAAVAVNPQDERYKALIGKFVELPL----V-G---
SYV_PSEU2       ---------LDYLIVATTRPETMLGDAAVAVNPEDERYKALIGKFVELPL----V-G---
SYV_IDILO       ---------KDHLVVATTRPETMLGDVCVAVHPDDERFAHLVGKFLELPI----V-N---
SYV_MANSM       ---------LDYLVVATTRPETVLGDTAVAVHPEDERYQSLIGKTVVLPL----A-N---
SYV_PASMU       ---------KDYLVVATTRPETMLGDTAVAVHPEDERYQSLIGKTVVLPL----A-N---
SYV_HAEDU       ---------KDYLIVATTRPETVLGDTAVAVHPEDERYQSLIGKTVLLPL----A-N---
SYV_HAEI8       ---------KDYLVVATTRPETMLGDTAVAVHPEDERYQSLIGKTVVLPL----A-N---
SYV_HAEIN       ---------KDYLVVATTRPETMLGDTAVAVHPEDERYQSLIGKTVVLPL----A-N---
SYV_COLP3       ---------LDYLVVATTRPETMLGDTGVAVNPEDPRYKDLIGKQVLLPL----V-N---
SYV_PHOPR       ---------KDYIVVATTRPETMLGDTGVAVNPEDPRYKDLIGKQIKLPI----V-G---
SYV_ALIF1       ---------KDYIVVATTRPETMLGDTGVAVNPEDPRYKDLIGKEILLPI----V-N---
SYV_VIBCH       ---------KDYIVVATTRPETMLGDTGVAVNPEDPRYKDLIGKEIILPI----V-G---
SYV_VIBVU       ---------KDYIVVATTRPETMLGDTGVAVNPEDPRYQDLIGKDIILPI----V-D---
SYV_VIBVY       ---------KDYIVVATTRPETMLGDTGVAVNPEDPRYQDLIGKDIILPI----V-D---
SYV_VIBPA       ---------KDYIVVATTRPETMLGDTGVAVNPEDPRYKDLIGKEIILPI----V-D---
SYV_PHOLL       ---------KDYLIVATTRPETMLGDTGVAVNPEDPRYKDLIGKEIILPL----I-N---
SYV_YERPE       ---------KDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKEVILPL----V-G---
SYV_YERPS       ---------KDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKEVILPL----V-G---
SYV_PECAS       ---------KDYLVVATTRPETMLGDTGVAVNPEDPRYKDLIGKEVILPL----I-G---
SYV_SHIDS       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_ECOL6       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_ECOLI       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_ECO57       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_SHIBS       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_SHISS       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_SHIFL       ---------KDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKYVILPL----V-N---
SYV_SALPA       ---------KDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPL----V-N---
SYV_SALTI       ---------KDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPL----V-N---
SYV_SALCH       ---------KDYLVVATTRPETILGDTGVAVNPEDPRYQSLIGKFVILPL----V-N---
SYV_SALTY       ---------KDYLVVATTRPETILGDTGVAVNPEDPRYQSLIGKFVILPL----V-N---
SYV_PSEHT       ---------KDYIVVATTRPETMLGDSGVAVNPDDERYIDLIGKEILLPI----V-N---
SYV_SHEON       ---------KDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKYILLPI----V-N---
SYV_CHRVO       ---------DEFVTVATTRPETLLGDVAVAIAPDDERYLHLVGKQLELPL----T-G---
SYV_NEIG1       ---------TEAVIVATTRPETLLGDAAVAVNPEDERYTHLIGKELILPL----T-G---
SYV_NEIMA       ---------AEAVIVATTRPETLLGDVAVAVNPEDERYTHLIGKELILPL----T-G---
SYV_NEIMB       ---------AEAVIVATTRPETLLGDVAVAVNPEDERYTHLIGKELILPL----T-G---
SYV_NITEU       ---------HQGLVVATTRPETMLGDMAVAVHPEDERYRHLIGRHLRLPL----S-E---
SYV_THIDA       ---------SGHLTVATTRPETLLGDTAVAVHPEDERYAHLIGKHVRLPI----A-E---
SYV_BORPE       VT-------LRGMTIATTRPETMLADGALCVHPDDPRYKHLLGKLVELPL----C-D---
SYV_BORBR       VT-------LRGMTIATTRPETMLADGALCVHPDDPRYKHLLGKLVELPL----C-D---
SYV_BORPA       VT-------LRGMTIATTRPETMLADGALCVHPDDPRYKHLLGKLVELPL----C-D---
SYV_BURMA       ---------SGHLSVATTRPETMLGDVAVMVHPEDERYRHLVGRHVKLPL----C-E---
SYV_BURPS       ---------SGHLSVATTRPETMLGDVAVMVHPEDERYRHLVGRHVKLPL----C-E---
SYV_CUPPJ       ---------LTHLTVATTRPETMLGDVAVMVHPEDERYAHLIGKEVELPL----T-G---
SYV_RALSO       TG-------LTHLTVATTRPETMLGDVAVMVHPEDERYAHLIGQAVRLPL----S-GEAD
SYV_AROAE       ---------LKGLTVATTRPETMLGDVAVMVHPEDERYAHLIGKTVRLPL----C-E---
SYV_DECAR       ---------SDSLVVATTRPETMLGDTAVMVHPEDERYKHMIGQMVKLPL----T-D---
SYV_FUSNN       ---------DEYIIIATSRPETMLADVAVAVHPEDERYKHLIGKTLILPL----V-N---
SYV_BDEBA       ---------SGFLVVATTRPETMLGDSAVCVHPEDERYKHLIGKNVLLPL----T-N---
SYV_GLUOX       ----------RTITVATTRPETMLGDVAVAVHPEDERYADMIGKTVILPL----T-G---
SYV_RHOS4       EGRPTEWEERDYLTVATTRPETMLGDTGIAVNPADERYAHLIGKEVVLPL----V-G---
SYV_RUEPO       GNIVLEEE-RDYISIATTRPETMLGDGAVAVHPSDERYAPIVGKLCEIPVGPKEH-R---
SYV_SPHEL       ---------SGYIQVATTRPETMLADMAVAVHPEDERYKALIGKQVRLPI----T-D---
SYV_ZYMMO       ---------SGEIIVATTRPETMLADMAVAVNPEDDRYKALIGKNIRLPI----T-N---
SYV_CAUVC       DGKATEFETRDYIVVATTRPETMLGDTGVAVHPDDERYKGLVGKFVTLPI----V-G---
SYV_NITWN       ---------STYIVVATTRPETMLGDTAVAVHPENAKLEYLIGSNVVLPL----A-G---
SYV_BRADU       ---------SSFIVVATTRPETMLGDTGVAVHPDDERYQKLIGKHVILPL----V-G---
SYV_RHOPA       ---------SSFIVVATTRPETMLGDSAVAVNPEDERYTHLVGKHVILPL----V-G---
SYV_BARHE       ---------TTFITVATTRPETMLGDTGIAVNPEDDRYRNLIGQNAILPL----V-G---
SYV_BARQU       ---------TTFITVATTRPETMLGDTGIAVNPEDDRYKNLIGQSALLPL----V-G---
SYV_AGRFC       DGTPTEFETRDYIVVATTRPETMLGDTGVAVNPEDERYKGIVGKHVILPI----V-G---
SYV_RHIME       DGNATEWETRNYLVVATTRPETMLGDTGVAVHPDDVRYKGIVGKHVILPI----V-G---
SYV_RHILO       ---------KTFITVATTRPETMLGDTAVAVHPDDERYRHLVGKNVVLPI----V-G---
SYV_BRUME       ---------HTYIIVATTRPETMLGDTGVAVNPKDERYHALVGNDVILPL----V-G---
SYV_BRUSU       E------NPHTYIIVATTRPETMLGDTGVAVNPKDERYHALVGNDVILPL----V-G---
SYV_DESPS       ---------SGSVVIATTRPETMPGDTAIAVHPDDERYAHLGEIGIKLPL----T-D---
SYV_DESVH       ---------SGSVVIATTRPETIMADTGVCVHPEDERYAGLIGKKILVPV----I-G---
SYV_GEOSL       ---------GRFVVVATTRPETMLGDTAVAVHPEDERYADLVGKKVLLPL----V-N---
SYV_PELCD       ---------DRHLVVATTRPETMLGDTAVAVHPEDERYADLIGKFIMLPL----M-D---
SYV_DEHM1       ---------SGFVTVATTRPETMLGDTAVAVHPDDARYTGMVGKNVLLPI----M-N---
SYV_DEHMC       ---------SGFVTVATTRPETMQGDTAVAIHPDDTRYAGMVGKNVVLPI----M-N---
SYV_SYMTH       ---------SGSIVIATTRPETMLGDTAVAVNPEDERYKHLVGKMLRHPA----T-G---
SYV_LACCA       ---------SGYIEIATTRPETMMGDTAVAVHPGDERYKDMVGTELILPL----A-N---
SYV_LACAC       ---------SGFVEIATTRPETMFGDTAVAVAPGDPRYKDIVGKELILPL----V-G---
SYV_LACJO       ---------SGFVEIATTRPETMFGDTAVAVAPGDERYKDIVGKELVLPL----V-G---
SYV_STAS1       ---------NGYIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAAR       ---------EGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAAC       ---------EGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAAN       ---------EGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAAS       ---------EGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAAW       ---------EGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAAM       ---------EGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAEQ       ---------NGYIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAES       ---------NGYIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPI----V-G---
SYV_STAHJ       ---------DGYIEIATTRPETMLGDTAIVVNPNDDRYKDVIGKKVILPI----V-G---
SYV_LACPL       ---------KHYIEIATTRPETMMGDTAVAVNPSDDRYKELVGKKVILPL----A-E---
SYV_LACSS       ---------SGSIEIATTRPETLPGDTAIAVHPDDERYADLVGKTVTLPL----M-N---
SYV_ENTFA       ---------SGVVEIATTRPETMLGDTAIAVHPEDERYQELIGKTVVLPL----V-D---
SYV_LACLA       ---------DEFVEIATTRPETFLGDTAVIVNEKDERYKHLVGKNVILPI----I-N---
SYV_STRMU       ---------SRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGQNVILPI----V-N---
SYV_STRA5       ---------SRALEVATTRPETMFGDVAVAVNPEDARYKDLIGQNVILPI----I-N---
SYV_STRA1       ---------SRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPI----I-N---
SYV_STRA3       ---------SRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPI----I-N---
SYV_STRT1       ---------SRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPI----L-N---
SYV_STRT2       ---------SRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPI----L-N---
SYV_STRP1       ---------SRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPI----V-N---
SYV_STRPM       ---------SRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPI----V-N---
SYV_STRP6       ---------SRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVLLPI----V-N---
SYV_STRP3       ---------SRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVILPI----V-N---
SYV_STRP8       ---------SRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVILPI----V-N---
SYV_STRPN       ---------SRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPI----A-N---
SYV_STRR6       ---------SRALEVATTRPETMFGDVAIAVNPEDPRYKDLIGKNVILPI----A-N---
SYV_LISIN       ---------SGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPI----L-N---
SYV_LISMF       ---------SGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPI----L-N---
SYV_LISMO       ---------SGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPI----L-N---
SYV_OCEIH       ---------DETIEIATTRPETMLGDTAVAVHPKDERYQHLIGKTVILPI----V-G---
SYV_BACC1       ---------SGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPI----V-G---
SYV_BACCZ       ---------SGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPI----V-G---
SYV_BACCR       ---------SGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPI----V-G---
SYV_BACAN       ---------SGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPI----V-G---
SYV_BACHK       ---------SGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPI----V-G---
SYV_BACSK       ---------SGSIEIATTRPETMLGDTAVAVHPDDERYQHLIGKMVKLPI----V-G---
SYV_BACHD       ---------DGAIEVATTRPETMLGDTAVAVHPEDERYQHLIGKMVKLPI----T-G---
SYV_GEOSE       ---------SGFIEVATTRPETMLGDTAVAVHPDDERYKHLIGKMVKLPI----V-G---
SYV_GEOKA       ---------SGCIEVATTRPETMLGDTAVAVHPDDERYKHLIGKMVKLPI----V-G---
SYV_BACLD       ---------SGSIEIATTRPETMLGDTAVAVHPEDERYKHLIGKTVILPI----T-G---
SYV_BACSU       ---------SGSIEIATTRPETMLGDTAVAVHPEDERYKHLIGKTVILPI----V-N---
SYV_THEMA       ---------DEYIVVATTRPETMLGDTAVAVHPEDERYKNFVGKTLILPL----V-G---
SYV_CARHZ       ---------SGYLTVATTRPETMLGDTAVAVHPEDERYRELIGKNVILPL----V-N---
SYV_CALS4       ---------EDYVVIATTRPETMLGDVAVAVHPEDERYRHLIGKTLILPL----V-G---
SYV_CLOPE       ---------EEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPL----T-D---
SYV_CLOAB       ---------DSFIEIATTRPETMLGDTAVAVNPKDERYKEFIGKLLVLPL----L-G---
SYV_CLOTE       ---------EEYLEIATTRPETMLGDTAVAVNPNDERYKHLIGKKLMLPL----V-N---
                              ::* * **   *  :     : .           *           

SYV_MYCGA       -------KLIPILVDEYIDMEFGSAVMKCTPGHDHNDYALSKKYQL---EELSCINFDGT
SYV_MYCGE       -------KQIPVVTDSYVDIKFGTGILKCTPAHDFNDYEINTKYKF---DFLSCIDSNGI
SYV_MYCPN       -------ALMPVFTDSYVDKKFGTGVLKCTPAHDFNDFALNEKYRL---PFVSCIDHNGL
SYV_MYCPE       -------KEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIISCFNEDGT
SYV_MYCS5       -------KRLPLIFDEYVKIKFGSGLMKLS-AHAEADIEIIEKLGL---EVIETIDKNGY
SYV_MYCH2       -------KLIKIIADSNVGSDFGSGIMKVS-AHSILDFEIMEKHNL---ESKDCIDNYGN
SYV_MYCH7       -------KLIIIIADSNVSSDFGSGIMKVS-AHSILDFEIMEKHNL---ESKDCIDNYGN
SYV_MYCHJ       -------KLIIIIADSNVSSDFGSGIMKVS-AHSILDFEIMEKHNL---ESKDCIDNYGN
SYV_MYCMO       -------KIIKMHSDDYAIMNFGSGIVKIS-AHDMNDFDVIKRLNL---EVIETIDKFGK
SYV_MYCPU       -------KRLPIITDDYIDQSFASGFMKIS-AHSLADIDILNKNNL---EIVESIDESGF
SYV_PARUW       -------RLIPIIADHHVDPSFGTGVVKITPAHDPNDYQIGLSHRL---PFINIMTPDGK
SYV_CHLPN       -------RQIPIIGDASVDPTFGTGAVKVTPAHDKDDYLMGTNHHL---PMINILTPSGG
SYV_CHLMU       -------REIPIIGDFSVDASFGTGAVKITPAHDKDDYRTGMNHRL---PMINILTPTGE
SYV_CHLTR       -------REIPIIGDFSVDASFGTGAVKITPAHDKDDYKTGMNHQL---PMINILTPTGE
SYV_CHLAB       -------REIPIIADMSVDPLFGTGAVKITPAHDKDDYRTGMHHNL---PMINILTPTGE
SYV_CHLCV       -------REIPIIGDMSVDPLFGTGAVKITPAHDRDDYRTGINHNL---PMVNILAPTGE
SYV_ONYPE       -------IQIPVISDNYVDINFGTGVVKVTPGHDINDFEVAKRHQL---KALLCMNEDGT
SYV_UREPA       -------IEMTVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNL---EIINIMNADGT
SYV_PORGI       -------RAVPIIEDEYVDMEFGTGCLKVTPAHDVNDYMLGQKHRL---ESIDIFHDNGI
SYV_BACFN       -------RVIPVIEDDYVDIEFGTGCLKVTPAHDVNDYMLGEKYNL---PSIDIFNDNGT
SYV_BACFR       -------RVIPVIEDDYVDIEFGTGCLKVTPAHDVNDYMLGEKYNL---PSIDIFNDNGT
SYV_BACTN       -------RVIPVIEDDYVDIEFGTGCLKVTPAHDVNDYMLGEKYNL---PSIDIFNDNGT
SYV_WIGBR       -------RSIPIIQDDYVKMDYGSGCVKITPGHDFNDFSICKNHKL---NIINILTISGK
SYV_DEIRA       -------RWVPIIADEAVEMEFGVGALKITPAHDPTDFEVGERHGL---ERPSVIDLDGN
SYV_THET8       -------VWIPILADPAVEKDFGTGALKVTPAHDPLDYEIGERHGL---KPVSVINLEGR
SYV_THETH       -------VWIPILADPAVEKDFGTGALKVTPAHDPLDYEIGERHGL---KPVSVINLEGR
SYV_THET2       -------VWIPILADPAVEKDFGTGALKVTPAHDPLDYEIGERHGL---EPVSVINLEGR
SYV_HELPJ       -------RTIPIIADAHVEMGFGTGCVKVTPGHDFNDYEVGKRHHL---ETIKIFDEKGI
SYV_HELPY       -------RTIPIIADEHVEMEFGTGCVKVTPGHDFNDYEVGKRHHL---ETIKIFDEKGI
SYV_CAMJE       -------KAIKIIADKHVEKEFGTGVVKVTPAHDMNDYEVGLRHNL---DFISVFDEKGI
SYV_CAMJR       -------KAIKIIADEHVEKEFGTGVVKVTPAHDMNDYEVGLRHNL---DFISVFDEKGI
SYV_HELHP       -------REIPIIADSHVDMSFGSGCVKVTPAHDMNDYEVGKRHNL---PFITIFDEKGI
SYV_WOLSU       -------REIQIIADSYVDREFGTGMVKVTPAHDPNDYEVGKRHDL---EFITVFDKEGY
SYV_BORBU       -------KKIKVIADFYVDSAFGTGALKVTPAHDPNDFEISKRHNI---SKVNILTQDGK
SYV_BORBP       -------KKIKIIADFHVDSAFGTGALKITPAHDPNDFEISKRHNI---PKVNILTQDGK
SYV_MESFL       -------QAIPIIADDYVELDFGTGVMKCTPAHDLNDFEIAVRHNL---EKPICMNEDGT
SYV_MYCMS       -------QVIPIISDEYVDIEFGTGVMKCTPAHDLNDYHLGIKHNL---KMPICLNIDGS
SYV_PELUB       -------KKIKIIEDEYADPEMGTGALKITPAHDFNDYEVGQRNNL---EIINIFTEGGK
SYV_TREDE       -------RKIPVIADSYVDKEFGTGVVKITPAHDPNDWEVGKRHNL---PVLNILNPDGT
SYV_TREPA       -------RIVPIIADSYVAQDFGTGMVKITPAHDPNDWDIGTRHSL---EAINMLNPDGS
SYV_GLOVI       -------RRIVIVGDEAVDREFGTGAVKVTPAHDPNDFEIGKRHGL---PMINLLNPNGT
SYV_PROMP       -------REIPVISDIHVDKDFGTGCVKVTPAHDPNDFAIGKRNNL---KQINIMNKDGT
SYV_PROMA       -------REIPVIADDHVDMDFGTGCVKVTPAHDPNDFAIGQRHNL---RQITVMNKDGT
SYV_PROMT       -------RTIPIIGDPHVDKDFGTGCVKVTPAHDPNDFEIGQRHDL---PQITVMTKKGT
SYV_PROMM       -------REIPVIADDHVDQDFGTGCVKVTPAHDPNDFAIGRRHDL---PQITVMNKNGS
SYV_SYNPX       -------REIPIVADDHVEKDFGTGCVKVTPAHDPNDFAIGQRHGL---PQITVMRKNGT
SYV_THEEB       -------REIPIIGDPLVDPTFGTGCVKVTPAHDPNDFVMGQRHRL---PMMNLMNKDGT
SYV_SYNP6       -------REIPIIADPWVEAEFGTGCVKVTPAHDPNDFAMGQRHQL---PLITVMNKDGT
SYV_NOSS1       -------QEIPIISDELVDPAFGTGCVKVTPAHDLNDFEMGKRHNL---PFINILNKDGT
SYV_SYNY3       -------REIPIVADELVDPEFGTGCVKVTPAHDPNDFVMGQRHNL---PFINLLNKDGS
SYV_LEPIC       -------RQIPLLFDSFVDKEFGSGLVKITPAHDANDFEAGQRLGL---KPLLVMNPNGT
SYV_LEPIN       -------RQIPLLFDSFVDKEFGSGLVKITPAHDANDFEAGQRLGL---KPLLVMNPNGT
SYV_STRAW       -------RFIPVVADTHVDPEFGTGAVKVTPAHDPNDFEIGQRHNL---PNIAVMDEHAV
SYV_STRCO       -------RSIPVVADEHVDPEFGTGAVKVTPAHDPNDFEIGQRHGL---PAIAVMDEHAV
SYV_CORJK       -------RQMIVVADDYVDPEFGTGAVKITPAHDPNDFAMGQRHDL---PMPVIMDETGH
SYV_CORDI       -------RQMIVVADDYVDPEFGTGAVKITPAHDPNDYALGLRHNL---DMPNIMDATGH
SYV_COREF       -------LTLKVVADDYVDPEFGSGAVKITPAHDPNDYALGLRHHL---DMPTIMDKTGR
SYV_CORGL       -------LSLKVVADDYVDPEFGSGAVKITPAHDPNDYALGLRHNL---DMPTIMDKTGR
SYV_NOCFA       -------RQIPIVADDYVDPEFGSGAVKITPAHDPNDFEIGLRHNL---PMPTIMDERGR
SYV_MYCLE       -------RELVIVADEHVDPEFGTGAVKVTPAHDPNDFEIGLRHNL---PMPNVMDVKAV
SYV_MYCBO       -------RELAIVADEHVDPEFGTGAVKVTPAHDPNDFEIGVRHQL---PMPSILDTKGR
SYV_MYCTU       -------RELAIVADEHVDPEFGTGAVKVTPAHDPNDFEIGVRHQL---PMPSILDTKGR
SYV_MYCPA       -------RQLLIVADEHVDPEFGTGAVKVTPAHDPNDFEIGLRHQL---PMISIMDTRGR
SYV_BUCBP       -------RIIPIISDEFVDVNKGTGCVKITPAHDFNDYEIAMRHNL---SIINVFTRNGK
SYV_BLOFL       -------RRIPIISDKFVNINKGTGCVKITPAHDFNDYIIGKKYKL---PMINIFSTYKT
SYV_BLOPB       -------RRIPIISDKNVDMFKGTGCLKITPAHDFNDYIIGKRHGL---PMINIFSLNGK
SYV_BUCAI       -------RIIPIIKDRYADLEKGTGCVKITPAHDFNDYKVGLHHKL---PMINIFTFDGR
SYV_BUCAP       -------RIIPIIADHYADMNKDTGCVKITPGHDFNDYEVGQRHKL---PMINIFTFNGK
SYV_FRATT       -------RQIPIIADDYVEKDFGTGCVKITPAHDFNDYEMGKRHNL---PMLNILTDDAT
SYV_COXBU       -------RTIPVIADEAVDKEFGTGSLKITPGHDFNDYEIGQRHQL---PLINILTSEGY
SYV_XYLFA       -------RHIPVIGDAYVDPTFGTGVVKVTPAHDFNDYQIGLRHRL---PMIQVLDDAAC
SYV_XYLFT       -------RQIEVISDTYVEPTFGTGVVKVTPAHDFNDYQVGLRHRL---PMIQVLDDAAC
SYV_XANC8       -------RLVPVITDDYVDRAFGTGVVKVTPAHDFNDYQVGVRHDL---PLINLFTVTAA
SYV_XANCP       -------RLVPVITDDYVDRAFGTGVVKVTPAHDFNDYQVGVRHDL---PLINLFTVTAA
SYV_XANOR       -------RHVPVITDDYVDRAFGTGVVKVTPAHDFNDYQVGERHNL---PLVNLFTADAK
SYV_XANC5       -------RHVPVITDDYVDRAFGTGVVKVTPAHDFNDYQVGERHNL---PLVNLFTVDAK
SYV_XANAC       -------RHVPVITDDYVDRAFGTGVVKVTPAHDFNDYQVGVRHDL---PLINLFTVTAT
SYV_LEGPA       -------RTIPVIADDYVDKEFGSGCVKITPAHDFNDHEVGKRHQL---PQINILTKKGT
SYV_LEGPH       -------RTIPVIADDYVDKEFGSGCVKITPAHDFNDHEVGKRHQL---PQINILTKKGT
SYV_LEGPL       -------RTIPVIADDYVDKEFGSGCVKITPAHDFNDHEVGKRHQL---PQINILTKKGT
SYV_METCA       -------REIPVIGDTYVDPEFGSGCVKITPAHDFNDYAIGVRHAL---PMISIFDQGAA
SYV_NITOC       -------RTIPVIADDYVEPEFGSGCVKITPAHDFNDYEVGQRHGL---PFINIFTVDAS
SYV_ACIAD       -------RLVPIVADEYVEKDFGTGCVKITPAHDFNDYDLGKRHDL---PIINIFNKNAE
SYV_PSYA2       -------RIVPIVADDYVDIEFGTGCVKITPAHDFNDYELGRRHEL---PLINILDAHAH
SYV_PSEAE       -------RHIPIIADEYVDREFGTGCVKITPAHDFNDYEVGKRHDL---PLINIFDKNAA
SYV_PSEPK       -------RRIPIIADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNL---PLLNIFDKNAF
SYV_PSEF5       -------RRIPIIADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNL---PLLNIFDKNAA
SYV_PSESM       -------RRIPIIADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNL---PLLNIFDKNAN
SYV_PSE14       -------RRIPIIADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNL---PLLNIFDKNAN
SYV_PSEU2       -------RRIPIIADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNL---PLLNIFDKNAN
SYV_IDILO       -------RRIPIVADHHVDSEFGTGCVKVTPAHDFNDYEIGKRHQT---GMISIFDDTAH
SYV_MANSM       -------REIPIVADEYVDREFGTGVVKITPAHDFNDYEVGKRHNL---PMVNVMTFNAD
SYV_PASMU       -------REIPIIADDYVDREFGTGVVKITPAHDFNDYEVGKRHQL---PMVNVMTLNAD
SYV_HAEDU       -------REIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHAL---PMVNVMTMNAD
SYV_HAEI8       -------REIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHNL---PMVNVLTLNAN
SYV_HAEIN       -------REIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHNL---PMVNVLTLNAN
SYV_COLP3       -------RLIPIVGDDHADMEKGTGCVKITPGHDFNDNEVGKRHAL---PQINILDKDAA
SYV_PHOPR       -------RLIPIVGDEHADMDKGTGCVKITPAHDFNDYEVGKRHSL---PMINILTFNAD
SYV_ALIF1       -------RLIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRNQL---PMINILTFNAD
SYV_VIBCH       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHQL---PMINILTFDAN
SYV_VIBVU       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHQL---PMINILTFDAN
SYV_VIBVY       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHQL---PMINILTFDAN
SYV_VIBPA       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHQL---PMINILTFDAN
SYV_PHOLL       -------RRIPIIGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINIMTFDGN
SYV_YERPE       -------RRIPILGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_YERPS       -------RRIPILGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_PECAS       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHQL---PMVNILTFDGD
SYV_SHIDS       -------RRIPIVGDEHAYMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_ECOL6       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_ECOLI       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_ECO57       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SHIBS       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SHISS       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SHIFL       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SALPA       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SALTI       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SALCH       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_SALTY       -------RRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHAL---PMINILTFDGD
SYV_PSEHT       -------RRIKIVADEHADKDKGTGCVKITPAHDFNDNEVGKRHKM---PMINIFDKDAA
SYV_SHEON       -------RRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHKL---PMFNVLTLDAA
SYV_CHRVO       -------RTIPVIADSYVDKEFGTGFVKITPAHDFNDYEVGKRHGT---QLINVMSLEAK
SYV_NEIG1       -------RTIPVIADEYVEKDFGTGCVKITPAHDFNDYEVGKRHDT---RLINVFDLEAK
SYV_NEIMA       -------RTIPVIADEYVEKDFGTGCVKITPAHDFNDYEVGKRHDT---RLVNVFDLEAK
SYV_NEIMB       -------RTIPVIADEYVEKDFGTGCVKITPAHDFNDYEVGKRHDT---RLINVFNLEAK
SYV_NITEU       -------RTIPIIADSYVDPAFGTGCVKITPAHDFNDYQVGLRHKL---IPLNVFTLDGK
SYV_THIDA       -------RSIPVIADEYVDREFGTGVVKITPAHDFNDWQVGQRHKL---MAISVLTLDAK
SYV_BORPE       -------RNIPIIADDFVDPDFGTGCVKITGAHDFNDYACALRHDI---PLIVIFTLDAH
SYV_BORBR       -------RNIPIIADDFVDPDFGTGCVKITGAHDFNDYACALRHDI---PLIVIFTLDAH
SYV_BORPA       -------RNIPIIADDFVDPDFGTGCVKITGAHDFNDYACALRHDI---PLIVIFTLDAH
SYV_BURMA       -------REIPIIADDYVDREFGTGVVKVTPAHDFNDYQVGLRHAL---APIEILTLDAK
SYV_BURPS       -------REIPIIADDYVDREFGTGVVKVTPAHDFNDYQVGLRHAL---APIEILTLDAK
SYV_CUPPJ       -------RRIPVIADEYVDREFGTGVVKVTPAHDFNDYAVGQRHNL---PQISILTLDAK
SYV_RALSO       ALDTAQWREIPIIGDEYVDRAFGTGVVKVTPGHDFNDYAVGQRHGL---PQISVLTLEAK
SYV_AROAE       -------RDIPIIGDDYVDREFGTGCVKVTPAHDFNDYAVGLRHNL---PMISILRLDAH
SYV_DECAR       -------REIPIIADSYVDLEFGTGCVKVTPAHDFNDYAVGQRHGL---PMISILTLDAK
SYV_FUSNN       -------REIPVIADEYVDKEFGTGALKITPAHDPNDYNLGKKYNL---PIINMLTPDGK
SYV_BDEBA       -------RKIKIIADTYVDKEFGSGVVKITPAHDFNDYKIGKTHNL---EFINILTKKAE
SYV_GLUOX       -------RRIPVVADLHSDPEKGTGAVKITPAHDFNDFEVGKRHDL---PAPTVLDETAC
SYV_RHOS4       -------RRIPIVADDYADPSKGTGAVKITPAHDFNDWGVGQRTGL---RAINVMSGRAT
SYV_RUEPO       -------RQIPIITDEYPDKNFGSGAVKITGAHDFNDYAVAKRGGI---PLYRLMDTRGQ
SYV_SPHEL       -------RLIPIVGDEHADPELGSGAVKITPGHDFNDFEVGVRAGIKAGEMLNMLDAKAA
SYV_ZYMMO       -------RLIPIIADIHADPELGSGAVKITPGHDFNDFEVGKRAGIKPADMLNMLDSHAR
SYV_CAUVC       -------RRIPIVADDYADPTKGSGAVKITPAHDFNDFGVGKRAGL---EAINILTVEAK
SYV_NITWN       -------RIIPIVGDDYADPEKGTGAVKITPAHDFNDFEVGRRHHL---PQISVLDREGR
SYV_BRADU       -------RKVEIVADDYSDPEKGSGAVKVTPAHDFNDFEVGNRHGL---RRISVLDKEGC
SYV_RHOPA       -------RRIPIVADEYSDPEKGSGAVKITPAHDFNDFEVGKRHHL---PQINVLDIEGK
SYV_BARHE       -------RRLSIVADAYANPDEGSGAVKITPAHDFNDFEVGRRNNL---RLINIFTEKAE
SYV_BARQU       -------RRLLIVADGYADPSEGSGAVKITPAHDFNDFEVGKRNNL---RLINVFTQKAE
SYV_AGRFC       -------RKIPIVADDYADPTAGTGAVKITPAHDFNDFEVGKRCGL---RAINVMNIDGT
SYV_RHIME       -------RRIPIVADEYPDPTTGTGAVKMTPAHDFNDFDVGKRQGL---RQVNVLTADGR
SYV_RHILO       -------RKIPVVADEYSDPEKGSGAVKITPAHDFNDFEVGKRHKL---PAINILTVEAA
SYV_BRUME       -------RHIPIVADDYADPEAGSGTVKITPAHDFNDFEVGKRNNL---RAINILTPEAA
SYV_BRUSU       -------RHIPIVADDYADPEAGSGAVKITPAHDFNDFEVGKRNNL---RAINILTPEAA
SYV_DESPS       -------RILPVVFDHHVEKDFGTGALKVTPSHDRNDYEIGIRHGL---DLCKVIDEKGM
SYV_DESVH       -------RAVPLFADTYVDREFGTGALKVTPCHDPNDWTLGERHGL---AFIQCIDEDGN
SYV_GEOSL       -------REIPVVADGYVDREFGTGVVKITPAHDFNDFEVGRRHNL---DLLNVFDESAV
SYV_PELCD       -------RQIPIIADEYVDKEFGSGAVKITPAHDFNDFEIGKRHDL---EFINIFDESGV
SYV_DEHM1       -------RRIPVIADEAVDMAFGTGAVKVTPAHDPNDFEMGLRHSL---PMITIQNRDTT
SYV_DEHMC       -------RRIPVIADEAVDMAFGTGAVKVTPAHDPNDFEMGLRHNL---PMITIQNRDTT
SYV_SYMTH       -------REIPIIADEYVDPAFGTGCVKITPFHDPNDFEIGLRHGL---EMPQVIGPKGE
SYV_LACCA       -------RKIPIIEDAYVDPEFGTGAVKITPAHDPNDFQVGNRHDL---KRINTMNDDGT
SYV_LACAC       -------RHIPIIEDQHVDPEFGTGLVKITPAHDPNDFQVGNRHNL---KRINVMNDDGT
SYV_LACJO       -------RHIPIIEDQHVDPEFGTGLVKITPAHDPNDFQVGNRHNL---ERINVMNDNGT
SYV_STAS1       -------RELPILADEYVDIEFGSGAMKVTPAHDPNDFEIGNRHDL---ERIIVMDESGK
SYV_STAAR       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDENGK
SYV_STAAC       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDENGK
SYV_STAAN       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDENGK
SYV_STAAS       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDENGK
SYV_STAAW       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDENGK
SYV_STAAM       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDENGK
SYV_STAEQ       -------RELPILADEYVDIEFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDEYGK
SYV_STAES       -------RELPILADEYVDIEFGSGAMKVTPAHDPNDFEIGQRHQL---ENIIVMDEYGK
SYV_STAHJ       -------RELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHSL---ENIIVMDENGK
SYV_LACPL       -------REIPIIADAYVDPEFGTGMVKITPAHDPNDFKVGNRHDL---KRINTMNDDAS
SYV_LACSS       -------REIPIIADHYVDKDFGTGALKITPAHDPNDFEVGNRHDL---PRINVMNEDAS
SYV_ENTFA       -------KEIPIIADDYVDMEFGTGVVKITPAHDPNDFEVGNRHDL---PRVNVMNEDGT
SYV_LACLA       -------RVIPILTDDHADMEKGTGVVKITPAHDPNDFEVAMRHDL---PMINMMNNDGT
SYV_STRMU       -------KLIPIVADEHADPEFGTGVVKITPAHDPNDFLVGQRHNL---PQVNVMNDDGT
SYV_STRA5       -------KPIPIVADEHADPEFGTGVVKITPAHDPNDFAVGQRHNL---PQVNVMNDDGT
SYV_STRA1       -------KPIPIVADEHADPEFGTGVVKITPAHDPNDFAVGQRHNL---PQVNVMNDDGT
SYV_STRA3       -------KPIPIIADEHADPEFGTGVVKITPAHDPNDFAVGQRHNL---PQVNVMNDDGT
SYV_STRT1       -------KPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNL---PQVNVMNDDGT
SYV_STRT2       -------KPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNL---PQVNVMNDDGT
SYV_STRP1       -------KLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNL---PQVNVMNDDGT
SYV_STRPM       -------KLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNL---PQVNVMNDDGT
SYV_STRP6       -------KLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNL---PQVNVMNDDGT
SYV_STRP3       -------KLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNL---PQVNVMNDDGT
SYV_STRP8       -------KLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNL---PQVNVMNDDGT
SYV_STRPN       -------KLIPIVGDEHADPELGTGVVKITPAHDPNDFLVGQRHNL---PQVNVMNDDGT
SYV_STRR6       -------KLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNL---PQVNIMNDDGT
SYV_LISIN       -------REIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHDL---PRIIVMHEDGT
SYV_LISMF       -------REIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHEL---PRIIVMHEDGT
SYV_LISMO       -------REIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHNL---PRIIVMHEDGT
SYV_OCEIH       -------REIEIVADDYVDMELGSGAVKITPAHDPNDFEIGNRHQL---ERILVMNEDGS
SYV_BACC1       -------REIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDL---PRILVMNEDGT
SYV_BACCZ       -------REIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDL---PRILVMNEDGS
SYV_BACCR       -------REIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDL---PRILVMNEDGS
SYV_BACAN       -------REIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDL---PRILVMNEDGS
SYV_BACHK       -------REIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDL---PRILVMNEDGS
SYV_BACSK       -------REIPIIADDYVDREFGSGAVKITPAHDPNDFEIGNRHNL---PRVLVMNEDGT
SYV_BACHD       -------REIPIVADDYVDMEFGSGAVKITPAHDPNDFEIGNRHNL---PRILVMNEDGT
SYV_GEOSE       -------REIPIIADEYVDMEFGSGAVKITPAHDPNDFEIGNRHNL---PRILVMNEDGT
SYV_GEOKA       -------REIPIIADEYVDMEFGSGAVKITPAHDPNDFEIGNRHNL---PRILVMNEDGT
SYV_BACLD       -------REIPIVGDDYVDMEFGSGAVKITPAHDPNDFEIGNRHNL---ERILVMNEDGT
SYV_BACSU       -------REIPIVGDDYVDMEFGSGAVKITPAHDPNDFELGNRHNL---ERILVMNEDGT
SYV_THEMA       -------REIPVVADKYVDPKFGTGAVKVTPAHDPNDYLIAQRHNL---PMIEIFDDNAR
SYV_CARHZ       -------RPIPVIADEYVDKEFGTGAVKITPAHDPNDFEVGLRHKL---PQVVVLDDDAV
SYV_CALS4       -------REIPVIADEYVDPSFGTGAVKVTPAHDPNDFEIGVRHNL---PFVNIMNENAT
SYV_CLOPE       -------REIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNL---PQIRVMDDSGV
SYV_CLOAB       -------RKIPVVADDYVDMEFGTGAVKITPAHDPNDYEVGKRHDL---KEIVMLNNDGT
SYV_CLOTE       -------REIPIVADDYVDVEFGTGAVKITPAHDPNDYEVGKRHDL---EEIIIMNENGT
                         : :  *         . :* :  *   *                       

SYV_MYCGA       LNELALE-------------------------------------FSGLDLYEARELIVKK
SYV_MYCGE       LNQNASK-------------------------------------FQGLSVLQARNKIVKW
SYV_MYCPN       LNEHAKQ-------------------------------------FTGLTVSAARQQVVEF
SYV_MYCPE       TNNYAVG-------------------------------------FENLKIADARVKCVEY
SYV_MYCS5       INAPDYQ-------------------------------------WHKMERFEAREKMAQF
SYV_MYCH2       LNHEVPE-------------------------------------FQGQNRFFARDLIAKK
SYV_MYCH7       LNHEVPE-------------------------------------FQGQNRFFARDLIAKK
SYV_MYCHJ       LNHEVPE-------------------------------------FQGQNRFFARDLIAKK
SYV_MYCMO       MTNAIPE-------------------------------------FENMSSLEARENIVLK
SYV_MYCPU       LTNICDE-------------------------------------FEGMERFEAREKIAQK
SYV_PARUW       INENGGH-------------------------------------FQGLSMTEARHAVVSE
SYV_CHLPN       INENGGP-------------------------------------FAGMAKEKAREEILIA
SYV_CHLMU       INENGGI-------------------------------------FTGLAKESARENIITS
SYV_CHLTR       INENGGI-------------------------------------FTGLSREVARENIITS
SYV_CHLAB       INENGGI-------------------------------------FAGLSKEKARESIITA
SYV_CHLCV       INENGGI-------------------------------------FAGLSKEKAREDIITA
SYV_ONYPE       MNDLALQ-------------------------------------YQGLDRFVCRQKLVQT
SYV_UREPA       LNEKCGE-------------------------------------FKGLDRLEARSLIIDK
SYV_PORGI       LNEHGGP-------------------------------------YAGMDRFDVRKKIEQD
SYV_BACFN       ISEAAGM-------------------------------------YIGMDRFDVRKQIEKD
SYV_BACFR       ISEAAGM-------------------------------------YIGMDRFDVRKQIEKD
SYV_BACTN       LSEAAGL-------------------------------------YIGMDRFDVRKQIEKD
SYV_WIGBR       ICKKPKV-------------------YDFNGNSVSDTNIKIPKELQGLSISEARNNIVYK
SYV_DEIRA       LTRDELV----------------------------------PAEFQGLERFAARKAVVKA
SYV_THET8       MEGERVP-----------------------------------EALRGLDRFEARRKAVEL
SYV_THETH       MEGERVP-----------------------------------EALRGLDRFEARRKAVEL
SYV_THET2       MEGERVP-----------------------------------EALRGLDRFEARRKAVEL
SYV_HELPJ       LNAHCGE-------------------------------------FENLERLEARDKVVAA
SYV_HELPY       LNAHCGE-------------------------------------FENLERLEARDKVVER
SYV_CAMJE       LNEHCLE-------------------------------------FQGLERLEAREKIVAK
SYV_CAMJR       LNEHCLE-------------------------------------FQGLERLEAREKIVAK
SYV_HELHP       FNKNAGI-------------------------------------FQGQERLESRPLIVQK
SYV_WOLSU       LNHHAGE-------------------------------------FEGLERLEAREAIVAK
SYV_BORBU       LNKNVPL------------------------------------QYQGLSAKDARFKIETE
SYV_BORBP       LNENVPL------------------------------------QYQGLSIKDARFKIEIE
SYV_MESFL       INEMGGE------------------------------------EYQGLDRFEARNKIIEN
SYV_MYCMS       VNQLGGK-------------------------------------YQGLDRFVARKKIIKN
SYV_PELUB       VNENAPK------------------------------------EYIGLDRFEARKRIIKE
SYV_TREDE       LNDAVPE------------------------------------KYRGLSTEKARKAVIED
SYV_TREPA       LNDQVPA------------------------------------AYRGLSCAQARIQIVAD
SYV_GLOVI       YNENAGP-------------------------------------YAGLDRFVVRKQVVAR
SYV_PROMP       LNINAGK-------------------------------------FQDLDRFDARKKIIKE
SYV_PROMA       MNAEAGP-------------------------------------FEGLDRFEARKAVVKA
SYV_PROMT       MNHNAGQ-------------------------------------FEGLDRFEAREAVIDS
SYV_PROMM       MNGHAGR-------------------------------------FEGLDRFEARKAVVAA
SYV_SYNPX       MNKEAGQ-------------------------------------FEGLDRFEARKAVVAG
SYV_THEEB       LNENAGE-------------------------------------FAGLDRFVARKQVVAR
SYV_SYNP6       MNENAGQ-------------------------------------FEGLDRFEARKAVVAA
SYV_NOSS1       LNANGGE-------------------------------------FAGQDRFVARKNVVSR
SYV_SYNY3       LNENGGD-------------------------------------FAGQDRFEARKNVVQA
SYV_LEPIC       MNENAGI-------------------------------------YQGLDRFEARKKVLAD
SYV_LEPIN       MNENAGI-------------------------------------YQGLDRFEARKKVLAD
SYV_STRAW       ITVSGP--------------------------------------FQGLDRLEARSAIVAA
SYV_STRCO       ITAHGP--------------------------------------FQGQDRLEARSAIVAA
SYV_CORJK       IANTGTE-------------------------------------FDGMERYEAREKIRLA
SYV_CORDI       IAGTGTQ-------------------------------------FDGMDRFEARVKIREA
SYV_COREF       IADTGTQ-------------------------------------FDGMTREEARVKVREA
SYV_CORGL       IADTGTQ-------------------------------------FDGLTREEARIKVREE
SYV_NOCFA       IANTGTE-------------------------------------FDGMDRFEARVKVRER
SYV_MYCLE       IVDTGTE-------------------------------------FDGMDRFEARIAVREA
SYV_MYCBO       IVDTGTR-------------------------------------FDGMDRFEARVAVRQA
SYV_MYCTU       IVDTGTR-------------------------------------FDGMDRFEARVAVRQA
SYV_MYCPA       IADTGTQ-------------------------------------FDGMDRFAARVAVREA
SYV_BUCBP       ITDVIEE-------------------YDISGEKSCIYKQNVPLRFHHLDRFIARKIIVKE
SYV_BLOFL       ILTIPEI-----------------SNNQGQPYIQSNDQYHIPKMFHNLDYKDARKKIIEE
SYV_BLOPB       ILKKLEV-------------------FNSSGQLTDQLYCKIPQIFHNLDSDNARKKIISE
SYV_BUCAI       IKSTAEV-------------------YNYKGEKSNQYSTCIPMQFQHLDILSARIEIIKE
SYV_BUCAP       IKSNFSI-------------------YDYQGSKSNFYDSSIPTEFQNLDILSARKKIIYE
SYV_FRATT       LNTNVPS------------------------------------KYQGLDRFEARKQVVAD
SYV_COXBU       LNENVPE------------------------------------PYRGLERFEARKKIIAD
SYV_XYLFA       IVSKTSI-QSGMPSGATSDTTNTPSDPEASSAANQHDTLVMPAHLAGLDRYAARKQILAD
SYV_XYLFT       IVSKTSI-QSGIASGATSDTTDTPSDSDASNASNQHDTLIMPAHLAGLDRYEARKQILAD
SYV_XANC8       INDNAPE------------------------------------RYRGLDRYDARKLVLSE
SYV_XANCP       INDNAPE------------------------------------RYRGLDRYDARKLVLSE
SYV_XANOR       IIDPRKQYPDDESPFVNAGIDWRELDQIQRKRLGQHLAYKIPAQYIGLDRYDARKLVLSE
SYV_XANC5       IIDPREQYPDDEYPVVDQGIDWRELNQVQRRRTGQHFAYSIPSAYVGLDRYEARKLVLAH
SYV_XANAC       INENAPE------------------------------------RYRGLDRYDARKLVLSE
SYV_LEGPA       INKNAPL------------------------------------KYQGMDRFVAREQIIKD
SYV_LEGPH       INKNAPL------------------------------------KYQGMDRFVAREQIIKD
SYV_LEGPL       INKNAPL------------------------------------KYQGMDRFLAREQIIKD
SYV_METCA       ILPRADI----------------------------------PAKYHGLDRYEARDLVVHD
SYV_NITOC       LNENVPE------------------------------------RYRNLDRFEARKLVVAD
SYV_ACIAD       VLAEFEY--------------------IAKAGEQISDAIAAPADYVGLERFAARKKLVAQ
SYV_PSYA2       ILPAMEV--------------------YPDLQTREPTLETTPADYAGLERFAARKLLVEQ
SYV_PSEAE       VLAQAQV-------------------FHLDGSVNPNLDPSLPQSYAGMDRFAARKAIVAE
SYV_PSEPK       VLSSAQA-------------------FNLDGSVNEQVDTQLPAQYANLDRFVARKQIVAD
SYV_PSEF5       VLPACQV-------------------FNLDGSLNDSVDGKIPAEYVGLDRFEARKQIVAA
SYV_PSESM       VLPAAQV-------------------FNLDGKLNESVDGTLPAAYAGLDRFEARKQIVAA
SYV_PSE14       VLAAAQV-------------------FNLDGTLNESVDGSLPAAYAGLDRFEARKQIVAA
SYV_PSEU2       VLPAAQV-------------------FNLDGTLNESVDGSLPAAYAGLDRFEARKQIVAA
SYV_IDILO       VMAKAGL----------------YTSTGETLEELNGFNGILPEQYAGKERFEARKQLVAE
SYV_MANSM       IREEAEI-------------------IGTDGQPLTTYEAEIPQDYRGLERFAARKKVVAD
SYV_PASMU       IRAEAEI-------------------IGSDGKILESYTALIPTKYQGMERFAARKQIVAD
SYV_HAEDU       IRQTAEV-------------------LGPDGKPLNTYQAIIPADYQGLERFTARKKVVAD
SYV_HAEI8       IRDEAEI-------------------IGTDGKPLAGYEATIPADYRGLERFAARKKIVAD
SYV_HAEIN       IRDEAEI-------------------IGTDGKPLAGYEATIPADYRGLERFAARKKIVAD
SYV_COLP3       ILATAEV-------------------YDTKGEVCNAYDTGLPSEFAGMDRFVARKAIVAK
SYV_PHOPR       IRDAAEV-------------------FDTNGEANDAYNSELPAKYHGMERFAARKAIVAE
SYV_ALIF1       IRESAEV-------------------FTTNGEVSDVYSTEIPAKYQGMERFEARKTIVAE
SYV_VIBCH       IRDAAEV-------------------FNSNGEASNAYGTEIPAKYQGMERFAARKAIVAE
SYV_VIBVU       IRDAAEV-------------------FTTNGEPSDAYGTELPAKYHGMERFAARKAIVAE
SYV_VIBVY       IRDAAEV-------------------FTTNGEPSDAYGTELPAKYHGMERFAARKAIVAE
SYV_VIBPA       IRGAAEV-------------------FNTNGEPSDAYSTELPAKYHGMERFAARKAIVAE
SYV_PHOLL       IRHKAEV-------------------FDTHGEISDSYSSDIPAEYQGIERFAARKTIVAE
SYV_YERPE       IRSEAEV-------------------FDTHGEATDAFSNAIPAQFQGLERFAARKAVVAE
SYV_YERPS       IRSEAEV-------------------FDTHGEATDAFSNAIPAQFQGLERFAARKAVVAE
SYV_PECAS       IRQSAEI-------------------FDTNGEASTACSSEIPEAFQGLERFAARKALVAA
SYV_SHIDS       IRESAQV-------------------FDTKGNESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_ECOL6       IRESAQV-------------------FDTKGNESDIYSSEIPAEFQKLERFAARKAVVAA
SYV_ECOLI       IRESAQV-------------------FDTKGNESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_ECO57       IRESAQV-------------------FDTKGNESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_SHIBS       IRESAQV-------------------FDTKGNESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_SHISS       IRESAQV-------------------FDTKGNESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_SHIFL       IRESAQV-------------------FDTKGNESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_SALPA       IRESAEV-------------------FDTKGEESNVYSSEIPAEFQKLERFAARKAIVAA
SYV_SALTI       IRESAEV-------------------FDTKGEESNVYSSEIPAEFQKLERFAARKAIVAA
SYV_SALCH       IRESAEV-------------------FDTKGEESDVYSSEIPAEFQKLERFAARKAIVAA
SYV_SALTY       IRESAEV-------------------FDTKGEESDVYSSEIPAEFQKLERFAARKAVVAA
SYV_PSEHT       ILTQGET--------------------YSFDGKELEFDAPIPERLHGLDRFAARKAIVAE
SYV_SHEON       IRSSAEV-------------------VNTDGTINTSLDGSLPERYAGLDRFKARDAIVAE
SYV_CHRVO       ILAKAQI---------------------FGFDGSAQGAIELPAAYAGLTAQEARKAMLAD
SYV_NEIG1       VLANAEV---------------------FNFKGEAQPGFSLPEKYAGLDRFAARKQMVAD
SYV_NEIMA       VLANAEV---------------------FNFKGEAQPSFALPEKYAGLDRFAARKQMVAD
SYV_NEIMB       VLANAEV---------------------FNFKGEAQLGFALPEKYAGLDRFAARKQMVAD
SYV_NITEU       INDNAPA------------------------------------EFQGLDRFDARKKVIAD
SYV_THIDA       MNELCPT------------------------------------EYQGLDRYDARQTLLDA
SYV_BORPE       INENGPK------------------------------------QFQGLERYEARQAVVAE
SYV_BORBR       INENGPK------------------------------------QFQGLERYEARQAVVAE
SYV_BORPA       INENGPK------------------------------------QFQGLERYEARQAVVAE
SYV_BURMA       INDNAPA------------------------------------AYRGLDRFDARKAIVDE
SYV_BURPS       INDNAPA------------------------------------AYRGLDRFDARKAIVDE
SYV_CUPPJ       ITADAPG------------------------------------NYAGQDRYDARKAIVAD
SYV_RALSO       IADTAPA------------------------------------TYRGIDRFEARKRIVVD
SYV_AROAE       VSDDAPE------------------------------------KYRGMDRFVAREVIVQD
SYV_DECAR       VNENAPE------------------------------------KYRGLDRFDARKAVVAD
SYV_FUSNN       IVEDYPK-------------------------------------YAGLDRFEARKKIVED
SYV_BDEBA       INENGGV-------------------------------------YAGLKVQEARKRILED
SYV_GLUOX       LWIEEIR--------------------PELRDVEGLASVAFVETLNGLSREEGRKQVVAE
SYV_RHOS4       MFLIENP-----------------------DFTEGCAPSEEALALDGLDRYEARKRVVAL
SYV_RUEPO       MRADGAP------YAAEAGKAQDYARGRAFTENEIDVINLVPDHLRGLDRFEARAKVVDE
SYV_SPHEL       ICQTQDG--------------------------------LVPAELIGLDRFEARKVIVAR
SYV_ZYMMO       VIQTAEN--------------------------------DVPEELIGLDRFEARQIIVEK
SYV_CAUVC       LNDSVPA------------------------------------EYVGMDRFVARKAIVAR
SYV_NITWN       LTLSENE---------------------DFLRGLPSGALMLAEEFDGMDRFAARKAIVAR
SYV_BRADU       LDLLDNE---------------------DYLRDLPEGAAQFAEEFNKVDRFVARKRIVER
SYV_RHOPA       ISVADNS---------------------AYLEGLPEGAREFAGEIDGTDRFVARKIIVAR
SYV_BARHE       VFLHENE-------------------AFFEGVVLSDALKMLVKDLDQKDRFIARDQIVSL
SYV_BARQU       IFLHKNE-------------------AFFDGLTLSDELKKLVENLDQADRFIARHQIVSL
SYV_AGRFC       ISIKENE-------------------DFLEGLSHPAALHGAWDRLEGQDRFTARKIIVEI
SYV_RHIME       ITIKNNE-------------------DFLEGLDHPAALHGAWDRLEGKDRFEARKLIVEM
SYV_RHILO       IKLKDNE-------------------DFLAGLDATPERQAVWDELDGLDRFVARKKIVEL
SYV_BRUME       ITLKDNV-------------------DFLEDLELTAELKALIVELDGMDRFAARKRIVEL
SYV_BRUSU       ITLKDNV-------------------DFLEDLELTAELKALIVELDGMDRFAARKRIVEL
SYV_DESPS       MNDNAGK-------------------------------------YAGLDRFECRKQIVED
SYV_DESVH       MTAEAGP-------------------------------------YAGLTKEECRKRIVAD
SYV_GEOSL       VNSAGHQ-------------------------------------YEGMERFAARKRVVED
SYV_PELCD       VNGNGGR-------------------------------------YQGLERFEARTRVLAD
SYV_DEHM1       MNENAGP-------------------------------------CSGMTAKACREYVVSE
SYV_DEHMC       MNENAGP-------------------------------------CSGMTAKACREYVVSE
SYV_SYMTH       MTEAAGK-------------------------------------YAGLDRYECRRRIVAD
SYV_LACCA       MNENAGK-------------------------------------YQGMDRFEARKAMVAD
SYV_LACAC       MNEEAGK-------------------------------------YAGMDRFECREALVKD
SYV_LACJO       MNEEAGK-------------------------------------YAGMDRFEAREALVKD
SYV_STAS1       MNDKADK-------------------------------------YQGMDRFDCREQLVKD
SYV_STAAR       MNNKAGK-------------------------------------YEGMDRFDCRKQLVED
SYV_STAAC       MNDKAGK-------------------------------------YEGMDRFDCRKQLVKD
SYV_STAAN       MNDKAGK-------------------------------------YEGMDRFDCRKQLVKD
SYV_STAAS       MNDKAGK-------------------------------------YEGMDRFDCRKQLVKD
SYV_STAAW       MNDKAGK-------------------------------------YEGMDRFDCRKQLVKD
SYV_STAAM       MNDKAGK-------------------------------------YEGMDRFDCRKQLVKD
SYV_STAEQ       MNDKADK-------------------------------------YKGMDRFDCRNQLVKD
SYV_STAES       MNDKADK-------------------------------------YKGMDRFDCRNQLVKD
SYV_STAHJ       MNDKADK-------------------------------------YAGLDRFECRKQLVED
SYV_LACPL       MNANAGK-------------------------------------YEGMDRFEARKAMVKD
SYV_LACSS       MNESAGK-------------------------------------YNGMDRFEARKAIVAD
SYV_ENTFA       MNELAGK-------------------------------------YEGMDRFAARKAIVSD
SYV_LACLA       INENGGK-------------------------------------YEGLDRFEARKQIVAD
SYV_STRMU       MNELAGE-------------------------------------FAGMDRFEARKATVKK
SYV_STRA5       MNELADE-------------------------------------FNGMDRFEARKAVVAK
SYV_STRA1       MNELADE-------------------------------------FNGMDRFEARKAVVAK
SYV_STRA3       MNELADE-------------------------------------FNGMDRFEARKAVVAK
SYV_STRT1       MNELAGE-------------------------------------FNGMDRFEARKAVVKK
SYV_STRT2       MNELAGE-------------------------------------FNGMDRFEARKAIVKK
SYV_STRP1       MNELAGD-------------------------------------FAGMDRFEARQATVAK
SYV_STRPM       MNELAGD-------------------------------------FAGMDRFEARQATVAK
SYV_STRP6       MNELAGD-------------------------------------FAGMDRFEARQATVAK
SYV_STRP3       MNELAGD-------------------------------------FAGMDRFEARQATVAK
SYV_STRP8       MNELAGD-------------------------------------FAGMDRFEARQATVAK
SYV_STRPN       MNELAFE-------------------------------------FSGMDRFEARKAVVAK
SYV_STRR6       MNELVFE-------------------------------------FSGMDRFEARKAVVAK
SYV_LISIN       MNDNAGK-------------------------------------YDGLDRFVARKAIIQD
SYV_LISMF       MNKNAGK-------------------------------------YDGLDRFVARKEIIQD
SYV_LISMO       MNENAGK-------------------------------------YDGLDRFVARKEIIQD
SYV_OCEIH       MNENAGK-------------------------------------YQGLDRFECRKQIVKD
SYV_BACC1       MNEKAGK-------------------------------------YNGMDRFECRKALVKD
SYV_BACCZ       MNEKAGK-------------------------------------YNGMDRFECRKALVKD
SYV_BACCR       MNEKAGK-------------------------------------YNGMDRFECRKELVKD
SYV_BACAN       MNEKAGK-------------------------------------YNGMDRFECRKALVKD
SYV_BACHK       MNEKAGK-------------------------------------YNGMDRFECRKALVKD
SYV_BACSK       MNEKAGK-------------------------------------YEGMDRFECRKQIVKD
SYV_BACHD       MNEKAGQ-------------------------------------YEGMDRFECRKQIVKD
SYV_GEOSE       MNENAMQ-------------------------------------YQGLDRFECRKQIVRD
SYV_GEOKA       MNENAMQ-------------------------------------YQGLDRFECRKQIVRD
SYV_BACLD       MNDNALQ-------------------------------------YKGMDRFECRKQIVKD
SYV_BACSU       MNENALQ-------------------------------------YQGMDRFECRKKLVKD
SYV_THEMA       INENGGK-------------------------------------YKGLDRYEAREKIVKD
SYV_CARHZ       MNENAGK-------------------------------------YRGLDRYEARKKIVED
SYV_CALS4       INENGGK-------------------------------------YEGLDRYEAREKIVKD
SYV_CLOPE       INHLGGK-------------------------------------YKGLDRYEARKQMVAD
SYV_CLOAB       IKEGFGK-------------------------------------YSGMDRYEARKAIVSD
SYV_CLOTE       INELGGK-------------------------------------YSGMDRYEARKAIVED
                                                                     *      

SYV_MYCGA       LISEDK---------------Y----------VK-FEEITSNVGYSDRSNVIVQPLLSKQ
SYV_MYCGE       LEKNKL---------------L----------VK-SIPLTSNVGFSERSGTVVEPMLSKQ
SYV_MYCPN       LQTQKL---------------L----------VK-TMPLTSNVGFSERSDTVVEPLLSKQ
SYV_MYCPE       LEKNNL---------------L----------EK-VEKTISNVGFSERTNAVVEPMMSEQ
SYV_MYCS5       LEENNY---------------L----------IK-AEDSISNVSYSDRSNSVIETLMLPQ
SYV_MYCH2       LEKEGF---------------L----------AK-IETVISNVGFSQRSDEIVEILKKPQ
SYV_MYCH7       LEKEGF---------------L----------AK-IETVISNVGFSQRSDEIVEILKKPQ
SYV_MYCHJ       LEKEGF---------------L----------AK-IETVISNVGFSQRSDEIVEILKKPQ
SYV_MYCMO       LKKENL---------------I----------DK-IENIKSNIIMSERSNTVAEVLVMPQ
SYV_MYCPU       LQKENL---------------I----------SR-VENYSSNIGYSDRTKVPIEILVKKQ
SYV_PARUW       MKEKGL---------------L----------EK-VEPHLNRVGISYRSKAIIEPYLSKQ
SYV_CHLPN       LEEQGL---------------F----------VR-KEPYKLRVGVSYRSGAVIEPYLSKQ
SYV_CHLMU       LEALGL---------------F----------VR-KEAYSSRVGVSYRSGAIIEPYLSKQ
SYV_CHLTR       LEALGL---------------F----------VK-KEAYSSRVGVSYRSGAIIEPYLSKQ
SYV_CHLAB       LETLGL---------------F----------VK-KEPYKLRVGVSYRSGAVIEPYLSKQ
SYV_CHLCV       LEAMGL---------------F----------VK-KEPYKLRVGVSYRSGAVIEPYLSKQ
SYV_ONYPE       LKQKGF---------------F----------TK-TENHLHKVGYSSISDAIIEPRLSLQ
SYV_UREPA       LQKNNH---------------L----------LK-VESYRTSVGFSERTNEIVEPYLSHQ
SYV_PORGI       LIDAGL---------------M----------ER-VENYVNKVGYSERTDVPIEPKLSMQ
SYV_BACFN       LEAAGL---------------L----------EK-TEAYTNKVGYSERTNVVIEPKLSMQ
SYV_BACFR       LEAAGL---------------L----------EK-TEAYTNKVGYSERTNVVIEPKLSMQ
SYV_BACTN       LDAAGL---------------L----------EK-TEAYTNKVGYSERTNVVIEPKLSMQ
SYV_WIGBR       LNRKEY---------------I----------TK-FEYKKVVLPFGDRSGDILEPMLTNQ
SYV_DEIRA       LEESGD---------------L----------LE-QKDHDTAIGLSERTKVPVEPIISEQ
SYV_THET8       FREAGH---------------L----------VK-EEDYTIALATCSRCGTPIEYAIFPQ
SYV_THETH       FREAGH---------------L----------VK-EEDYTIALATCSRCGTPIEYAIFPQ
SYV_THET2       FREAGH---------------L----------VK-EEDYTIALATCSRCGTPIEYAIFPQ
SYV_HELPJ       LKENAL---------------L----------EK-IEEHVHQVGHCYRCHNVVEPYVSKQ
SYV_HELPY       LKENAL---------------L----------EK-IEEHTHQVGHCYRCHNVVEPYVSKQ
SYV_CAMJE       LESLGF---------------I----------EK-IEEYNNQIGYCYRCNNIVEPYISKQ
SYV_CAMJR       LESLGF---------------I----------EK-IEEYNNQIGYCYRCNNIVEPYISKQ
SYV_HELHP       LQENGF---------------V----------EK-IEDYTNQVGKCYRCGNIVEPYISKQ
SYV_WOLSU       LQEKGY---------------I----------EK-IEEHENQVGKCYRCGNVVEPYISKQ
SYV_BORBU       LMEKGF---------------L----------QD-VKKHKQQVGHCYRSGEVIEPYLSTQ
SYV_BORBP       LMEKGF---------------L----------KG-VKKHRQQVGHCYRSGEVIEPYLSTQ
SYV_MESFL       LTKEKT---------------F----------IK-AEPMIHQVGFSERSNAIVEPYLSDQ
SYV_MYCMS       AIKEDL---------------F----------VK-EEDIINQVGFSERSNAIVEPYLSDQ
SYV_PELUB       LKEKEF---------------F----------VK-EENIKNKVPYGDRSNSIIEPFLTEQ
SYV_TREDE       LEELGL---------------F----------KN-EEKIKHAVGCCYRCHTSIEPYVSKQ
SYV_TREPA       LQAHGL---------------L----------SR-EERIVHSVGVCYRCEAVIEPYLSLQ
SYV_GLOVI       AAAEGW---------------L----------VG-IEDHVHNVPYSERGGVPIEPYLSDQ
SYV_PROMP       LDTLGL---------------L----------TK-IENYKNTVPFSDRGKVPIEPLLSTQ
SYV_PROMA       LEQKGL---------------L----------TK-VEPYRHSVPFSDRGKVPIEPLLSTQ
SYV_PROMT       LKEIGL---------------L----------TK-IEAYKHSVPFSDRGKVPVEPLLSTQ
SYV_PROMM       LQEEGL---------------L----------VK-VEPHRHSVPYSDRGKVPVEPLLSTQ
SYV_SYNPX       LDELGL---------------L----------VK-VEDYRHSVPYSDRGKVPVEPLLSTQ
SYV_THEEB       LEAEGF---------------L----------VR-VEDYKHTVPYSDRGKVPIEPLLSTQ
SYV_SYNP6       LEEAGF---------------L----------VK-VEDYRHSIPISDRGKVPVEPLLSTQ
SYV_NOSS1       LETDGF---------------L----------VK-IEDYKHTVPYSDRGKVPVEPLLSTQ
SYV_SYNY3       LEAQGF---------------L----------VK-IEPYRHSVPYGDRGKVPVEPLLSTQ
SYV_LEPIC       LEAKGL---------------I----------EK-IEDHIHAVGHNSRGGAVIEPYLSTQ
SYV_LEPIN       LEAKGL---------------I----------EK-IEDHIHAVGHNSRGGAVIEPYLSTQ
SYV_STRAW       LRAEGR---------------I----------VAEKRPYVHSVGHCSRCKTTIEPRLSMQ
SYV_STRCO       LRAEGR---------------I----------VAEKRPYVHSVGHCSRCKTTIEPRLSMQ
SYV_CORJK       LEEQGR---------------I----------VARKFPYVHSVGHSERSKEAVEPRLSEQ
SYV_CORDI       LAEQGR---------------I----------VKEVRPYVHSVGHSERSGEPIEPRLSLQ
SYV_COREF       LAEQGR---------------I----------VKEVRPYVHSVGHSERSGEAIEPRLSLQ
SYV_CORGL       LAAQGR---------------I----------VKEIRPYVHSVGHSERSGEAIEPRLSLQ
SYV_NOCFA       LAREGR---------------V----------VAEKRPYIHSVGHSERTGEPIEPRLSMQ
SYV_MYCLE       LAVQGR---------------I----------VEEKRPYRHSVGHSERSGEVIEPRLSLQ
SYV_MYCBO       LAAQGR---------------V----------VEEKRPYLHSVGHSERSGEPIEPRLSLQ
SYV_MYCTU       LAAQGR---------------V----------VEEKRPYLHSVGHSERSGEPIEPRLSLQ
SYV_MYCPA       LAAQGR---------------I----------VEEKRPYLHSVGHSERSGEPIEPRLSLQ
SYV_BUCBP       LIALKL---------------L----------IK-IQKHNLAIPYGERSGSVIEPLLTDQ
SYV_BLOFL       CKRLKI---------------L----------ED-IKTHQLTVPINNRTGTIIEPMLTDQ
SYV_BLOPB       CNALKL---------------L----------HN-IEPHDLTIPYSDRTGTIIEPMLTDQ
SYV_BUCAI       ITKLGF---------------L----------EK-IEECNVTVPYSERSGVIIEPMLTNQ
SYV_BUCAP       IEKLGL---------------L----------EK-IEECNFFTPYSERSGVIIQPMLTNQ
SYV_FRATT       MEALGL---------------L----------DK-IEPHALKVPTGDRTGEILEPYLTKQ
SYV_COXBU       LQRENL---------------L----------EK-TEPYRVPVPRGERSGVIIEPLLTDQ
SYV_XYLFA       LDAQGL---------------L----------VA-AIPHTLQVPRGDRTGQVIEPYLTAQ
SYV_XYLFT       LDAQGL---------------L----------VA-ATPHTLQVPRGDRTGQVIEPYLTAQ
SYV_XANC8       LEDLGL---------------L----------VE-TKPHKLQVPRGDRTGQVIEPYLTDQ
SYV_XANCP       LEDLGL---------------L----------VE-TKPHKLQVPRGDRTGQVIEPYLTDQ
SYV_XANOR       LEDLSI---------------L----------VE-TKPHKLQVPRGDRTGQVIEPYLTDQ
SYV_XANC5       LEDEGR---------------L----------VE-TKPHKLQVPRGDRTGQVIEPYLTDQ
SYV_XANAC       LEDLGV---------------L----------VE-TKPHKLQVPRGDRTGQVIEPYLTDQ
SYV_LEGPA       LEKEGL---------------L----------AK-TEPHKLKVPRGEKSNVIIEPLLTDQ
SYV_LEGPH       LEKEGL---------------L----------AK-TEPHKLKVPRGEKSNVIIEPLLTDQ
SYV_LEGPL       LEQEGL---------------L----------AK-TEPHKLKVPRGEKSNVIIEPLLTDQ
SYV_METCA       LNELGL---------------I----------EK-IEEHRLMVPRGDRTGVVVEPFLTDQ
SYV_NITOC       LEAAGL---------------L----------EK-IEDHKLMVPRGDRSRTVIEPYLTDQ
SYV_ACIAD       AEAEGW---------------L----------DQ-IQPYDLKAPRGDRSGVIVEPLLTDQ
SYV_PSYA2       AGEQGW---------------L----------EK-IEDYALKAPRAERGGAIVEPWLTDQ
SYV_PSEAE       FEAMGL---------------L----------EK-VDDHALKVPKGDRSGTVIEPWLTDQ
SYV_PSEPK       LDAQGL---------------L----------VS-IDDHALKVPKGDRSGTVIEPWLTDQ
SYV_PSEF5       FDAAGL---------------L----------VS-VDDHALKVPKGDRSGTVIEPWLTDQ
SYV_PSESM       FDAAGL---------------L----------VS-IDDHALKVPKGDRSGTIIEPWLTDQ
SYV_PSE14       FDAAGL---------------L----------VS-VDDHALKVPKGDRSGTIIEPWLTDQ
SYV_PSEU2       FDAAGL---------------L----------VS-VDDHALKVPKGDRSGTIIEPWLTDQ
SYV_IDILO       FDELGL---------------L----------EK-IEKHTNKIPYGDRGGVPIEPHLTDQ
SYV_MANSM       FDSLGL---------------L----------EK-IQPHDLKVPYGDRGGVPIEPMLTDQ
SYV_PASMU       FEELGL---------------L----------DE-IKPHDLKVPYGDRGGVPIEPMLTDQ
SYV_HAEDU       FEALAL---------------L----------DE-IKPHDLKVPYGDRGGVPIEPMLTDQ
SYV_HAEI8       FEALGL---------------L----------DE-IKPHDLKVPYGDRGGVPIEPMLTDQ
SYV_HAEIN       FEALGL---------------L----------DE-IKPHDLKVPYGDRGGVPIEPMLTDQ
SYV_COLP3       FDELGL---------------L----------VE-VKDHDLVAPYGDRSGVIIEPLLTDQ
SYV_PHOPR       FDELGL---------------L----------EE-VKDHDLTVPYGDRGGVAIEPMLTDQ
SYV_ALIF1       FEELGL---------------L----------EE-IKDHDLTVPYGDRGGVVIEPMLTDQ
SYV_VIBCH       FEELGL---------------L----------QE-IKDHDLTVPYGDRGGVVIEPMLTDQ
SYV_VIBVU       FDELGL---------------L----------EE-VKDHDLQVPYGDRGGVVIEPMLTDQ
SYV_VIBVY       FDELGL---------------L----------EE-VKDHDLQVPYGDRGGVVIEPMLTDQ
SYV_VIBPA       FDELGL---------------L----------EE-VKDHDLQVPYGDRGGVVIEPMLTDQ
SYV_PHOLL       FERLGL---------------L----------VE-IKAHDLTVPYGDRGGVVIEPMLTDQ
SYV_YERPE       FEKLGL---------------L----------EE-VKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_YERPS       FEKLGL---------------L----------EE-VKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_PECAS       FDELGL---------------L----------EE-IKAHDLTVPYGDRGGVVIEPMLTDQ
SYV_SHIDS       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_ECOL6       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_ECOLI       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_ECO57       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SHIBS       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SHISS       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SHIFL       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SALPA       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SALTI       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SALCH       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_SALTY       VDALGL---------------L----------EE-IKPHDLTVPYGDRGGVVIEPMLTDQ
SYV_PSEHT       FEELGL---------------L----------EK-IEDHGLTVPYGDRSGVVIEPLLTDQ
SYV_SHEON       FETLGL---------------L----------EK-IAPHGLKVPYGDRSGVVIEPMLTDQ
SYV_CHRVO       LQAQGL---------------L----------LE-TKPHKLMVPRGDRTGTVIEPLLTDQ
SYV_NEIG1       LQEQGF---------------L----------VE-IKPHTLMTPKGDRTGSVIEPMLTSQ
SYV_NEIMA       LQEQGF---------------L----------VE-IKAHTLMTPKGDRTGSVIEPMLTSQ
SYV_NEIMB       LQEQGF---------------L----------VE-IKPHTLMTPKGDRTGSVIEPMLTSQ
SYV_NITEU       LQAQGL---------------L----------VE-TRPHKLMVPRGDRTNTVIEPMLTDQ
SYV_THIDA       LQAKGL---------------L----------VS-AKPHKLMIPRGDRTHAVLEPMLTDQ
SYV_BORPE       LQAQQY---------------L----------VK-VEPHKMMQPKGDRTGVVLEPMLTDQ
SYV_BORBR       LQAQQY---------------L----------VK-VEPHKMMQPKGDRTGVVLEPMLTDQ
SYV_BORPA       LQAQQY---------------L----------VK-VEPHKMMQPKGDRTGVVLEPMLTDQ
SYV_BURMA       LDAQGL---------------L----------ES-VKPHKLMVPRGDRTGVVIEPMLTDQ
SYV_BURPS       LDAQGL---------------L----------ES-VKPHKLMVPRGDRTGVVIEPMLTDQ
SYV_CUPPJ       LEAQGL---------------L----------VE-TKKHKLMTPRSERTGSAIEPMLTDQ
SYV_RALSO       LETLGL---------------L----------AE-VKKHTLMVPRGDRTGVIIEPMLTDQ
SYV_AROAE       LEAQGL---------------L----------AG-IKPHKLMVPRGDRTSAVIEPMLTDQ
SYV_DECAR       LEALGI---------------L----------EK-TDKHKLKVPRGDRTNVVIEPMLTDQ
SYV_FUSNN       LKAQDL---------------F----------IK-TEHLHHAVGQCYRCQTVIEPRVSPQ
SYV_BDEBA       LKAQDL---------------L----------EK-EEPHVHSVGHCSRSGAVVEPYLSEQ
SYV_GLUOX       LERLEW---------------L----------EK-IEPHKLQVPHAERGGAIVEPRLTLQ
SYV_RHOS4       AEEQGW---------------L----------DG-IDQDRHMVPHGDRSKVAIEPMLTDQ
SYV_RUEPO       ITSEGLAVMTVASDPRLGTTALKPGAEGADAIVPLVEAKPIMQPFGDRSKVVIEPMLTDQ
SYV_SPHEL       LKDEGF---------------LVPWTDKEGAEHD-AEPRTIQTPYGDRSGQVIEPWLTDQ
SYV_ZYMMO       IDALGL---------------L----------DK-IEDRVIQAPYGDRSGVPIEPWLTDQ
SYV_CAUVC       AEEEGW---------------L----------KE-IEKTKHMVPHGDRSGVVIEPFLTDQ
SYV_NITWN       LEEFGF---------------L----------DK-IEPHTHMVPHGDRSNAVVEPYLTDQ
SYV_BRADU       LESFGF---------------V----------ER-IEPHTHMVPHGDRSNSVIEPYLTDQ
SYV_RHOPA       LDDFGF---------------L----------EK-IEPNVHMVPHGDRSGVVIEPFLTDQ
SYV_BARHE       MEEKGY---------------L----------VT-VDDHPHTVPYGDRSGVPIEPFLTDQ
SYV_BARQU       MEEGGY---------------L----------AA-VDDHPHTVPHGDRSGVPIEPFLTDQ
SYV_AGRFC       FEEAGL---------------L----------DK-IEPHKHVVPHGDRGGVPIEPRLTDQ
SYV_RHIME       LEEAGL---------------V----------DH-IEPHKHMVPHGDRGGVPIEPRLTEQ
SYV_RHILO       MEEGGF---------------L----------EK-VEPHRHAVPHGDRGGVPIEPFLTEQ
SYV_BRUME       MDERGY---------------L----------EK-IDDHTHAVPHGDRGGVPIEPYLTDQ
SYV_BRUSU       MDERGY---------------L----------EK-IDDHTHAVPHGDRGGVPIEPYLTDQ
SYV_DESPS       LREQGY---------------L----------VE-IEDYDHAVGHCYRCKTVIEPTTSLQ
SYV_DESVH       LEASGQ---------------L----------VR-VEELNHSVGHCYRCKTVVEPHMSEQ
SYV_GEOSL       LEALGL---------------L----------EK-IDDHAHAVGGCYRCKTVVEPYLSLQ
SYV_PELCD       LDAAGL---------------L----------EQ-TEEHLNAVGECYRCKTVIEPYMSLQ
SYV_DEHM1       LKSLGL---------------L----------LK-IEDYTHSVGHCQRCSAVIEPMVSKQ
SYV_DEHMC       MKSLGL---------------L----------LR-IEDYIHSVGHCQRCSAVIEPMVSKQ
SYV_SYMTH       AEAEGW---------------L----------VK-VEEHQHAVGCCARCGTVIEPLISRQ
SYV_LACCA       LDKAGL---------------L----------LK-VEPIVHSVGHSERTGVQVEARLSTQ
SYV_LACAC       LKEEGY---------------L----------IK-VEPIVHSVGHSERSGVQVEPRLSKQ
SYV_LACJO       LKEEGF---------------L----------IK-VEPIVHSVGHSERSGVQVEPRLSKQ
SYV_STAS1       LEAENL---------------V----------IK-IEEHEHSVGHSERSGAVVEPYLSTQ
SYV_STAAR       LKEQDL---------------V----------IK-IEDHVHSVGHSERSGAVVEPYLSTQ
SYV_STAAC       LKEQDL---------------V----------IK-IEDHVHSVGHSERSGAVVEPYLSTQ
SYV_STAAN       LKEQDL---------------V----------IK-IEDHVHSVGHSERSGAVVEPYLSTQ
SYV_STAAS       LKEQDL---------------V----------IK-IEDHVHSVGHSERSGAVVEPYLSTQ
SYV_STAAW       LKEQDL---------------V----------IK-IEDHVHSVGHSERSGAVVEPYLSTQ
SYV_STAAM       LKEQDL---------------V----------IK-IEDHFHSVGHSERSGAVVEPYLSTQ
SYV_STAEQ       LKEQDL---------------V----------IK-IEEHTHSVGHSERSGAIVEPYLSTQ
SYV_STAES       LKEQDL---------------V----------IK-IEEHTHSVGHSERSGAIVEPYLSTQ
SYV_STAHJ       LKAQDL---------------V----------IK-IEEHVHSVGHSERSGAVVEPYLSTQ
SYV_LACPL       LEDQDL---------------M----------IK-IDPIVHSVGHSERTDVQVEARLSTQ
SYV_LACSS       LKEQGF---------------L----------IK-VDPMTHSVGHSERTGVQVEARLSTQ
SYV_ENTFA       LKELGR---------------L----------IK-IETMNHSVGHSERTGVVVEPRLSTQ
SYV_LACLA       LKELGQ---------------L----------VD-IKPVRHEVGHSERTGVVVEPRLSTQ
SYV_STRMU       LEEIGA---------------L----------VE-IEKMTHSVGHSERTGVPIEPRLSTQ
SYV_STRA5       LESLGN---------------L----------VK-IKKTTHSVGHSERTGVVVEPRLSTQ
SYV_STRA1       LESLGN---------------L----------VK-IEKMTHSVGHSERTGVVVEPRLSTQ
SYV_STRA3       LESLGN---------------L----------VK-IEKMTHSVGHSERTGVVVEPRLSTQ
SYV_STRT1       LEEIGA---------------L----------VE-IEKMTHSVGHSERTGVPVEPRLSTQ
SYV_STRT2       LEEIGA---------------L----------VE-IEKMTHSVGHSERTGVPVEPRLSTQ
SYV_STRP1       LEELGA---------------L----------VN-IEKRVHSVGHSERSGAVVEPRLSTQ
SYV_STRPM       LEELGA---------------L----------VN-IEKRVHSVGHSERSGAVVEPRLSTQ
SYV_STRP6       LEELGA---------------L----------VN-IEKRVHSVGHSERSGAVVEPRLSTQ
SYV_STRP3       LEELGA---------------L----------VN-IEKRVHSVGHSERSGAVVEPRLSTQ
SYV_STRP8       LEELGA---------------L----------VN-IEKRVHSVGHSERSGAVVEPRLSTQ
SYV_STRPN       LEEIGA---------------L----------VK-IEKRVHSVGHSERTGVVVEPRLSTQ
SYV_STRR6       LEEIGA---------------L----------VK-IEKRVHSVGHSERTGVVVEPRLSTQ
SYV_LISIN       FKDLGL---------------F----------IK-QEPHLHSVGHSERTGAVVEPYLSLQ
SYV_LISMF       FKDLGL---------------F----------IK-QEPHLHSVGHSERTGAVVEPYLSLQ
SYV_LISMO       FKDLGL---------------F----------IK-QEPHLHSVGHSERTGAVVEPYLSLQ
SYV_OCEIH       LKEQGV---------------M----------FN-IEERTHQVGHSERSGAVVEPYLSTQ
SYV_BACC1       LQEAGV---------------L----------VE-IEPHMHSVGHSERSGAVVEPYLSTQ
SYV_BACCZ       LQEAGV---------------L----------VE-IEPHMHSVGHSERSGAVVEPYLSTQ
SYV_BACCR       LQEAGV---------------L----------VE-IEPHMHSVGHSERSGAVVEPYLSTQ
SYV_BACAN       LQEAGV---------------L----------VE-IEPHMHSVGHSERSGAVVEPYLSTQ
SYV_BACHK       LQEAGV---------------L----------VE-IEPHMHSVGHSERSGAVVEPYLSTQ
SYV_BACSK       LQAQQV---------------L----------FK-IEDHLHSVGHSERSGAVVEPYLSTQ
SYV_BACHD       LQEQGV---------------L----------FK-IEEHVHSVGHSERSGAVVEPYLSTQ
SYV_GEOSE       LQEQGV---------------L----------FK-IEEHVHSVGHSERSGAVIEPYLSTQ
SYV_GEOKA       LQEQGV---------------L----------FK-IEEHVHSVGHSERSGAVVEPYLSTQ
SYV_BACLD       LQEEGV---------------L----------FK-IEEHTHSVGHSERSGAVVEPYLSTQ
SYV_BACSU       LQEAGV---------------L----------FK-IEDHMHSVGHSERSGAVVEPYLSTQ
SYV_THEMA       LEEQGF---------------L----------VK-IEDYTHSVGHCYRCDTVIEPKLSDQ
SYV_CARHZ       LKDLGL---------------L----------VK-EEEITHSVGHCYRCDTVIEPRLSKQ
SYV_CALS4       LEEQGL---------------L----------LK-VEEHVHNVGHCYRCDTVVEPLLSEQ
SYV_CLOPE       LEELGL---------------L----------VK-IKPHTHNVGTHDRCGTVVEPIISKQ
SYV_CLOAB       LKEEGY---------------L----------VK-IKEHVHNVGTHDRCGNIIEPMVSKQ
SYV_CLOTE       LKKEGF---------------L----------VK-VKEHIHNVSCHDRCNTIIEPMISKQ
                                                                     :     *

SYV_MYCGA       WFLIT------------TK--------FVDEIKKLVN-NEDQ-----IKIYPKRFLDTIN
SYV_MYCGE       WFVDL------------PK------------LKDHLY--LKK----YPDFIPKRFNKQVS
SYV_MYCPN       WFVDL------------PK------------LKKALA--IKK----YPELIPKRFNKQVT
SYV_MYCPE       WFVKV------------SE--------YSKKVIELQK-SSKK-----IQFFPIKFEKNLI
SYV_MYCS5       WFIKM------------DH--------FRDLILKNLS-SKEK-----IKFLPNRYKNNLK
SYV_MYCH2       WFVKM------------DE--------LAKSLISHLN-SKDK-----IKFYPKNFEKNLR
SYV_MYCH7       WFVKM------------DE--------LAKSLISHLN-SKDK-----IKFYPKNFEKNLR
SYV_MYCHJ       WFVKM------------DE--------LAKSLISHLN-SKDK-----IKFYPKNFEKNLR
SYV_MYCMO       WFIKM------------EP--------FSKMILKKIQ--NENEDDKKVLFFPKKFENILK
SYV_MYCPU       WFVKM------------DL--------FSKMVLDSLE-SKNK-----VNFYPSRFKKNLE
SYV_PARUW       WFVKM------------DG--------FSKKLREVVQ--NGQ-----VKLIPSHWESTYF
SYV_CHLPN       WFVSV------------SE--------FRGALREFVE--SQD-----IKIFPKDFVKNYL
SYV_CHLMU       WFVSV------------DS--------FRESLREFVN--SKE-----INLFPPEFIRNYL
SYV_CHLTR       WFVSV------------DS--------FRDSLRGFVN--SEE-----IRIFPPEFVRNYL
SYV_CHLAB       WFVSV------------DS--------FRDSLREFVA--SDA-----IKIFPPEFTKNYL
SYV_CHLCV       WFVSV------------ES--------FRDSLREFVA--NDS-----IKIFPPEFTRNYL
SYV_ONYPE       WVLKT------------KA--------IAQIALKTNK----------INFFPLRFENIFN
SYV_UREPA       WFIKM------------DS--------LIKDTIKMQDDCNNK-----VDFYPNRFNKTLL
SYV_PORGI       WFLQM------------ES--------LAKPALDAVM--NDE-----IKLHPAKFKNTYR
SYV_BACFN       WFLKM------------EH--------LAQIALEPVM--KDD-----IKFYPAKYKNTYR
SYV_BACFR       WFLKM------------EH--------LAQIALEPVM--KDD-----IKFYPAKYKNTYR
SYV_BACTN       WFLKM------------QH--------FADMALPPVM--NDE-----LKFYPAKYKNTYR
SYV_WIGBR       WYIKT------------KK--------LSEVAIEAVK--EKK-----IKFISKQYENMYF
SYV_DEIRA       WFVKM------------KP--------FADQVLEGLD--KGE-----IKLVPERYTKVNR
SYV_THET8       WWLRM------------RP--------LAEEVLKGLR--RGD-----IAFVPERWKKVNM
SYV_THETH       WWLRM------------RP--------LAEEVLKGLR--RGD-----IAFVPERWKKVNM
SYV_THET2       WWLRM------------KP--------LAEEVLKGLR--RGD-----IAFVPERWKKVNI
SYV_HELPJ       WFVK-------------PE--------IAQSSIEKIQ--QGL-----ARFYPSNWINNYN
SYV_HELPY       WFVK-------------PE--------IAQSSIEKIQ--QGL-----ARFYPSNWINNYN
SYV_CAMJE       WFVK-------------KE--------IAQESIEKVA--LGE-----SKFYPNHWINSFN
SYV_CAMJR       WFVK-------------KE--------IAQESIEKVA--LGE-----SKFYPNHWINSFN
SYV_HELHP       WFVK-------------KE--------TAHNAIQRVN--NGE-----LHFYPAQWLNNYN
SYV_WOLSU       WFVK-------------KE--------VAQKAIERIN--SGE-----AAFYPAQWKNNYN
SYV_BORBU       WFVRM------------KP--------LADKALKALE--NGE-----LKFYPKKWENTYK
SYV_BORBP       WFVSM------------KP--------LAEKALKALE--SGE-----LRFYPKKWENTYK
SYV_MESFL       WFVKM------------DS--------FADMILKLQE-SNDK-----IKFFPERFDQVLK
SYV_MYCMS       WFVKM------------DK--------FKNMVIDLQN-SDNK-----INFYPNRFSDVLN
SYV_PELUB       WFVDA------------KK--------LSIKAKDIVN--SKK-----TNFFPANWSKTYF
SYV_TREDE       WFVKM------------QP--------LAQKALDAWK--KGD-----VVFYPQKWENTYA
SYV_TREPA       WFVKM------------KP--------LASQALAAWK--RAD-----VQFHPKKWENTYV
SYV_GLOVI       WFLDV------------SG--------MATRVLEAFD-SQNQ-----PAFVPERWGKVYR
SYV_PROMP       WFLKM------------DN--------ISSSCLKELD--SKK-----PTFIPQRWEKVYK
SYV_PROMA       WFVRM------------EP--------MAERCRSHLG--KDE-----PRFYPDRWAKVYR
SYV_PROMT       WFVKM------------DP--------LSSSCSEFFE--KGQ-----PKFIPNRWSKVYR
SYV_PROMM       WFVRM------------EP--------LAARCHECLD--HGA-----PRFVPNRWQKVYR
SYV_SYNPX       WFVRT------------EP--------LAARCREALE--KQD-----PRFIPERWEKVYR
SYV_THEEB       WFVKI------------RP--------LADAALKALD-RQHS-----PRFIPDRWAKVYR
SYV_SYNP6       WFVKI------------EP--------LAQRALEALN--GEE----GPRFVPERWTKVYR
SYV_NOSS1       WFVKI------------RP--------LADKSLAFLD-EKNS-----PEFVPQRWTKVYR
SYV_SYNY3       WFVKI------------ES--------LAQNALACLD-EDNS-----PNFVPERWGKVYR
SYV_LEPIC       WFVKI------------KP--------LADLAVQAVQ--SGQ-----VEFIPKMWEKTFF
SYV_LEPIN       WFVKI------------KP--------LADLAVQAVQ--SGQ-----VEFIPKMWEKTFF
SYV_STRAW       WWVKV------------GP--------LAKAAGDAVR--EGK-----VKIHPQEMEKRYF
SYV_STRCO       WWVKV------------GP--------LAKAAGDAVR--DGK-----VKIHPQEMEKRYF
SYV_CORJK       WFVKV------------EE--------LAKMSGDAIR--SGD-----SVIHPSSQEPRWF
SYV_CORDI       WWVKV------------EK--------LATMAGDAIR--EGD-----TVIHPKSSEPRYF
SYV_COREF       WWVKV------------EE--------LAKMSGDAVR--AGD-----TTIHPKSLEPRYF
SYV_CORGL       WFVKV------------EE--------LAKMSGDAVR--EGD-----TTIHPKSLEPRYF
SYV_NOCFA       WWVKV------------EA--------LAKAAGDAVR--NGQ-----VVIHPASQEPRWF
SYV_MYCLE       WWVRV------------ES--------LAKAAGDAVR--NGD-----TVIHPASMESRWF
SYV_MYCBO       WWVRV------------ES--------LAKAAGDAVR--NGD-----TVIHPASMEPRWF
SYV_MYCTU       WWVRV------------ES--------LAKAAGDAVR--NGD-----TVIHPASMEPRWF
SYV_MYCPA       WWVRV------------ES--------LAKAAGDAVR--NGD-----TVIHPTSMEPRWF
SYV_BUCBP       WYLRV------------EP--------LAKIAVEAVK--SGK-----IIFIPKKYEKIYY
SYV_BLOFL       WFIKT------------KF--------LAKQAINAVT--NEK-----IKFIPKNYTNIYL
SYV_BLOPB       WYIRV------------KH--------LTQHAIDAVN--LNI-----INFVPKQYKNMYF
SYV_BUCAI       WYLKT------------ST--------LAKVALNAVK--DKK-----IKFIPQQYESMYS
SYV_BUCAP       WYLKT------------SH--------LSQSAIDVVR--EKK-----IKFIPNQYKSMYL
SYV_FRATT       WFVKA------------DV--------LAKPAIEAVE--KGD-----VRFVPDNWKNTYF
SYV_COXBU       WFIKM------------EA--------LAKPAMEAVE--SGE-----LKFIPKNWEKTYL
SYV_XYLFA       WFVKM------------ET--------LAARGLALVE--RGA-----VTFVPPNWINTYR
SYV_XYLFT       WFVRM------------ET--------LAARGLELVE--RGA-----VRFVPPNWINTYR
SYV_XANC8       WFVKM------------DA--------LAKRGLELVE--SGQ-----VKFVPPNWINTYR
SYV_XANCP       WFVKM------------DA--------LAKRGLELVE--SGQ-----VKFVPPNWINTYR
SYV_XANOR       WFVKM------------DA--------LAKRGLELVE--SGQ-----IQFVPPNWINTYR
SYV_XANC5       WFVKM------------DA--------LAKRGLELVE--SGQ-----IKFVPPNWINTYR
SYV_XANAC       WFVKM------------DA--------LAKRGLELVE--SGQ-----IKFVPPNWINTYR
SYV_LEGPA       WYVKT------------KP--------LAEPAIAAVK--KGD-----IRFIPETWDKTYF
SYV_LEGPH       WYVKT------------KP--------LAEPAIAAVK--KGD-----IRFIPETWDKTYF
SYV_LEGPL       WYVKT------------KP--------LAEPAIAAVK--KGD-----IRFIPETWDKTYF
SYV_METCA       WFVKA------------GP--------LAGPAIKAVE--EGR-----IRFVPENWSNTYY
SYV_NITOC       WFVKT------------AP--------LAEPAIQAVE--NGQ-----IRFIPENWNKIYF
SYV_ACIAD       WYVKI------------AP--------LAQPAIEAVQ--DGR-----IKFVPEQYTNMYM
SYV_PSYA2       WYVAV------------KE--------LAQPAIAAVE--DGQ-----IEFVPAQYKNMYM
SYV_PSEAE       WYVST------------KP--------LAEDAIAAVE--DGR-----IQFVPKQYENMYF
SYV_PSEPK       WYVST------------KP--------LAEPAIAAVE--DGR-----IQFVPKQYENMYF
SYV_PSEF5       WYVST------------KP--------LAEPAIAAVE--DGR-----IAFVPKQYENMYF
SYV_PSESM       WYVST------------KP--------LAEPAIAAVE--DGR-----IAFVPKQYENMYF
SYV_PSE14       WYVST------------KP--------LAEPAIAAVE--DGR-----IAFVPKQYENMYF
SYV_PSEU2       WYVST------------KP--------LAEPAIAAVE--DGR-----IAFVPKQYENMYF
SYV_IDILO       WYVRV------------EP--------MAKQATAAVE--DGR-----IEFVPKQYENMYF
SYV_MANSM       WYVSV------------KP--------LAETAIKAVE--EGE-----IQFVPKQYENLYY
SYV_PASMU       WYVSV------------KP--------LAEVAVKAVE--DGE-----IQFVPKQYENLYF
SYV_HAEDU       WYVSV------------KP--------LAEVATKAVE--NGE-----IQFVPKQYENLYF
SYV_HAEI8       WYVSV------------KP--------LADVAIKAVE--DGE-----IQFVPKQYENLYF
SYV_HAEIN       WYVSV------------KP--------LADVAIKAVE--DGE-----IQFVPKQYENLYF
SYV_COLP3       WYVRV------------EK--------LAGPAVDAVK--DGQ-----IEFVPKQYENMYF
SYV_PHOPR       WYVRT------------AP--------LAAPAVKAVE--DGQ-----IQFVPKQYENMYF
SYV_ALIF1       WYVRT------------AP--------LAEPAVKAVE--DGQ-----IQFVPKQYENMYF
SYV_VIBCH       WYVRA------------GI--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_VIBVU       WYVRT------------AP--------LAKTAVEAVE--NGD-----IQFVPKQYENMYF
SYV_VIBVY       WYVRT------------AP--------LAKTAVEAVE--NGD-----IQFVPKQYENMYF
SYV_VIBPA       WYVRT------------AP--------LAKTAVEAVE--NGD-----IQFVPKQYENMYF
SYV_PHOLL       WYVRT------------AP--------LAKVAIEAVE--NGD-----IQFVPKQYENMYY
SYV_YERPE       WYVHT------------AP--------LAKVAIEAVE--NGE-----IQFVPKQYENMYY
SYV_YERPS       WYVRT------------AP--------LAKVAIEAVE--NGE-----IQFVPKQYENMYY
SYV_PECAS       WYVRA------------AV--------LAKPAVEAVE--DGR-----IQFVPKQYENMYF
SYV_SHIDS       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_ECOL6       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_ECOLI       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_ECO57       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SHIBS       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SHISS       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SHIFL       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SALPA       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SALTI       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SALCH       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_SALTY       WYVRA------------DV--------LAKPAVEAVE--NGD-----IQFVPKQYENMYF
SYV_PSEHT       WYVRV------------AP--------LAEPAKEAVK--NGD-----IQFVPKQYENMYF
SYV_SHEON       WYVAV------------AP--------MAKTAIEAVE--NGD-----IKFVPQQYENMYF
SYV_CHRVO       WFVAMNKVAEG--DATGQS--------IAAKAIEAVE--SGE-----VRFVPENWVNTYN
SYV_NEIG1       WFVAMSATPNGG-----EPDNEFKGLSLADKAKKAVD--SGA-----VRFIPENWVNTYN
SYV_NEIMA       WFVAMSATPNGG-----EPDSEFKGLSLADKAKKAVD--SGA-----VRFIPENWVNTYN
SYV_NEIMB       WFVAMSATPNGG-----EPDSEFKGLSLADKAKKAVD--SGA-----VRFIPENWVNTYN
SYV_NITEU       WYLAM------------EG--------LAKQGLAVVA--SGK-----VRFVPENWTHVYN
SYV_THIDA       WFMSM------------EG--------LAKQGLAAVD--SGE-----LKFVPENWTTTYR
SYV_BORPE       WFVAMSKPAPAGTLNPGKS--------ITEVALEAVA--DGR-----IAFYPENWTTIYN
SYV_BORBR       WFVAMSKPAPAGTLNPGKS--------ITEVALEAVA--DGR-----IAFYPENWTTIYN
SYV_BORPA       WFVAMSKPAPASTLNPGKS--------ITEVALEAVA--DGR-----IAFYPENWATIYN
SYV_BURMA       WFVAMTKPAPQGTFHPGKS--------ITEVSLEVVR--RGE-----IKFVPENWTTTYY
SYV_BURPS       WFVAMTKPAPQGTFHPGKS--------ITEVSLEVVR--RGE-----IKFVPENWTTTYY
SYV_CUPPJ       WFVAMSKPAPEGTFYPGRS--------IAEVALDAVQ--SGE-----IKLVPENWNSTYN
SYV_RALSO       WFVAMSKPAPEGTRFPGRS--------IAEVALDAVQ--GGK-----IKLVPEQWVNTYN
SYV_AROAE       WFVAMTKPGADG-----RS--------ITAKALECVA--SGE-----IRFYPENWINTYN
SYV_DECAR       WFVAMSKPGDDG-----KS--------ITEKALDVVH--SGE-----IKFYPENWVNTYN
SYV_FUSNN       WFVKM------------KP--------LAEKALEVVR--NGE-----VKILPKRMEKIYY
SYV_BDEBA       WFVKM------------EA--------LAVPAKRVAE--NGT-----IRFEPESWTKVYL
SYV_GLUOX       WYCDA------------KT--------LSGPAVEAVE--SGK-----IAFEPRQWENTFH
SYV_RHOS4       WFVDT------------AQ--------IVQPAIDAVR--TGR-----TEILPERDAKTYF
SYV_RUEPO       WFVDA------------EK--------VVGPALDAVR--DGT-----VKIIPESGEKTYY
SYV_SPHEL       WYVDA------------AT--------LAKPAIEAVR--SGA-----TKIVPKSWEKTYF
SYV_ZYMMO       WYVDA------------EK--------LAQPALEAVR--SGK-----IKIIPESWTKTYY
SYV_CAUVC       WYVDA------------KT--------LAQPALKAVE--TGE-----TIFEPKHWEKTYF
SYV_NITWN       WYVDA------------KE--------LARPAMAAVR--SGE-----TAFVPKNWEKTYF
SYV_BRADU       WYVDA------------KT--------LAKPAIAAVR--SGE-----TSFVPKNWEKTYF
SYV_RHOPA       WYVDA------------KT--------LAQPAIAAVR--SGE-----TTFVPKNWEKTYF
SYV_BARHE       WYVNA------------AE--------LAKPAIEAVH--QGK-----TQFIPDSWQKTYF
SYV_BARQU       WYVCA------------EQ--------LAKPAVEAVR--QGR-----TQFVPDSWKKTYF
SYV_AGRFC       WWVDN------------KT--------LAQPAIASVR--EGR-----TNFVPKNWENTYF
SYV_RHIME       WYVDA------------KT--------LAKPAIAAVK--EGR-----TNFVPKNWEKTFF
SYV_RHILO       WYANA------------AE--------LAKPAIASVR--EGR-----TNFVPKNWEKTYF
SYV_BRUME       WYVNA------------GE--------LAKPAMAAVR--DGR-----TQIVPKNWEKTYF
SYV_BRUSU       WYVNA------------GE--------LAKPAMAAVR--DGR-----TQIVPKNWEKTYF
SYV_DESPS       WFVSV------------KP--------LAAKAVDAVR--DGQ-----INIYPKTWYNTFY
SYV_DESVH       WFVAS------------TK--------LAPRARAAVP---QM-----TQIFPESWMKTYF
SYV_GEOSL       WYVKV------------GP--------LAERALAAVK--DGR-----TRIVPQQWENTYY
SYV_PELCD       WYVNV------------QP--------LAEKAIEAVQ--TGQ-----TRIIPQQWEKTYF
SYV_DEHM1       WFVKM------------EP--------LAKPALEAVN--SGR-----IQILPERFTKVYQ
SYV_DEHMC       WFVKM------------EP--------LAKPALEAVN--SGR-----IQILPERFNKVYQ
SYV_SYMTH       WYVKM------------KP--------LAEPAIRAVE--SGQ-----IKIVPERFTKVYL
SYV_LACCA       WFVKM------------KP--------LAEAAIKAQQEPDKK-----VTFVPERFEHTYL
SYV_LACAC       WFVKM------------KP--------LADKVLENQK-SEGK-----VNFVPERFEQTLN
SYV_LACJO       WFVKM------------KP--------LAEKVLENQK-TDDK-----VNFVPERFEHTLE
SYV_STAS1       WFVKM------------KP--------LAEQALNNQK-TDDR-----IDFVPARFEKTFN
SYV_STAAR       WFVRM------------ED--------LAKRSLDNQK-TDDR-----IDFYPQRFEHTFN
SYV_STAAC       WFVRM------------ED--------LAKRSLDNQK-TDDR-----IDFYPQRFEHTFN
SYV_STAAN       WFVRM------------ED--------LAKRSLDNQK-TDDR-----IDFYPQRFEHTFN
SYV_STAAS       WFVRM------------ED--------LAKRSLDNQK-TDDR-----IDFYPQRFEHTFN
SYV_STAAW       WFVRM------------ED--------LAKRSLDNQK-TDDR-----IDFYPQRFEHTFN
SYV_STAAM       WFVRM------------ED--------LAKRSLDNQK-TDDR-----IDFYPQRFEHTFN
SYV_STAEQ       WFVKM------------KP--------LAQRALDNQN-TKDR-----IDFFPGRFENTFN
SYV_STAES       WFVKM------------KP--------LAQRALDNQN-TKDR-----IDFFPGRFENTFN
SYV_STAHJ       WFVKM------------KP--------LAQRSLDNQK-TDDR-----IDFYPPRFENTFN
SYV_LACPL       WFVKM------------KP--------LAEQALKNQE-GDDA-----VDFIPKRFEDAFK
SYV_LACSS       WFVKM------------KP--------LAEMALKNQE-TDQK-----VNFVPERFENTFT
SYV_ENTFA       WFVKM------------GP--------LAEKAMKNQE-TEDA-----VEFYPPRFNQTFL
SYV_LACLA       WFVKM------------DE--------LAKNAIANQT-TEDA-----VEFYPPRFNDTFM
SYV_STRMU       WFVKM------------DQ--------LAKNAIANQD-TDDK-----VDFYPPRFNDTFL
SYV_STRA5       WFVKM------------DQ--------LAKNAIANQD-TEDK-----VEFYPPRFNDTFM
SYV_STRA1       WFVKM------------DQ--------LAKNAIANQD-TEDK-----VEFYPPRFNDTFM
SYV_STRA3       WFVKM------------DQ--------LAKNAIANQD-TEDK-----VEFYPPRFNDTFM
SYV_STRT1       WFVKM------------DQ--------LAKNAIANQD-TDDK-----VDFYPPRFNDTFL
SYV_STRT2       WFVKM------------DQ--------LAKNAIANQD-TDDK-----VDFYPPRFNDTFL
SYV_STRP1       WFVKM------------DE--------LAKQAMDNQE-TDDR-----VDFYPPRFNDTFL
SYV_STRPM       WFVKM------------DE--------LAKQAMDNQE-TDNR-----VDFYPPRFNDTFL
SYV_STRP6       WFVKM------------DE--------LAKQAMDNQE-TDDR-----VDFYPPRFNDTFL
SYV_STRP3       WFVKM------------DE--------LAKQAMDNQE-TDDR-----VDFYPPRFNDTFL
SYV_STRP8       WFVKM------------DE--------LAKQAMDNQE-TDDR-----VDFYPPRFNDTFL
SYV_STRPN       WFVKM------------DQ--------LAKNAIANQD-TEDK-----VEFYPPRFNDTFL
SYV_STRR6       WFVKM------------DQ--------LAKNAIANQD-TEDK-----VEFYPPRFNDTFL
SYV_LISIN       WFVKM------------EP--------LAAEALALQK-TEDK-----VNFVPARFEKTYE
SYV_LISMF       WFVKM------------EP--------LAAEALELQK-TENK-----VNFVPARFEKTYE
SYV_LISMO       WFVKM------------EP--------LAAEALELQK-TENK-----VNFVPARFEKTYE
SYV_OCEIH       WFVKM------------DP--------LAKSALDMQADADEK-----VNFVPDRFERTYF
SYV_BACC1       WFVKM------------AP--------LAEKAVALQQKEEEK-----VTFVPERFENTYL
SYV_BACCZ       WFVKM------------AP--------LAEKAVALQQKDEEK-----VTFVPERFENTYL
SYV_BACCR       WFVKM------------AP--------LAEKAVALQQKEEEK-----VTFVPERFENTYL
SYV_BACAN       WFVKM------------AP--------LAEKAIELQQKEEEK-----VTFVPDRFENTYL
SYV_BACHK       WFVKM------------AP--------LAEKAIELQQKEEEK-----VTFVPDRFENTYL
SYV_BACSK       WFVKM------------RP--------LAEEALKLQEYADTK-----VTFVPQRFEQTYI
SYV_BACHD       WFVKM------------KP--------LAEQAIELQT-TENK-----VNFVPDRFEKTYL
SYV_GEOSE       WFVKM------------KP--------LAEAAIKLQQ-TDGK-----VQFVPERFEKTYL
SYV_GEOKA       WFVKM------------KP--------LAEAAIKLQQ-TDEK-----VQFVPDRFEKTYL
SYV_BACLD       WFVQM------------QP--------LADAAIELQK-SEGK-----VNFVPDRFEKTYL
SYV_BACSU       WFVRM------------QP--------LADAAIELQK-KEEK-----VNFVPDRFEKTYL
SYV_THEMA       WFVST------------KP--------LAKRAIEAVE--NGE-----IRFFPERWTKVYL
SYV_CARHZ       WFVKM------------KP--------LAEPAIEAAL--TGK-----VKFVPERFTKIYL
SYV_CALS4       WFVKM------------EP--------LAKPALQVVK--EGK-----IKFVPERFEKIYT
SYV_CLOPE       WYVKM------------QS--------LADPAIEVVR--NKG-----TKFVPERFEKTYF
SYV_CLOAB       WYVKM------------ES--------LAKPAIEAVK--AGK-----TKFVPERFDKIYF
SYV_CLOTE       WYVKM------------KE--------LAKPAIEVVK--SGE-----IKFVPERFDKTYF
                *                                                : .        

SYV_MYCGA       NWLDHNQDWCISRQLVWGHQIPAWY-H----KD-------HPD-----EV----------
SYV_MYCGE       NWLNKLKPWCISRQLIWGHKIPVWF-E----NN--------TG-----EI----------
SYV_MYCPN       RWLSQLKPWCISRQLIWGHPIPVWT-H----KQ--------SG-----AL----------
SYV_MYCPE       NWMTNLNDWCISRQLWWGHQIPVWY-K----KD---S-----K-----EI----------
SYV_MYCS5       RWMNNVYDWNISRQLWWGHQIPAWY------KD---------G-----KM----------
SYV_MYCH2       KWFEKIHDWTISRQLWWGHRIPVWY-K----ND---------------EF----------
SYV_MYCH7       KWFEKIHDWTISRQLWWGHRIPVWC-K----ND---------------EF----------
SYV_MYCHJ       KWFEKIHDWTISRQLWWGHRIPVWC-K----ND---------------EF----------
SYV_MYCMO       IWMQEAHDWNISRQLWWGHKIPAWY-D----EK---------G-----NI----------
SYV_MYCPU       GWMNKTYDWTISRQLWWGHQIPAWY------KD---------E-----QT----------
SYV_PARUW       HWIDNLRDWCISRQLWWGHRIPIWY-HKEDSNR---------L-----IC----------
SYV_CHLPN       SWVNHLRDWCISRQLWWGHRIPVWY-HKNDDER---------V-----LC----------
SYV_CHLMU       TWVNNLKDWCISRQLWWGHRIPVWH-NKHDEEY---------V-----IC----------
SYV_CHLTR       TWVNNLKDWCISRQLWWGHRIPVWH-NKHDENV---------------IC----------
SYV_CHLAB       TWVNNLRDWCISRQLWWGHRIPVWY-HKSDAHR---------M-----LC----------
SYV_CHLCV       SWVNNLRDWCISRQLWWGHRIPVWY-HKSDEDR---------I-----LC----------
SYV_ONYPE       NWLQNIEDWCISRQLWWGHQIPAWH-K----GQ---------------EI----------
SYV_UREPA       TWLKNTEDWCISRQLWWGHQIPVWY-H----KK--------TN-----QI----------
SYV_PORGI       HWMENVKDWCISRQLWWGHRIPAYY-L----PD---------G-----SI----------
SYV_BACFN       HWMENIKDWCISRQLWWGHRIPAYF-L----PE---------G-----GY----------
SYV_BACFR       HWMENIKDWCISRQLWWGHRIPAYF-L----PE---------G-----GY----------
SYV_BACTN       HWMENIKDWCISRQLWWGHRIPAYF-L----PE---------G-----GY----------
SYV_WIGBR       GWMENIKDWCISRQLWWGHRIPIWY-D----VN---------K-----NQ----------
SYV_DEIRA       DWLENIRDWNISRQLWWGHQIPAWY-D----KE---------G-----NI----------
SYV_THET8       DWLENVKDWNISRQLWWGHQIPAWY-C----ED--------CQ-----AV----------
SYV_THETH       DWLENVKDWNISRQLWWGHQIPAWY-C----ED--------CQ-----AV----------
SYV_THET2       DWLENVKDWNISRQLWWGHQIPAWY-C----ED--------CQ-----AV----------
SYV_HELPJ       AWMRELRPWCISRQLFWGHQIPVFT-C----EN---------N-----HQ----------
SYV_HELPY       AWMRELRPWCISRQLFWGHQIPVFT-C----EN---------N-----HQ----------
SYV_CAMJE       AWMKDLRDWCISRQLWWGHQIPVYY-C----EC---------S-----HE----------
SYV_CAMJR       AWMKDLRDWCISRQLWWGHQIPVYY-C----EC---------S-----HE----------
SYV_HELHP       AWMRELKDWCISRQLWWGHRIPVWY-C----EC---------G-----NK----------
SYV_WOLSU       AWMKELRDWCISRQLWWGHQIPVYY-C----DC---------G-----HE----------
SYV_BORBU       YWLSNIRDWCISRQLVWGHRIPVWY-NV---DT---------S-----EL----------
SYV_BORBP       YWLSNIKDWCISRQLVWGHRIPAWY-NI---DT---------S-----EL----------
SYV_MESFL       KWMENIHDWTISRQLWWGHRIPAWY------NKEDKT-----------KI----------
SYV_MYCMS       RWMTDAHDWCISRQLWWGHQIPCWY-H----KK--------TN-----EM----------
SYV_PELUB       QWMNNIEPWCISRQLWWGHQIPAWY-G----PD---------K-----KI----------
SYV_TREDE       HWMNNIRDWCISRQLWWGHRIPVWY-C----AD--------CG-----KT----------
SYV_TREPA       RWLEHIRDWCISRQLWWGHRIPVWY-C----AQ--------CA-----QQ----------
SYV_GLOVI       DWLVRIRPWNISRQLWWGHRIPAWFVAG---SE---------G-----EY----------
SYV_PROMP       DWLDNINDWCISRQLWWGHQIPAWY-VLKQSED---------------SI----------
SYV_PROMA       DWLTGIRDWCISRQLWWGHRIPAWF-VVSETNN---------------EL----------
SYV_PROMT       DWLTDIRDWCISRQLWWGHRIPAWF-VISQTDN---------------KV----------
SYV_PROMM       DWLTEIRDWCISRQLWWGHRIPAWF-VVSETDD---------------QL----------
SYV_SYNPX       DWLTDIRDWCISRQLWWGHRIPAWFVI----SE-------TGG-----KY----------
SYV_THEEB       DWLVNLRDWCISRQLWWGHQIPAWYVV----SE-------TNG-----EV----------
SYV_SYNP6       DWLENLRDWCISRQLWWGHQIPAWYAV----SE-------TNG-----VV----------
SYV_NOSS1       DWLVNLRDWCISRQLWWGHQIPAWYAV----SE-------TNG-----QI----------
SYV_SYNY3       DWLVKLKDWCISRQLWWGHQIPAWYVI----SE-------TNG-----AI----------
SYV_LEPIC       EWMNNIRDWCISRQLWWGHRIPAYH-C----KK--------CK-----HF----------
SYV_LEPIN       EWMNNIRDWCISRQLWWGHRIPAYH-C----KK--------CK-----HF----------
SYV_STRAW       DWVDNLHDWCISRQLWWGHRIPVWY-G----PN---------G-----EV----------
SYV_STRCO       DWVDNLHDWCISRQLWWGHRIPVWY-G----PE---------G-----EV----------
SYV_CORJK       DWVDDMHDWCISRQLWWGHRIPIWY-G----PN---------G-----EI----------
SYV_CORDI       DWVDDMHDWCISRQLWWGHRIPIWY-G----PE---DAEGNRD-----IV----------
SYV_COREF       DWVDDMHDWCISRQLWWGHRIPIWY-G----PD---------G-----DV----------
SYV_CORGL       DWVDNMHDWTISRQLWWGHRIPIWY-G----PN---------D-----EI----------
SYV_NOCFA       EWVDNMHDWTISRQLWWGHRIPIWY-G----PD---------G-----EV----------
SYV_MYCLE       AWVDDMRDWCISRQLWWGHRIPIWY-G----PN---------G---E-QV----------
SYV_MYCBO       SWVDDMHDWCISRQLWWGHRIPIWY-G----PD---------G---E-QV----------
SYV_MYCTU       SWVDDMHDWCISRQLWWGHRIPIWY-G----PD---------G----EQV----------
SYV_MYCPA       AWVDDMHDWCVSRQLWWGHRIPIWY-G----PN---------G-----EQ----------
SYV_BUCBP       SWMNNIKDWCISRQLLWGHRMPIWY-D----KK---------N-----NI----------
SYV_BLOFL       QWMNEIQDWCISRQIWWGHRIPVWY-D----NN---------N-----TI----------
SYV_BLOPB       SWMNNLQDWCISRQIWWGHKIPAWY-D----DN---------N-----TI----------
SYV_BUCAI       SWMNNIEDWCISRQLWWGHRIPVWY-D----DQ---------K-----NI----------
SYV_BUCAP       SWMNNIEDWCISRQLWWGHQIPVWY-D----DK---------K-----NI----------
SYV_FRATT       AWMRDIQDWCVSRQLWWGHRIPAWY-D----EA---------G-----NA----------
SYV_COXBU       QWLSNIQDWCISRQLWWGHRLPVWY-D----EE---------K-----NS----------
SYV_XYLFA       HWMENIQDWCISRQLWWGHRIPAWF-D----TQ---------G-----GV----------
SYV_XYLFT       HWMENIQDWCISRQLWWGHRIPAWF-D----TQ---------G-----CV----------
SYV_XANC8       HWMENIQDWCISRQLWWGHRIPAWF-D----EA---------G-----KC----------
SYV_XANCP       HWMENIQDWCISRQLWWGHRIPAWF-D----EA---------G-----KC----------
SYV_XANOR       HWMENIQDWCISRQLWWGHRIPAWF-D----DA---------G-----HC----------
SYV_XANC5       HWMENIQDWCISRQLWWGHRIPAWF-D----EA---------G-----TC----------
SYV_XANAC       HWMENIQDWCISRQLWWGHRIPAWF-D----DA---------G-----KC----------
SYV_LEGPA       QWMDNIEDWCISRQLWWGHRIPAWY-D----NH---------G-----NI----------
SYV_LEGPH       QWMDNIEDWCISRQLWWGHRIPAWY-D----NH---------G-----NI----------
SYV_LEGPL       QWMDNIEDWCISRQLWWGHRIPAWY-D----NH---------G-----NI----------
SYV_METCA       QWMYNIQDWCISRQIWWGHRIPAWY-D----GE---------G-----RV----------
SYV_NITOC       EWMRNIQDWCISRQIWWGHRIPAWY-D----PE---------G-----KI----------
SYV_ACIAD       AWMNNIQDWCISRQLWWGHRIPAWY-D----AE---------G-----NV----------
SYV_PSYA2       AWMNGIQDWCISRQLWWGHRIPAWY-D----EE---------G-----SI----------
SYV_PSEAE       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_PSEPK       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----QV----------
SYV_PSEF5       SWMRDIQDWCISRQLWWGHRIPAWY-D----ES---------G-----KV----------
SYV_PSESM       SWMRDIQDWCISRQLWWGHRIPAWY-D----ES---------G-----KV----------
SYV_PSE14       SWMRDIQDWCISRQLWWGHRIPAWY-D----ES---------G-----KV----------
SYV_PSEU2       SWMRDIQDWCISRQLWWGHRIPAWY-D----ES---------G-----KV----------
SYV_IDILO       SWMRDIQDWCISRQLWWGHRIPAWY-D----EQ---------G-----NV----------
SYV_MANSM       SWMRDIQDWCISRQLWWGHRIPAWY-D----EQ---------G-----NV----------
SYV_PASMU       SWMRDIQDWCISRQLWWGHRIPAWY-D----EQ---------G-----NV----------
SYV_HAEDU       SWMRDIQDWCISRQLWWGHRIPAWY-D----ES---------G-----NV----------
SYV_HAEI8       SWMRDIQDWCISRQLWWGHRIPAWY-D----AE---------G-----NV----------
SYV_HAEIN       SWMRDIQDWCISRQLWWGHRIPAWY-D----AE---------G-----NV----------
SYV_COLP3       SWMNNIQDWCISRQLWWGHRIPAWY-D----EN---------E-----KV----------
SYV_PHOPR       AWMRDVQDWCISRQLWWGHRIPAWY-D----NY---------G-----KV----------
SYV_ALIF1       AWMRDVQDWCISRQLWWGHRIPAWY-D----ND---------G-----KV----------
SYV_VIBCH       SWMRDIQDWCISRQLWWGHRIPAWY-D----EQ---------G-----NV----------
SYV_VIBVU       SWMRDVQDWCISRQLWWGHRIPAWY-D----NQ---------G-----NV----------
SYV_VIBVY       SWMRDVQDWCISRQLWWGHRIPAWY-D----NQ---------G-----NV----------
SYV_VIBPA       SWMRDVQDWCISRQLWWGHRIPAWY-D----NQ---------G-----NV----------
SYV_PHOLL       SWMRDIQDWCISRQLWWGHRIPAWY-D----TN---------G-----NV----------
SYV_YERPE       SWMRDIQDWCISRQLWWGHRIPAWY-D----EQ---------G-----NV----------
SYV_YERPS       SWMRDIQDWCISRQLWWGHRIPAWY-D----EQ---------G-----NV----------
SYV_PECAS       SWMRDIQDWCISRQLWWGHRIPAWY-D----AN---------G-----NV----------
SYV_SHIDS       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_ECOL6       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_ECOLI       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_ECO57       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_SHIBS       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_SHISS       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_SHIFL       SWMRDIQDWCISRQLWWGHRIPAWY-D----EA---------G-----NV----------
SYV_SALPA       SWMRDIQDWCISRQLWWGHRIPAWY-G----ND---------G-----NV----------
SYV_SALTI       SWMRDIQDWCISRQLWWGHRIPAWY-D----ND---------G-----NV----------
SYV_SALCH       SWMRDIQDWCISRQLWWGHRIPAWY-D----ND---------G-----NV----------
SYV_SALTY       SWMRDIQDWCISRQLWWGHRIPAWY-D----ND---------G-----NV----------
SYV_PSEHT       SWMNDVQDWCISRQLWWGHRIPAWY-D----SE---------G-----NV----------
SYV_SHEON       SWMRDIQDWCISRQLWWGHRIPAWY-D----TN---------G-----KV----------
SYV_CHRVO       QWMKNIQDWCISRQLWWGHQIPAWY-D----ED---------G-----NI----------
SYV_NEIG1       QWMNNIQDWCISRQLWWGHQIPAWY-D----EA---------G-----NV----------
SYV_NEIMA       QWMNNIQDWCISRQLWWGHQIPAWY-D----NE---------G-----NV----------
SYV_NEIMB       QWMNNIQDWCISRQLWWGHQIPAWY-D----NE---------G-----NV----------
SYV_NITEU       QWLENIQDWCISRQLWWGHRIPAWY-D----ED---------G-----NV----------
SYV_THIDA       QWLENIQDWCVSRQLWWGHRIPAWY-D----AD---------G-----EF----------
SYV_BORPE       QWLNNIQDWCISRQLWWGHQIPAWY-S----ED---------G-----QV----------
SYV_BORBR       QWLNNIQDWCISRQLWWGHQIPAWY-S----ED---------G-----QV----------
SYV_BORPA       QWLNNIQDWCISRQLWWGHQIPAWY-S----ED---------G-----QV----------
SYV_BURMA       QWLENIQDWCISRQLWWGHQIPAWY-G----EN---------G-----EI----------
SYV_BURPS       QWLENIQDWCISRQLWWGHQIPAWY-G----EN---------G-----EI----------
SYV_CUPPJ       QWLANIQDWCISRQLWWGHQIPAWY-D----DA---------G-----NC----------
SYV_RALSO       QWLNNIQDWCISRQLWWGHQIPAWY-D----EA---------G-----NV----------
SYV_AROAE       QWLNNIQDWCISRQLWWGHQIPAWY-ADVEGDS---------------RV----------
SYV_DECAR       QWLNNIQDWCISRQLWWGHQIPAWY-G----DN---------G-----QI----------
SYV_FUSNN       NWLENIRDWCISRQIWWGHRIPAWY-G----PD---------R-----HV----------
SYV_BDEBA       HWLNNIEDWCISRQLWWGHRIPVWY-C----ED--------CN-----HQ----------
SYV_GLUOX       AWMRDIQPWCISRQLWWGHRIPAWY-G----AD---------G-----KV----------
SYV_RHOS4       HWLENIEPWCISRQLWWGHQIPVWY-G----LDIWPARFEDDGDDTLDEVEIFELLEDGA
SYV_RUEPO       HWLENIEPWCISRQLWWGHQIPVWY-G----PN-----RDDLGASY--KA----------
SYV_SPHEL       NWMENIQPWCVSRQLWWGHRIPAWF-D----AE---------G-----KP----------
SYV_ZYMMO       NWLENIQPWCISRQLWWGHQIPVWY-T----DD---------G-----QA----------
SYV_CAUVC       EWLRNIEPWCVSRQLWWGHRIPAWF-G----PE---------G-----SI----------
SYV_NITWN       EWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----KV----------
SYV_BRADU       EWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----KV----------
SYV_RHOPA       EWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----KV----------
SYV_BARHE       NWMQNIQPWCVSRQLWWGHQIPAWY-G----PD---------G-----RV----------
SYV_BARQU       NWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----MV----------
SYV_AGRFC       QWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----QV----------
SYV_RHIME       EWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----QI----------
SYV_RHILO       DWMENIQPWCISRQLWWGHQIPAWY-G----PD---------G-----RV----------
SYV_BRUME       DWMENIQPWCVSRQLWWGHQIPAWY-G----PD---------S-----HC----------
SYV_BRUSU       DWMENIQPWCVSRQLWWGHQIPAWY-G----PD---------G-----HC----------
SYV_DESPS       SWMDNIRDWCISRQIWWGHRIPAWS-C----AD--------CG-----EL----------
SYV_DESVH       NWLDNIRDWCISRQIWWGHRIPAWT-C----GK--------CG-----KL----------
SYV_GEOSL       DWMENIKDWCISRQIWWGHRIPAWY-C----DH--------CG-----ET----------
SYV_PELCD       EWMFNIRDWCISRQIWWGHRIPAWF-C----AA--------CN-----EV----------
SYV_DEHM1       NWMENIRDWCISRQLWWGHRIPVWY-C----PC---------G-----EM----------
SYV_DEHMC       NWMENIRDWCISRQLWWGHRIPVWY-C----PC---------G-----EM----------
SYV_SYMTH       HWMENIQDWCISRQIWWGHRIPVWY-C----DD--------CG-----HL----------
SYV_LACCA       QWMENIHDWVISRQLWWGHQIPAWY-N----KQ--------TG-----ET----------
SYV_LACAC       HWMENVHDWVISRQLWWGHRIPAWY-N----KK--------TG-----ET----------
SYV_LACJO       QWMSDVHDWVISRQLWWGHRIPAWY-N----KK--------TG-----ET----------
SYV_STAS1       RWMEEIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAAR       QWMENIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAAC       QWMENIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAAN       QWMENIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAAS       QWMENIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAAW       QWMENIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAAM       QWMENIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_STAEQ       RWMEEIRDWTISRQLWWGHQIPAWY-H----KD--------TG-----EV----------
SYV_STAES       RWMEEIRDWTISRQLWWGHQIPAWY-H----KD--------TG-----EV----------
SYV_STAHJ       RWMEEIRDWTISRQLWWGHQIPAWY-H----KE--------TG-----EI----------
SYV_LACPL       QWMENIHDWVISRQLWWGHRIPAWY-N----KT--------TG-----ET----------
SYV_LACSS       QWMENVHDWVISRQLWWGHQIPAWY-H----KQ--------TG-----EM----------
SYV_ENTFA       RWMENVHDWVISRQLWWGHQIPAWY-H----KE--------TG-----EM----------
SYV_LACLA       QWMENVHDWVISRQLWWGHQIPAWY-N----EA---------G-----EM----------
SYV_STRMU       QWMENVHDWVISRQLWWGHQIPAWY-N----AD---------G-----DM----------
SYV_STRA5       SWMENVHDWVISRQLWWGHQIPAWY-N----VN---------G-----EM----------
SYV_STRA1       SWMENVHDWVISRQLWWGHQIPAWY-N----VN---------G-----EM----------
SYV_STRA3       SWMENVHDWVISRQLWWGHQIPAWY-N----VN---------G-----EM----------
SYV_STRT1       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRT2       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRP1       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRPM       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRP6       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRP3       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRP8       QWMENVHDWVISRQLWWGHQIPAWY-N----AE---------G-----EI----------
SYV_STRPN       QWMENVHDWVISRQLWWGHQIPAWY-N----AD---------G-----EM----------
SYV_STRR6       QWMENVHDWVISRQLWWGHQIPAWY-N----AD---------G-----EM----------
SYV_LISIN       TWMDNIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EI----------
SYV_LISMF       TWMDNIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EI----------
SYV_LISMO       TWMDNIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EI----------
SYV_OCEIH       NWMDNIRDWCISRQLWWGHRIPAWY-H----KE--------TK-----EI----------
SYV_BACC1       RWMENIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EV----------
SYV_BACCZ       RWMENIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EV----------
SYV_BACCR       RWMENIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EV----------
SYV_BACAN       RWMENIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EV----------
SYV_BACHK       RWMENIHDWCISRQLWWGHRIPAWY-H----KE--------TG-----EV----------
SYV_BACSK       RWMENIRDWCISRQLWWGHQIPAWY-H----KE--------TN-----EI----------
SYV_BACHD       RWMENIRDWCISRQLWWGHRIPAWY-H----KE--------TG-----EV----------
SYV_GEOSE       HWLENIRHWCISRQLWWGHRIPAWY-H----KE--------TG-----EI----------
SYV_GEOKA       HWLENIRDWCISRQLWWGHRIPAWY-H----KE--------TG-----EI----------
SYV_BACLD       HWMENIRDWCISRQLWWGHRIPAWY-H----KE--------TG-----EI----------
SYV_BACSU       HWMENIRDWCISRQLWWGHRIPAWY-H----KE--------TG-----EL----------
SYV_THEMA       NWMYEIRDWCISRQLWWGHRIPVWY-C----QD--------CG-----HL----------
SYV_CARHZ       NWLYNIRDWCISRQLWWGHRIPVWY-C----DE--------CG-----EV----------
SYV_CALS4       NWLENIKDWCISRQLWWGHRIPAWY-C----ED--------CG-----HV----------
SYV_CLOPE       NWMENIQDWCISRQLWWGHRIPVFY-C----KD--------CG-----EI----------
SYV_CLOAB       NWMENIQDWCISRQLWWGHRIPVWY-C----KD--------CG-----EI----------
SYV_CLOTE       NWMENIQDWCISRQLWWGHRIPVWY-C----KD--------CG-----ET----------
                 *.     * :***: *** :* :                                    

SYV_MYCGA       -------------I------VSINSP----------------------------------
SYV_MYCGE       -------------V------VGEKPS----------------------------------
SYV_MYCPN       -------------H------VGSTAP----------------------------------
SYV_MYCPE       -------------Y------VGTKPP----------------------------------
SYV_MYCS5       -------------K------VQAE------------------------------------
SYV_MYCH2       -------------K------VQIDSP----------------------------------
SYV_MYCH7       -------------K------VQIDSP----------------------------------
SYV_MYCHJ       -------------K------VQIDSP----------------------------------
SYV_MYCMO       -------------K------VQTTSP----------------------------------
SYV_MYCPU       -------------K------VQLNSP----------------------------------
SYV_PARUW       -------------Y------AGSDLPDEVK------------------------------
SYV_CHLPN       -------------Y------DGEGIPEEVA------------------------------
SYV_CHLMU       -------------F------DGDGVPEEVA------------------------------
SYV_CHLTR       -------------F------DGEGGPEEVM------------------------------
SYV_CHLAB       -------------Y------DGEGIPEEVA------------------------------
SYV_CHLCV       -------------Y------DGEGIPEEVA------------------------------
SYV_ONYPE       -------------K------VQIESP----------------------------------
SYV_UREPA       -------------Y------CDTIPP----------------------------------
SYV_PORGI       -------------V------VAETAEKAVELARKQTGSDS--------------------
SYV_BACFN       -------------V------VAVTDEEALKLAREKTGNPN--------------------
SYV_BACFR       -------------V------VAVTDEEALKLAREKTGNPN--------------------
SYV_BACTN       -------------V------VAATPEEALAKAKEKTGNAA--------------------
SYV_WIGBR       -------------Y------PGISESDVRDNFKI--------------------------
SYV_DEIRA       -------------Y------VPDPENPELDCDQDPR------------------------
SYV_THET8       -------------N------VPRPERYLEDPTSCEA------------------------
SYV_THETH       -------------N------VPRPERYLEDPTSCEA------------------------
SYV_THET2       -------------N------VPKPERYLEDPTSCEA------------------------
SYV_HELPJ       -------------F------VSLDTPLSCPT-----------------------------
SYV_HELPY       -------------F------VSLDTPLSCPT-----------------------------
SYV_CAMJE       -------------W------ASQHTPKTCPK-----------------------------
SYV_CAMJR       -------------W------ASQHTPKTCPK-----------------------------
SYV_HELHP       -------------V------ASESDNPICPQ-----------------------------
SYV_WOLSU       -------------W------ASETTPSHCPK-----------------------------
SYV_BORBU       -------------I------VSDTDPSLDEK-----------------------------
SYV_BORBP       -------------I------ISDTDPSLDEK-----------------------------
SYV_MESFL       -------------Y------VGMEAP----------------------------------
SYV_MYCMS       -------------Y------VGINPP----------------------------------
SYV_PELUB       -------------F------VAINEEEAKLDAKKFY------------------------
SYV_TREDE       -------------I------VSRTDITECPH-----------------------------
SYV_TREPA       -------------T------VSRVDVQRCAH-----------------------------
SYV_GLOVI       -------------V------VAHDEAEAFAVARERY------------------------
SYV_PROMP       -------------DQNTPYVVARNEKEALSKATKEF------------------------
SYV_PROMA       -------------TDDTPYIVALSEKDALLEAQKKY------------------------
SYV_PROMT       -------------VNETPYIVARTEDEAKKLAREKY------------------------
SYV_PROMM       -------------TDATPYLVARSEEEAWQQARDQF------------------------
SYV_SYNPX       -------------TDTTPYVVARNEVEALEKAKAKY------------------------
SYV_THEEB       -------------RDDTPFVVAMDETAARAKAIAQF------------------------
SYV_SYNP6       -------------TDSTPFVVAKSAEEAQQQAIAQF------------------------
SYV_NOSS1       -------------TDNTPFVVAKSTNEAWEKAKSQF------------------------
SYV_SYNY3       -------------TDHTPFIVAYDEAEALAKAKAEY------------------------
SYV_LEPIC       -------------E------VSETAVTVCTS-----------------------------
SYV_LEPIN       -------------E------VSETAVTVCTS-----------------------------
SYV_STRAW       -------------V-----CVGPDDEV---------------------------------
SYV_STRCO       -------------V-----CVGPGEEP---------------------------------
SYV_CORJK       -------------V------CCGPDDEA--------------------------------
SYV_CORDI       -------------C------VGPDEQP---------------------------------
SYV_COREF       -------------I-----CVGPDE-----------------------------------
SYV_CORGL       -------------I-----CVGPDE-----------------------------------
SYV_NOCFA       -------------V-----CLGPGE-----------------------------------
SYV_MYCLE       -------------C------VGPDE-----------------------------------
SYV_MYCBO       -------------C------VGPDE-----------------------------------
SYV_MYCTU       -------------C------VGPDE-----------------------------------
SYV_MYCPA       -------------R-----CVGPDE-----------------------------------
SYV_BUCBP       -------------Y------VGLDEKHIREKYHI--------------------------
SYV_BLOFL       -------------Y------VGHCEKDIRIKNQL--------------------------
SYV_BLOPB       -------------Y------VGYCEKDIRIKNKL--------------------------
SYV_BUCAI       -------------Y------IGQNEKEIRQAYSI--------------------------
SYV_BUCAP       -------------Y------VGHSEKKIREEYNI--------------------------
SYV_FRATT       -------------Y------VGEDEADVRAKYNL--------------------------
SYV_COXBU       -------------Y------VGRSREEILKKYHL--------------------------
SYV_XYLFA       -------------Y------VGRSEAEVRAKHAL--------------------------
SYV_XYLFT       -------------Y------VGRSEAEVRAKHAL--------------------------
SYV_XANC8       -------------Y------VGHDEAQVRATHGL--------------------------
SYV_XANCP       -------------Y------VGHDEAQVRATHGL--------------------------
SYV_XANOR       -------------H------VGHDEAEVRAKHGL--------------------------
SYV_XANC5       -------------Y------VGHDEAEVRAKHGL--------------------------
SYV_XANAC       -------------Y------VGHDEAEVRAKHGL--------------------------
SYV_LEGPA       -------------Y------VGYSENDVRFKHKI--------------------------
SYV_LEGPH       -------------Y------VGYSENDVRFKHKI--------------------------
SYV_LEGPL       -------------Y------VGYSENDVRFKHKI--------------------------
SYV_METCA       -------------Y------VGRSEEEVRAKHGL--------------------------
SYV_NITOC       -------------Y------VAPTETQARQKYNL--------------------------
SYV_ACIAD       -------------Y------VGRNEEEVRAKNNL--------------------------
SYV_PSYA2       -------------Y------VARDEAEVRSKYNL--------------------------
SYV_PSEAE       -------------Y------VGRDEVEVRTKHKL--------------------------
SYV_PSEPK       -------------Y------VGRNEEEVRAKHKL--------------------------
SYV_PSEF5       -------------Y------VGRDEAEVRAKHNL--------------------------
SYV_PSESM       -------------Y------VGRDEAEVRAKNNL--------------------------
SYV_PSE14       -------------Y------VGRDEAEVRAKNNL--------------------------
SYV_PSEU2       -------------Y------VGRDEAEVRAKNNL--------------------------
SYV_IDILO       -------------Y------VGRTEEEVREKHN---------------------------
SYV_MANSM       -------------Y------VGRSEEEVRSKNGL--------------------------
SYV_PASMU       -------------Y------VARDEAEVRAKHNL--------------------------
SYV_HAEDU       -------------Y------VARTEAEVRIKHNL--------------------------
SYV_HAEI8       -------------Y------VARNEEEVRSKYNL--------------------------
SYV_HAEIN       -------------Y------VARNEEEVRSKYNL--------------------------
SYV_COLP3       -------------Y------VGRTEEEVRANNDI--------------------------
SYV_PHOPR       -------------Y------VGRTEDEVREKNNL--------------------------
SYV_ALIF1       -------------Y------VGRTEEEVREKNNL--------------------------
SYV_VIBCH       -------------F------VGRNEEEVRAENNI--------------------------
SYV_VIBVU       -------------Y------VGRSEEEVRQNHNL--------------------------
SYV_VIBVY       -------------Y------VGRSEEEVRQNHNL--------------------------
SYV_VIBPA       -------------Y------VGRTEEEVRKNNNL--------------------------
SYV_PHOLL       -------------Y------VGRSEEEVRRENNL--------------------------
SYV_YERPE       -------------Y------VGRDEAEVRRDNNL--------------------------
SYV_YERPS       -------------Y------VGRDEAEVRRDNNL--------------------------
SYV_PECAS       -------------Y------VGRTEAEVRSENNL--------------------------
SYV_SHIDS       -------------Y------VGRNEEEVRKENNL--------------------------
SYV_ECOL6       -------------Y------VGRNEDEVRKENNL--------------------------
SYV_ECOLI       -------------Y------VGRNEDEVRKENNL--------------------------
SYV_ECO57       -------------Y------VGRNEEEVRKENNL--------------------------
SYV_SHIBS       -------------Y------VGRNEEEVRKENNL--------------------------
SYV_SHISS       -------------Y------VGRNEEEVRKENNL--------------------------
SYV_SHIFL       -------------Y------VGRNEEEVRKENNL--------------------------
SYV_SALPA       -------------Y------VGRTEDEVRQENNL--------------------------
SYV_SALTI       -------------Y------VGRTEDEVRQENNL--------------------------
SYV_SALCH       -------------Y------VGRTEDEVRQENNL--------------------------
SYV_SALTY       -------------Y------VGRTEDEVRQENNL--------------------------
SYV_PSEHT       -------------F------VGRDEAEVRRENNI--------------------------
SYV_SHEON       -------------Y------VGRTEAEVRAKHDI--------------------------
SYV_CHRVO       -------------Y------VGRTEAEAQAK-----------------------------
SYV_NEIG1       -------------Y------VARNQAEAEKQ-----------------------------
SYV_NEIMA       -------------Y------VARNQEEAEKQ-----------------------------
SYV_NEIMB       -------------Y------VARNQEEAEKQ-----------------------------
SYV_NITEU       -------------T------VAHDLEEARKL-----------------------------
SYV_THIDA       -------------Y------VAHTEEEARKQ-----------------------------
SYV_BORPE       -------------F------VARSEEEAQEQARAA-------------------------
SYV_BORBR       -------------F------VARSEQEAQEQARAA-------------------------
SYV_BORPA       -------------F------VARSEQEAQEQARAA-------------------------
SYV_BURMA       -------------F------VARNEEDARAQAAAK-------------------------
SYV_BURPS       -------------F------VARNEEDARAQAAAK-------------------------
SYV_CUPPJ       -------------F------VARTEEEAQAKAKAA-------------------------
SYV_RALSO       -------------Y------VARTEEEARAQAAAK-------------------------
SYV_AROAE       -------------W------VAHDEAEAKSLAAKD-------------------------
SYV_DECAR       -------------F------VAHSEAEAKAEAAKQ-------------------------
SYV_FUSNN       -------------F------VAMDEAEAKEQAKKHY------------------------
SYV_BDEBA       -------------T------VAETDVTACEK-----------------------------
SYV_GLUOX       -------------Y------VAENEQDAQVQA----------------------------
SYV_RHOS4       FNHADPTHHCAFDF------EGVSEKFLDDLASLPHPLNNARVVEVASRAEAIDRLAQA-
SYV_RUEPO       -------------F------CAASEQDALLLAQNYYGANVEVDFDSGPEELSGGIAFGTI
SYV_SPHEL       -------------Y------VAETEEEAQAEA----------------------------
SYV_ZYMMO       -------------I------VAENEESAQEKA----------------------------
SYV_CAUVC       -------------F------VEESEEAAYAAARAQF------------------------
SYV_NITWN       -------------F------VAETEDEAIGHALGYYVEQGVITA----------------
SYV_BRADU       -------------F------VAETEEEAISHALGYYVEQEVITA----------------
SYV_RHOPA       -------------F------VAETEEEAVGNALGYYVEQEVITP----------------
SYV_BARHE       -------------F------VEKSEEEALNSALSHY------------------------
SYV_BARQU       -------------F------VEKSEEEALAAAFSHY------------------------
SYV_AGRFC       -------------F------VEKTEEEALQAAIQHYIAHEGPWKAWVEEKLENF------
SYV_RHIME       -------------F------VERNEEEALHAAIQHYIAHEGPMKAYVEDLLENF------
SYV_RHILO       -------------F------VEKTEEEALSAAIEYYLALEGPWKAWVEDRLENF------
SYV_BRUME       -------------F------VEKSEAEAKAAARAHY------------------------
SYV_BRUSU       -------------F------VEKSEAEAKAAARAHY------------------------
SYV_DESPS       -------------I------VETEDPTSCPK-----------------------------
SYV_DESVH       -------------I------VSEQDPTACPD-----------------------------
SYV_GEOSL       -------------T------VAKIDPTVCAA-----------------------------
SYV_PELCD       -------------T------VSREDPTACSH-----------------------------
SYV_DEHM1       -------------I------VSKEDPTACPK-----------------------------
SYV_DEHMC       -------------I------VAKVDPTVCPK-----------------------------
SYV_SYMTH       -------------T------VSETDPTRCEK-----------------------------
SYV_LACCA       -------------Y------VGMEAPK---------------------------------
SYV_LACAC       -------------Y------VGEEAPK---------------------------------
SYV_LACJO       -------------Y------VGLEAPK---------------------------------
SYV_STAS1       -------------F------VGEHEPE---------------------------------
SYV_STAAR       -------------Y------VGEEAP----------------------------------
SYV_STAAC       -------------Y------VGEEAP----------------------------------
SYV_STAAN       -------------Y------VGEEAP----------------------------------
SYV_STAAS       -------------Y------VGEEAP----------------------------------
SYV_STAAW       -------------Y------VGEEAP----------------------------------
SYV_STAAM       -------------Y------VGEEAP----------------------------------
SYV_STAEQ       -------------F------VGEEAPE---------------------------------
SYV_STAES       -------------F------VGEEAPE---------------------------------
SYV_STAHJ       -------------Y------VGEEAPK---------------------------------
SYV_LACPL       -------------Y------VGVDGPK---------------------------------
SYV_LACSS       -------------Y------VGEEAPE---------------------------------
SYV_ENTFA       -------------Y------VGMEEP----------------------------------
SYV_LACLA       -------------Y------VGEEAPE---------------------------------
SYV_STRMU       -------------Y------VGEEAPE---------------------------------
SYV_STRA5       -------------Y------VGEDAPE---------------------------------
SYV_STRA1       -------------Y------VGEDAPE---------------------------------
SYV_STRA3       -------------Y------VGEDAPE---------------------------------
SYV_STRT1       -------------Y------VGEEAPE---------------------------------
SYV_STRT2       -------------Y------VGEEAPE---------------------------------
SYV_STRP1       -------------Y------VGEEAPE---------------------------------
SYV_STRPM       -------------Y------VGEEAPE---------------------------------
SYV_STRP6       -------------Y------VGEEAPE---------------------------------
SYV_STRP3       -------------Y------VGEEAPE---------------------------------
SYV_STRP8       -------------Y------VGEEAPE---------------------------------
SYV_STRPN       -------------Y------VGEEAPE---------------------------------
SYV_STRR6       -------------Y------VGEEAPE---------------------------------
SYV_LISIN       -------------Y------VGENEPE---------------------------------
SYV_LISMF       -------------Y------VGESEPE---------------------------------
SYV_LISMO       -------------Y------VGEKEPE---------------------------------
SYV_OCEIH       -------------Y------VGKEAP----------------------------------
SYV_BACC1       -------------Y------VGTEAP----------------------------------
SYV_BACCZ       -------------Y------VGTEAP----------------------------------
SYV_BACCR       -------------Y------VGTEAP----------------------------------
SYV_BACAN       -------------Y------VGTEAP----------------------------------
SYV_BACHK       -------------Y------VGTEAP----------------------------------
SYV_BACSK       -------------Y------VGKEPP----------------------------------
SYV_BACHD       -------------Y------VGHEAPQ---------------------------------
SYV_GEOSE       -------------Y------VDHEPPK---------------------------------
SYV_GEOKA       -------------Y------VDHEPPK---------------------------------
SYV_BACLD       -------------Y------VGVEAPE---------------------------------
SYV_BACSU       -------------Y------VGLEAPE---------------------------------
SYV_THEMA       -------------N------VSEEDVEKCEK-----------------------------
SYV_CARHZ       -------------I------PSREEVKSCPK-----------------------------
SYV_CALS4       -------------T------VSREDPVKCEV-----------------------------
SYV_CLOPE       -------------M------VELEDPTKCCK-----------------------------
SYV_CLOAB       -------------I------VSEKEPKACSK-----------------------------
SYV_CLOTE       -------------I------VSLEEAKKCSK-----------------------------
                                                                            

SYV_MYCGA       --------GD--DYY-----------RDSDVLDTWFSSALWPLICF--DDGL--------
SYV_MYCGE       --------KNLQNYT-----------RSKDVLDTWFSSSLWPLICL----NW--------
SYV_MYCPN       --------TDKQNYT-----------QSTDVLDTWFSSSLWPLICL----DW--------
SYV_MYCPE       --------KNEELYV-----------RDNDVLDTWFSSGLWPITTT--------------
SYV_MYCS5       --------SPGQGWV-----------QDSDVLDTWFSSGIAAFSFF----KW------EN
SYV_MYCH2       ----------GQGWI-----------QDEDVLDTWFSSGISVFAFL----GW------PQ
SYV_MYCH7       ----------GQGWI-----------QDEDVLDTWFSSGISAFAFL----GW------PQ
SYV_MYCHJ       ----------GQGWI-----------QDEDVLDTWFSSGISAFAFL----GW------PQ
SYV_MYCMO       ----------GSNWT-----------QDQDVLDTWFSSGIAPFSFL----NW------PQ
SYV_MYCPU       ----------GPDWT-----------QDPDVLDTWFSSAIAPFSFF----GW------PN
SYV_PARUW       --------NAPEEWI-----------QDSDVLDTWFSSALWPFSTL----GW------PE
SYV_CHLPN       --------QDPDSWY-----------QDPDVLDTWFSSGLWPLTCL----GW------PD
SYV_CHLMU       --------QDPESWY-----------QDPDVLDTWFSSGLWPLTCF----GW------PE
SYV_CHLTR       --------RDPESWY-----------QDPDVLDTWFSSGLWPLTCF----GW------PD
SYV_CHLAB       --------KDPESWE-----------QDPDVLDTWFSSGLWPLTCL----GW------PD
SYV_CHLCV       --------QDPDSWY-----------QDPDVLDTWFSSGLWPLTCL----GW------PD
SYV_ONYPE       ----------GPEWS-----------LDCDVLDTWFSSALWPFSTL----GW------PN
SYV_UREPA       --------KDLENWI-----------QDEDVLDTWFSSGMWPLLTT----KW------NY
SYV_PORGI       --------LTVEDLR-----------QDSDSLDTWFSSWLWPISVF----GD---VMDPE
SYV_BACFN       --------LKMTDLR-----------QDEDCLDTWFSSWLWPISLF---DGI------NN
SYV_BACFR       --------LKMTDLR-----------QDEDCLDTWFSSWLWPISLF---DGI------NN
SYV_BACTN       --------LTMDDLR-----------QDEDCLDTWFSSWLWPISLF---DGI------NH
SYV_WIGBR       --------NKEEILT-----------QEEDVLDTWFSSAIWSFASL----GW------PQ
SYV_DEIRA       --------YAHLNLR-----------RDPDVFDTWFSSNLWPFSTL----GW------PD
SYV_THET8       --------CGSPRLK-----------RDEDVFDTWFSSALWPLSTL----GW------PE
SYV_THETH       --------CGSPRLK-----------RDEDVFDTWFSSALWPLSTL----GW------PE
SYV_THET2       --------CGSPRLK-----------RDEDVFDTWFSSALWPLSTL----GW------PE
SYV_HELPJ       --------CKSEKLE-----------QDKDVLDTWFSSGLWAFSTL----GW------GQ
SYV_HELPY       --------CKSETLE-----------QDKDVLDTWFSSGLWAFSTL----GW------GQ
SYV_CAMJE       --------CQSQNFK-----------QDEDVLDTWFSSGLWAMSTL----GW------GN
SYV_CAMJR       --------CQSQNFK-----------QDEDVLDTWFSSGLWAMSTL----GW------GN
SYV_HELHP       --------CQSTITK-----------QDEDVLDTWFSSGLWAFSTL----GW------GN
SYV_WOLSU       --------CQGSQFH-----------QDPDVLDTWFSSALWPFSTL----GW------GN
SYV_BORBU       --------NMGKRFV-----------QDPDVLDTWFSSWLWPFSSL----GW------PN
SYV_BORBP       --------NVGKRFV-----------QDPDVLDTWFSSWLWPFSSL----GW------PN
SYV_MESFL       --------KDAENWI-----------QDEDVLDTWFSSGLWPFATLMRGEGF--------
SYV_MYCMS       --------SDIENWT-----------QDQDVLDTWFSSGLWAFSTLLNNKGL--------
SYV_PELUB       --------NKDVDLI-----------RDPDVLDTWFSSGLWPFATL----GW------PD
SYV_TREDE       --------CKSKNIK-----------QDEDVLDTWFSSWLWPFSTL----GW------PE
SYV_TREPA       --------CGSADIT-----------QDPDVLDTWFSSWLWPFSTL----GW------PQ
SYV_GLOVI       --------GPDVQLQ-----------RDQDVLDTWFSSSLWPFTTL----GW------PD
SYV_PROMP       --------GSNLQLI-----------RDKDVLDTWFSSGLWPFSTL----GW------PN
SYV_PROMA       --------GTDAVLR-----------QDEDVLDTWFSSGLWPFSTL----GW------PD
SYV_PROMT       --------GDSVKIE-----------QDEDVLDTWFSSGLWPFSTL----GW------PD
SYV_PROMM       --------GEAVVIQ-----------QDEDVLDTWFSSGLWPFSTM----GW------PD
SYV_SYNPX       --------GAAAVIE-----------QDEDVLDTWFSSGLWPFSTL----GW------PD
SYV_THEEB       --------GEDIELQ-----------QDQDVLDTWFSSGLWPFSTL----GW------PD
SYV_SYNP6       --------GPDVVLQ-----------QDEDVLDTWFSSGLWPFSTL----GW------PN
SYV_NOSS1       --------GENVQLE-----------QDPDVLDTWFSSGLWPFSTL----GW------PE
SYV_SYNY3       --------GPTVQLQ-----------QDPDVLDTWFSSGLWPFSTM----GW------PE
SYV_LEPIC       --------CGSQEVE-----------PDPDVLDTWFSSQLWPFSTL----GW------PD
SYV_LEPIN       --------CGSQEVE-----------PDPDVLDTWFSSQLWPFSTL----GW------PD
SYV_STRAW       --------PTGEGWS-----------QDTDVLDTWFSSGLWPFSTL----GW------PE
SYV_STRCO       --------PSGEGWY-----------QDSDVLDTWFSSGLWPFSTL----GW------PE
SYV_CORJK       --------PTGEGWY-----------QDEDVLDTWFSSALWPFSTM----GW------PE
SYV_CORDI       --------P--AGYE-----------QDPDVLDTWFSSALWPFSTM----GW------PD
SYV_COREF       --------QAPEGYT-----------QDPDVLDTWFSSALWPFSTM----GW------PD
SYV_CORGL       --------QAPEGYV-----------QDPDVLDTWFSSALWPFSTM----GW------PE
SYV_NOCFA       --------TPPEGWV-----------QDPDVLDTWFSSGLWPFSTM----GW------PD
SYV_MYCLE       --------TPPEGWQ-----------QDPDVLDTWFSSALWPFSTL----GW------PQ
SYV_MYCBO       --------TPPQGWE-----------QDPDVLDTWFSSALWPFSTL----GW------PD
SYV_MYCTU       --------TPPQGWE-----------QDPDVLDTWFSSALWPFSTL----GW------PD
SYV_MYCPA       --------TPPEGWE-----------QDPDVLDTWFSSALWPFSTL----GW------PE
SYV_BUCBP       --------SDDIFLI-----------QETDVLDTWFSSSLWMFSSL----GW------PN
SYV_BLOFL       --------NKDIQLS-----------QDNNVLDTWFSSSLWTFSSL----GW------PK
SYV_BLOPB       --------NNNVILH-----------REKDVLDTWFSSSLWTFAAL----GW------PK
SYV_BUCAI       --------SENVLLK-----------QENDVLDTWFSSGLWTFSSL----GW------PK
SYV_BUCAP       --------SDDMILN-----------QDNDVLDTWFSSGLWTFSTL----GW------PE
SYV_FRATT       --------ADDIAIK-----------QDEDVFDTWFSSALWPFSTL----GW------PE
SYV_COXBU       --------SPDVKLQ-----------QETDVLDTWFSASLWPFATL----GW------PE
SYV_XYLFA       --------GPEVTLT-----------QDNDVLETWFSSQLWPFSTL----GW------PD
SYV_XYLFT       --------GPEVTLT-----------QDNDVLETWFSSQLWPFSTL----GW------PD
SYV_XANC8       --------GAEVALH-----------QDSDVLETWFSSQLWPFSTL----GW------PD
SYV_XANCP       --------GAEVALH-----------QDSDVLETWFSSQLWPFSTL----GW------PD
SYV_XANOR       --------GAEIALH-----------QDSDVLETWFSSQLWPFSTL----GW------PD
SYV_XANC5       --------GADVALH-----------QDSDVLETWFSSQLWPFSTL----GW------PD
SYV_XANAC       --------GAEIALH-----------QDSDVLETWFSSQLWPFSTL----GW------PD
SYV_LEGPA       --------DQSTPLK-----------QDEDVLDTWFSSALWPFSTL----GW------PE
SYV_LEGPH       --------DQSTPLK-----------QDEDVLDTWFSSALWPFSTL----GW------PE
SYV_LEGPL       --------DQSTPLK-----------QDEDVLDTWFSSALWPFSTL----GW------PE
SYV_METCA       --------DASIPLR-----------QDEDVLDTWFSSALWPFSTL----GW------PE
SYV_NITOC       --------PPDLPLE-----------QDPDVLDTWFSSALWPFSTL----GW------PE
SYV_ACIAD       --------AADLALQ-----------QDEDVLDTWFSSGLWTFSTL----GWTGDAKKDA
SYV_PSYA2       --------AADVKLR-----------QDDDVLDTWFSSGLWTFSTL----DW---ADVNA
SYV_PSEAE       --------GNEAELR-----------QDEDVLDTWFSSGLWTFSTL----GW------PQ
SYV_PSEPK       --------GADVVLR-----------QDDDVLDTWFSSGLWTFSTL----GW------PE
SYV_PSEF5       --------GPDVALQ-----------QDNDVLDTWFSSGLWTFSTL----GW------PE
SYV_PSESM       --------GPEIALQ-----------QDNDVLDTWFSSGLWTFSTL----GW------PE
SYV_PSE14       --------GPEIALQ-----------QDNDVLDTWFSSGLWTFSTL----GW------PE
SYV_PSEU2       --------GPEVALQ-----------QDNDVLDTWFSSGLWTFSTL----GW------PE
SYV_IDILO       --------LGDTPLQ-----------QDEDVLDTWFSSALWTFSTL----GW------PK
SYV_MANSM       --------NSSVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PQ
SYV_PASMU       --------PADLALK-----------QDEDVLDTWFSSGLWTFSTL----GW------PK
SYV_HAEDU       --------PLDLPLT-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_HAEI8       --------DSAVELK-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_HAEIN       --------DSAVELK-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_COLP3       --------AADMKLR-----------QDDDVLDTWFSSALWTFSTL----GW------PK
SYV_PHOPR       --------ASVVVLR-----------QDDDVLDTWFSSALWTFGTQ----GW------PE
SYV_ALIF1       --------APVVVLR-----------QDDDVLDTWFSSALWTFGTQ----GW------PE
SYV_VIBCH       --------AADVALR-----------QDDDVLDTWFSSALWTFGTL----GW------PE
SYV_VIBVU       --------ESVIELH-----------QDEDVLDTWFSSALWTFGTQ----GW------PE
SYV_VIBVY       --------ESVIELH-----------QDEDVLDTWFSSALWTFGTQ----GW------PE
SYV_VIBPA       --------ESVIELH-----------QDEDVLDTWFSSALWTFGTQ----GW------PE
SYV_PHOLL       --------GTDISLN-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_YERPE       --------GAEVALR-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_YERPS       --------GAEVALR-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_PECAS       --------ADDVVLN-----------QDEDVLDTWFSSGLWTFSTL----GW------PE
SYV_SHIDS       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_ECOL6       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_ECOLI       --------GADVVLR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_ECO57       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SHIBS       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SHISS       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SHIFL       --------GANVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SALPA       --------GADVQLR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SALTI       --------GADVQLR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SALCH       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_SALTY       --------GADVALR-----------QDEDVLDTWFSSALWTFSTL----GW------PE
SYV_PSEHT       --------ADSVTLS-----------QDEDVLDTWFSSALWTFSTQ----GW------PA
SYV_SHEON       --------DDAIALR-----------QDEDVLDTWFSSALWTFSTL----GW------PD
SYV_CHRVO       --------AGGKTLR-----------REQDVLDTWFSSALVPFSTL----GW------PE
SYV_NEIG1       --------AGKTGLT-----------REEDVLDTWFSSALVPFSTL----GW------PS
SYV_NEIMA       --------AGKTGLT-----------REEDVLDTWFSSALVPFSTL----GW------PS
SYV_NEIMB       --------AGKTGLT-----------REEDVLDTWFSSALVPFSTL----GW------PS
SYV_NITEU       --------SGKEILR-----------QDDDVLDTWFSSALWPFSTL----GW------PE
SYV_THIDA       --------AGGRELT-----------QDNDVLDTWFSSALWPFSTL----GW------PE
SYV_BORPE       --------GVSGPLT-----------RDPDILDTWFSSALVPFTTF----GW------PE
SYV_BORBR       --------GVAGPLT-----------RDPDVLDTWFSSALVPFTTF----GW------PE
SYV_BORPA       --------GVAGPLT-----------RDPDVLDTWFSSALVPFTTF----GW------PE
SYV_BURMA       --------GYTGALK-----------RDDDVLDTWFSSALVPFSSL----GW------PN
SYV_BURPS       --------GYTGALK-----------RDDDVLDTWFSSALVPFSSL----GW------PN
SYV_CUPPJ       --------GSTGALR-----------REEDVLDTWFSSALVPFSSL----GW------PE
SYV_RALSO       --------GHTGAIK-----------RDDDVLDTWFSAALVPFSSL----GW------PA
SYV_AROAE       --------GFTGRLR-----------RDDDVLDTWYSSALWPFSTL----DW-TA-EWPE
SYV_DECAR       --------GYTGTLK-----------RDEDVLDTWFSSALWPFSTL----DW-TGDEAID
SYV_FUSNN       --------GHDVELS-----------QEEDVLDTWFSSALWPFSTM----GW------PE
SYV_BDEBA       --------CGSTKLH-----------QDDDVLDTWFSSALWPFSTM----GW------PN
SYV_GLUOX       --------GEGVSLT-----------QDEDVLDTWFSSALWPFTTL----GW------PD
SYV_RHOS4       --------LADYNLNEDPTHLVYPVWRDPDVLDTWFSSGLWPIGTL----GW------PE
SYV_RUEPO       EGPGGQKTLQSVSLT-----------RDPDVLDTWFSSGLWPIGTL----GW------PE
SYV_SPHEL       --------GEGVALT-----------RDPDVLDTWFSSALWPFATL----GW------PE
SYV_ZYMMO       --------GQGVNLR-----------RDPDVLDTWFSSALWPFATL----GW------PD
SYV_CAUVC       --------GADVQLT-----------QDEDVLDTWFSSALWPFSTL----GW------PE
SYV_NITWN       --------EQGAGMARDPAKRDGFITRDEDVLDTWFSSALWPFSTL----GW------PD
SYV_BRADU       --------EQGREMALDRNKREGFITRDEDVLDTWFSSALWPFSTL----GW------PE
SYV_RHOPA       --------AQAHDMAEDPAKREGFITRDEDVLDTWFSSALWPFSTL----GW------PD
SYV_BARHE       --------GEVVNLT-----------RDPDVLDTWFSSALWPFSTL----GW------PN
SYV_BARQU       --------GEEVELT-----------RDQDVLDTWFSSALWPFSTL----GW------PN
SYV_AGRFC       --------APGEILT-----------RDEDVLDTWFSSALWPFSTL----GW------PE
SYV_RHIME       --------KPGEILT-----------RDEDVLDTWFSSALWPFSTL----GW------PK
SYV_RHILO       --------QPGEILT-----------RDEDVLDTWFSSALWPFSTL----GW------PD
SYV_BRUME       --------GEDVALE-----------RDTDVLDTWFSSALWPFSTL----GW------PD
SYV_BRUSU       --------GEDVALE-----------RDTDVLDTWFSSALWPFSTL----GW------PD
SYV_DESPS       --------CGSSKLS-----------QETDVLDTWFSSALWPFSTM----GW------PE
SYV_DESVH       --------CGCTDLT-----------QDPDVLDTWFSSALWPFSTM----GW------PD
SYV_GEOSL       --------CGSDEIR-----------QETDVLDTWFSSALWPFSTM----GW------PD
SYV_PELCD       --------CGATELR-----------QETDVLDTWFSSALWPFSTM----GW------PD
SYV_DEHM1       --------CGSTKLE-----------QDPDVLDTWFSSGLWPHSTL----GW------PD
SYV_DEHMC       --------CGGTELE-----------QDPDVLDTWFSSGLWPHSTL----GW------PD
SYV_SYMTH       --------CGSANIR-----------QDEDALDTWFSSALWPFSTL----GW------PD
SYV_LACCA       ---------DIENWK-----------QDPDVLDTWFSSALWPFSTM----GW------PN
SYV_LACAC       ---------DIENWE-----------QDPDVLDTWFSSALWPFSTM----GW------PD
SYV_LACJO       ---------DSENWE-----------QDPDVLDTWFSSALWPFSTL----GW------PD
SYV_STAS1       ---------DIENWV-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAAR       --------TDIENWQ-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAAC       --------TDIENWQ-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAAN       --------TDIENWQ-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAAS       --------TDIENWQ-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAAW       --------TDIENWQ-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAAM       --------TDIENWQ-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAEQ       ---------DIENWI-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAES       ---------DIENWI-----------QDEDVLDTWFSSALWPFSTL----GW------PD
SYV_STAHJ       ---------DIDNWV-----------QDEDVLDTWFSSALWPFSTL----GW------PN
SYV_LACPL       ---------DPENWE-----------QDPDVLDTWFSSALWPFSTM----GW------PN
SYV_LACSS       ---------DIENWT-----------QDSDVLDTWFSSALWPFSTM----GW------PN
SYV_ENTFA       --------ADSENWV-----------QDSDVLDTWFSSALWPFSTM----GW------PN
SYV_LACLA       ----------GEGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRMU       ----------GDGWK-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRA5       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRA1       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRA3       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRT1       ----------GDGWK-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRT2       ----------GDGWK-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRP1       ----------GDDWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRPM       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRP6       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRP3       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRP8       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_STRPN       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PE
SYV_STRR6       ----------GDGWT-----------QDEDVLDTWFSSALWPFSTM----GW------PE
SYV_LISIN       ---------NLDQWE-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_LISMF       ---------NLSEWE-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_LISMO       ---------NLSEWE-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_OCEIH       --------ADIENWE-----------QDEDVLDTWFSSALWPFSTM----GW------PN
SYV_BACC1       --------ADIENWN-----------QDNDVLDTWFSSALWPFSTL----GW------PN
SYV_BACCZ       --------ADIENWN-----------QDNDVLDTWFSSALWPFSTL----GW------PN
SYV_BACCR       --------ADIENWN-----------QDNDVLDTWFSSALWPFSTL----GW------PN
SYV_BACAN       --------ADIENWN-----------QDNDVLDTWFSSALWPFSTL----GW------PN
SYV_BACHK       --------ADIENWN-----------QDNDVLDTWFSSALWPFSTL----GW------PN
SYV_BACSK       --------RDSENWR-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_BACHD       ---------DIDNWK-----------QDEDVLDTWFSSALWPFSTM----GW------PD
SYV_GEOSE       ---------DIENWE-----------QDPDVLDTWFSSALWPFSTM----GW------PD
SYV_GEOKA       ---------DIENWE-----------QDPDVLDTWFSSALWPFSTM----GW------PD
SYV_BACLD       ---------DAENWE-----------QDKDVLDTWFSSALWPFSTM----GW------PD
SYV_BACSU       ---------DSENWE-----------QDTDVLDTWFSSALWPFSTM----GW------PD
SYV_THEMA       --------CGSTNLK-----------QDEDVLDTWFSSALWPFSTL----GW------PE
SYV_CARHZ       --------CQSTKVH-----------QDPDVLDTWFSSALWPFSTL----GW------PQ
SYV_CALS4       --------CGSTNIH-----------QDENVLDTWFSSALWPFSTM----GW------PE
SYV_CLOPE       --------CGSENIE-----------QDKDVLDTWFSSALWPFSTL----GW------PD
SYV_CLOAB       --------CNSENLE-----------QDKDVLDTWFSSALWPFSTL----GW------PD
SYV_CLOTE       --------CSSENLI-----------QDEDVLDTWFSSALWPFSTL----GW------PD
                                           . : ::**:*: :                    

SYV_MYCGA       ----DQ-K---------EFNANFPNSLLVTAYDIVFFWVLRMIFMSW-------LLKKS-
SYV_MYCGE       -------E---------QDDSFHETELLVTGYDILFFWVLRMLFNSF-------FETKK-
SYV_MYCPN       -------H---------KNKHFVPTDLLVTGYDILFFWVLRMTFNSY-------FQTKQ-
SYV_MYCPE       ----DALK---------SKDALFPTNVLVTGFDIIFFWVFRMMFFSL-------YLKKE-
SYV_MYCS5       ----DD-A---------FFKRYYPSSLMVSGYDLIFFWISRMIFLSL-------EFTNQ-
SYV_MYCH2       ----NF-D---------LIKSYFPTSLLVTGWDILFFWVARMYFSSL-------FIMKQ-
SYV_MYCH7       ----NF-D---------LIKSYFPTSLLVTGWDILFFWVARMYFSSL-------FIMKQ-
SYV_MYCHJ       ----NF-D---------LIKSYFPTSLLVTGWDILFFWVARMYFSSL-------FIMKQ-
SYV_MYCMO       ----KS-E---------FLKRYYPTSVIVTAYDIIFFWVARMYFMGI-------YSMKN-
SYV_MYCPU       ----TY-K---------KLKRYYPTSLLVTGHDIIFFWVSRMYFSGL-------YFMKD-
SYV_PARUW       ----QT-S---------ELAKFYPTSVLVTGHDILFFWVARMILMGD-------YALDQ-
SYV_CHLPN       ----ENSP---------DLKKFYPTALLVTGHDILFFWVTRMVLLCS-------SMSGE-
SYV_CHLMU       ----ES-A---------DLRKFYPTSVLVTGHDILFFWVTRMVLMCS-------AMVDT-
SYV_CHLTR       ----ENSL---------DLKKFYPTAVLVTGHDILFFWVTRMVLMCS-------AMVDT-
SYV_CHLAB       ----SECG---------DLEKFYPTAVLVTGHDILFFWVTRMVLLCS-------AMVGK-
SYV_CHLCV       ----VESG---------DLEKFYPTAVLITGHDILFFWVTRMVLLCS-------AMVEE-
SYV_ONYPE       ----CNAP---------LFQNRFPTDVLVTGYDILTFWVSKMVFQSI-------LLTHK-
SYV_UREPA       ----NS-H---------FFDRYFPTSLIVTGMDILFFWVSRMMNFSQ-------YLVEK-
SYV_PORGI       ----NE-----------ELDYYYPTSDLVTAPDILFFWVARMIMAGY-------EYRGK-
SYV_BACFN       ----PGNE---------EINYYYPTSDLVTGPDIIFFWVARMIMAGY-------EYEGK-
SYV_BACFR       ----PGNE---------EINYYYPTSDLVTGPDIIFFWVARMIMAGY-------EYEGK-
SYV_BACTN       ----PGNE---------EISYYYPTSDLVTGPDIIFFWVARMIMVGY-------EYEGK-
SYV_WIGBR       ----KS-I---------KFDTFHPTNLIISGFDIIYFWISRMIMLTM-------YIIKD-
SYV_DEIRA       ----TDSE---------DFRKFYPTQVLVTGYDILFFWVARMQMAGY-------GLTGQ-
SYV_THET8       ----ET-E---------DLKAFYPGDVLVTGYDILFLWVSRMEVSGY-------HFMGE-
SYV_THETH       ----ET-E---------DLKAFYPGDVLVTGYDILFLWVSRMEVSGY-------HFMGE-
SYV_THET2       ----ET-E---------DLKAFYPGDVLVTGYDILFLWVSRMEVSGY-------HFMGE-
SYV_HELPJ       ----EKSD----LFNESDLKDFYPNTTLITGFDILFFWVARMLFCSE-------SLLGE-
SYV_HELPY       ----EKSG----LFNESDLKDFYPNTTLITGFDILFFWVARMLFCSE-------SLLGE-
SYV_CAMJE       ----ENWG-KDKIWSEKDLKDFYPNSLLITGFDILFFWVARMMFQST-------NVLHQ-
SYV_CAMJR       ----ENWG-KDKIWSEKDLKDFYPNSLLITGFDILFFWVARMMFQST-------NVLHQ-
SYV_HELHP       ----EDTNTQPPLYHANDLAEFYPNSLLITGFDILFFWVARMILSGE-------SLLDS-
SYV_WOLSU       ----GEAG-KGSWWREEDLQEFYPNSLLITGFDILFFWVARMLMMGE-------HFLDN-
SYV_BORBU       ----VD-V---------DFKNYYPTNTLITAYDIIFFWVARMVMAGL-------EFTGQ-
SYV_BORBP       ----IT-V---------DFENYYPTKTLITAYDIIFFWVARMVMAGL-------EFTGQ-
SYV_MESFL       ----ES-K---------YFKEYLPNGVLVTGHDIIFSWVSRMIFQTI-------EYTGQ-
SYV_MYCMS       ----ES-E---------YFKNYFPTSVLVTGYDIIFFWVARMIFQTL-------EYTKQ-
SYV_PELUB       ----NK-E---------YVDKFYPTSVLVTGFDIIFFWVARMIMFGM-------EFLDK-
SYV_TREDE       ----KT-E---------DLARFFPTSALVTGHDIIFFWVARMIMASL-------QFTGK-
SYV_TREPA       ----ET-Q---------KLRAFYPTSAVITAYDIIFFWVARMIMAGL-------EFTQT-
SYV_GLOVI       ----QT-E---------DLGVFYPNALMSTGFDIIFFWVARMAMMAG-------EFTGQ-
SYV_PROMP       ----INDA---------DFKKWYPNSVLITGFDIIFFWVARMTMMGK-------TFTNN-
SYV_PROMA       ----KTNA---------DLSRWYPTNTLVTGFDIIFFWVARMTMMAG-------AFTGK-
SYV_PROMT       ----ETHP---------DFQRWYPTNTLVTGFDIIFFWVARMTMMAG-------VFTER-
SYV_PROMM       ----QESA---------DLECWYPTSTLVTGFDIIFFWVARMTMMAG-------AFTGR-
SYV_SYNPX       ----AESA---------DLQRWYPTSTLVTGFDIIFFWVARMTMMAG-------AFTGE-
SYV_THEEB       ----DT-P---------DYRRYYPNTTLVTGFDIIFFWVARMTMMGQ-------YFTGK-
SYV_SYNP6       ----QT-E---------DLETFYPTSTLVTGFDIIFFWVARMTMMAG-------HFTGK-
SYV_NOSS1       ----QT-P---------DLAKYYPTTTLVTGFDIIFFWVARMTMMAG-------HFTGQ-
SYV_SYNY3       ----QT-D---------DLAKYYPTSTLVTGFDIIFFWVARMTMMAG-------HFTGQ-
SYV_LEPIC       ----QT-E---------DLKRYYPTSVLVTGFDIIFFWVSRMIMMGM-------KFMQA-
SYV_LEPIN       ----QT-E---------DLKRYYPTSVLVTGFDIIFFWVSRMIMMGM-------KFMQA-
SYV_STRAW       ----QT-E---------SLAKFYPNSVLVTGYDILFFWVARMMMFGL-------YAMDG-
SYV_STRCO       ----QT-E---------SLAKFYPNSVLVTGYDILFFWVARMMMFGL-------YAMDG-
SYV_CORJK       ----KT-P---------ELEKFYPTSVLVTGYDILFFWVARMMMFATFASKHTPEILGT-
SYV_CORDI       ----KT-P---------ELDKFYPTSVLVTAYDILFFWVARMMMFGTLAGETTPEILGQ-
SYV_COREF       ----KT-P---------ELDKFYPTSVLVTAYDILFFWVARMMMFGTFAAKETPELLGE-
SYV_CORGL       ----KT-P---------ELEKFYPTSVLVTAYDILFFWVARMMMFGTFAAKETPELLGE-
SYV_NOCFA       ----AT-P---------ELTKFYPTSVLVTGYDILFFWVARMMMFGM-------YVAEDP
SYV_MYCLE       ----MT-P---------ELEKFYPTSILVTGYDILFFWVARMMMLGT-------FVGGD-
SYV_MYCBO       ----KT-A---------ELEKFYPTSVLVTGYDILFFWVARMMMFGT--------FVGDD
SYV_MYCTU       ----KT-A---------ELEKFYPTSVLVTGYDILFFWVARMMMFGT--------FVGDD
SYV_MYCPA       ----KT-P---------ELEKFYPTSVLVTGYDILFFWVARMMMFGT-------FVGDD-
SYV_BUCBP       ----NK-D---------LFKNFYSTDVVVSGFDIIFFWIARMIMLSM-------HLIKD-
SYV_BLOFL       ----NN-T---------LLKMFHPTNIIISGFDIIFFWIARMIMMTM-------YLVKD-
SYV_BLOPB       ----NT-N---------LLNVFHPTNIIISGFDIIFFWIARMIMLTM-------HFIKN-
SYV_BUCAI       ----KT-T---------FLKTFHPTNVLVSGFDIIFFWIARMIMLTM-------YFMKD-
SYV_BUCAP       ----KT-E---------FLKIFHSTDVLVSGFDIIFFWIARMIMLTM-------YLVKD-
SYV_FRATT       ----QT-P---------ELAKYYPTSVLVTGFDIIFFWVARMMMFGM-------YFMND-
SYV_COXBU       ----KT-E---------SFKTFYPTQVLVTGFDIIFFWVARMVMMGL-------KLTHK-
SYV_XYLFA       PTAMAE-H---------GYARYLPSSVLVTGFDIIFFWVARMIMATD-------HFTGN-
SYV_XYLFT       PMAMAE-R---------GFERYLPSSVLVTGFDIIFFWVARMIMATD-------HFTGN-
SYV_XANC8       AQAMDE-R---------GFARYLPSSVLVTGFDIIFFWVARMIMATD-------SFTGQ-
SYV_XANCP       AQAMDE-R---------GFARYLPSSVLVTGFDIIFFWVARMIMATD-------SFTGQ-
SYV_XANOR       SQAMAE-R---------GFARYLPSSVLVTGFDIIFFWVARMIMATD-------SFTGQ-
SYV_XANC5       AQAMAE-R---------GFARYLPSSVLVTGFDIIFFWVARMIMATD-------SFTGQ-
SYV_XANAC       AQAMAE-R---------GFGRYLPSSVLVTGFDIIFFWVARMIMATD-------SFTGQ-
SYV_LEGPA       ----RT-P---------ELEQFYPTSVLVTGFDIIFFWVARMIMMGL-------KFTGK-
SYV_LEGPH       ----RT-P---------ELEQFYPTSVLVTGFDIIFFWVARMIMMGL-------KFTGK-
SYV_LEGPL       ----RT-P---------ELEQFYPTSVLVTGFDIIFFWVARMIMMGL-------KFTGK-
SYV_METCA       ----RK-P---------ELDTFYPTSVLVTGFDIIFFWVARMIMMGL-------KFMGD-
SYV_NITOC       ----DT-S---------LLRAFYPTSVLVTGFDIIFFWVARMIMMGL-------KFTGE-
SYV_ACIAD       ----EN-Y---------FLNTFHPTDVLVTGFDIIFFWVARMIMMTM-------HFMKN-
SYV_PSYA2       ----DP-R---------VMETFHPTSVLVTGFDIIFFWVARMIMMTM-------HFVKN-
SYV_PSEAE       ----QT-E---------FLKTFHPTDVLVTGFDIIFFWVARMIMLTM-------HLVKN-
SYV_PSEPK       ----QT-E---------FLKKFHSTDVLVTGFDIIFFWVARMIMLTM-------HLIKN-
SYV_PSEF5       ----QT-D---------FLKTFHPTDVLVTGFDIIFFWVARMIMLTM-------HLVKN-
SYV_PSESM       ----KT-K---------ALETFHSTDVLVTGFDIIFFWVARMIMLTL-------HLVKN-
SYV_PSE14       ----KT-K---------ALETFHSTDVLVTGFDIIFFWVARMIMLTM-------HLVKN-
SYV_PSEU2       ----KT-K---------ALKTFHSTDVLVTGFDIIFFWVARMIMLTM-------HLVKN-
SYV_IDILO       ----NT-E---------DLKTFHPTDVLVTGFDIIFFWVARMIMMTM-------HFMKD-
SYV_MANSM       ----QT-K---------ELAMFHPTNVLITGFDIIFFWVARMIMMTM-------HFIKD-
SYV_PASMU       ----QT-P---------DLKMFHSTDVLITGFDIIFFWVARMIMFTM-------HFVKD-
SYV_HAEDU       ----QT-K---------ELKMFHTTDVLITGFDIIFFWVARMIMFTM-------HFIKD-
SYV_HAEI8       ----QT-K---------ELKMFHPTDVLITGFDIIFFWVARMIMFTM-------HFVKD-
SYV_HAEIN       ----QT-K---------ELKMFHPTDVLITGFDIIFFWVARMIMFTM-------HFVKD-
SYV_COLP3       ----DT-E---------DLKTFHPTDVLVTGFDIIFFWVARMIMMTM-------HFNKD-
SYV_PHOPR       ----NT-D---------ALKTFHPSEVLVSGFDIIFFWVARMIMMTM-------HFVKD-
SYV_ALIF1       ----NT-D---------ALKTFHPSEVLVSGFDIIFFWVARMIMMTM-------HFVKD-
SYV_VIBCH       ----KT-P---------ELKVFHPTDVLVTGFDIIFFWVARMIMMTM-------HFCKD-
SYV_VIBVU       ----QT-D---------DLKVFHPSDVLVTGFDIIFFWVARMIMMTM-------HFVKD-
SYV_VIBVY       ----QT-D---------DLKVFHPSDVLVTGFDIIFFWVARMIMMTM-------HFVKD-
SYV_VIBPA       ----QT-D---------DLKVFHPSDVLVTGFDIIFFWVARMIMMTM-------HFVKD-
SYV_PHOLL       ----QT-D---------ALKTFHPTDVLVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_YERPE       ----QT-D---------ALKTFHPTSVVVSGFDIIFFWIARMIMLTM-------HFMKD-
SYV_YERPS       ----QT-D---------ALKTFHPTSVVVSGFDIIFFWIARMIMLTM-------HFMKD-
SYV_PECAS       ----QT-P---------DLKSFHPSSVMVSGFDIIFFWIARMIMLTM-------HFIKD-
SYV_SHIDS       ----NT-D---------ALRQFHPSSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_ECOL6       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_ECOLI       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_ECO57       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SHIBS       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SHISS       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SHIFL       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SALPA       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SALTI       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SALCH       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_SALTY       ----NT-D---------ALRQFHPTSVMVSGFDIIFFWIARMIMMTM-------HFIKD-
SYV_PSEHT       ----NT-D---------DLKTFHPSDVLVTGFDIIFFWVARMIMMTL-------HFIKD-
SYV_SHEON       ----NV-E---------DLKTFHPTDVLVTGFDIIFFWVARMIMMTM-------HFIKD-
SYV_CHRVO       ----ET-P---------DLKAFLTSNVLVTGYEIIFFWVARMIMMTK-------HFTGK-
SYV_NEIG1       ----ET-D---------ELKAFLPSNVLVTGYEIIFFWVARMIMMTT-------HFTGK-
SYV_NEIMA       ----ET-D---------ELKAFLPSNVLVTGYEIIFFWVARMIMMTT-------HFTGK-
SYV_NEIMB       ----ET-D---------ELKAFLPSNVLVTGYEIIFFWVARMIMMTT-------HFTGK-
SYV_NITEU       ----QT-P---------ELKTFLPGSVLVTGFDIIFFWVARMVMMSL-------HFTGE-
SYV_THIDA       ----QT-P---------ELERYLPTSVLVTGFDIIFFWVARMVMMSK-------HLTGK-
SYV_BORPE       ----DT-P---------DLRRYLPSSVLVTGFDIIFFWVARMVMLTM-------HMTGS-
SYV_BORBR       ----DT-P---------DLRRYLPSSVLVTGFDIIFFWVARMVMLTM-------HMTGS-
SYV_BORPA       ----DT-P---------DLRRYLPSSVLVTGFDIIFFWVARMVMLTM-------HMTGS-
SYV_BURMA       ----ET-P---------EMKHFLPSSVLVTGFDIIFFWVARMVMMTT-------HFTGK-
SYV_BURPS       ----ET-P---------EMKHFLPSSVLVTGFDIIFFWVARMVMMTT-------HFTGK-
SYV_CUPPJ       ----ET-P---------ELKHFLPSSVLVTGYDIIFFWVARMVMMTK-------HFTGQ-
SYV_RALSO       ----DT-P---------ELKHFLPSTVLVTGYDIIFFWVARMVMMTL-------HFTGE-
SYV_AROAE       ----KSND---------ALDLYLPSSVLVTGFDIIFFWVARMVMMTK-------HITGK-
SYV_DECAR       ----AANP---------LLKQYLPSSVLVTGFDIIFFWVARMVMMTK-------QITGQ-
SYV_FUSNN       ----KT-K---------ELDLFYPTNTLVTGADIIFFWVARMIMFGM-------YELKK-
SYV_BDEBA       ----ET-E---------TLKTFYPTSYLVTGHDIIFFWVARMIMMGL-------EFQRD-
SYV_GLUOX       ----RT-E---------ELARYYPTSVLVTGFDIIFFWVARMMMMGL-------HFMDD-
SYV_RHOS4       ----ET-P---------ELARYFPTNVLITGFDIIFFWVARMMMMQL-------AVVNE-
SYV_RUEPO       ----DT-D---------EMRRYFPTSVLITGFDILFFWVARMMMMQL-------AVVDQ-
SYV_SPHEL       ----NSDP---------TLGGRYSNDVLISGFDILFFWDARMMMQGL-------HFMKE-
SYV_ZYMMO       ----TD-P---------KALGRYPNDVLISGFDILFFWDARMIMQGL-------HFMKD-
SYV_CAUVC       ----KT-S---------DLERFYPTSTLVTGFDIIFFWVARMMMMGI-------HFMGE-
SYV_NITWN       ----ET-P---------EVRRYYPTNVLVTGFDIIFFWVARMMMMGI-------HFMKE-
SYV_BRADU       ----DA-P---------EVQRYYPTNALVTGFDIIFFWVARMMMMGL-------HFMKE-
SYV_RHOPA       ----ET-P---------ELDRYYPTNVLVTGFDIIFFWVARMMMMGL-------HFMDD-
SYV_BARHE       ----KT-P---------ELATFYPTSLSVTGFDIIFFWVARMMMMGL-------HFMGE-
SYV_BARQU       ----KT-T---------ELDTFYPTSLSVTGFDIIFFWVARMMMMGL-------HFMGE-
SYV_AGRFC       ----QT-P---------ELARYYPTNVLVTGFDIIPFWVVRMMQMGL-------HFMKD-
SYV_RHIME       ----ET-P---------ELDKYYQTDVLVTGFDIIFFWVARMMMMGL-------HFMKD-
SYV_RHILO       ----QT-P---------ELKTYYQTDVLVTGFDIIFFWVARMMMMGL-------HFMDE-
SYV_BRUME       ----KT-P---------ELATYYPTSVLVTGFDILFFWVARMMMMGL-------HFMEE-
SYV_BRUSU       ----KT-P---------ELATYYPTSVLVTGFDILFFWVARMMMMGL-------HFMEE-
SYV_DESPS       ----NT-K---------ELQTFYPTSVLITSFDILFFWVARMMMMGL-------HLMDE-
SYV_DESVH       ----KT-K---------DLATFYPTSVLVTGFDILFFWVARMMMLGM-------HFMDE-
SYV_GEOSL       ----RT-P---------ELAAFYPTSCLVTGFDILFFWVARMMMMGL-------HFMNE-
SYV_PELCD       ----KT-V---------ALEKFYPTSCLVTGFDILFFWVARMMMMGL-------KFMGQ-
SYV_DEHM1       ----QT-E---------DLKRFYPGSVLETAYDIIFFWVARMIVMGI-------EDMKE-
SYV_DEHMC       ----QT-E---------DLKRFYPGTVMETAYDIIFFWVARMIVMGM-------EDMNE-
SYV_SYMTH       ----DT-A---------DLRYFFPTDVLVTGYDILFFWVARMIFSSL-------ELTGK-
SYV_LACCA       ----TDAP---------DYKRYYPTDTLVTGYDIIPFWVARMIFQGL-------HFTHQ-
SYV_LACAC       ----TDNP---------DFKRYFPTNALVTGYDIIFFWVSRMIFQSL-------HFTKE-
SYV_LACJO       ----ENSE---------DFKRYFPTNTLVTGYDIIFFWVSRMIFQSL-------HFTGK-
SYV_STAS1       ----VEAD---------DFQRYFPTNALVTGYDIIFFWVARMIFQGL-------EFTGK-
SYV_STAAR       ----LESE---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAAC       ----LESE---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAAN       ----LESE---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAAS       ----LESE---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAAW       ----LESE---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAAM       ----LESE---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAEQ       ----TNAD---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAES       ----TNAD---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_STAHJ       ----IDAD---------DFKRYYPTNALVTGYDIIFFWVARMIFQGL-------EFTDR-
SYV_LACPL       ----TDAE---------DFKRYFPTNTLVTGYDILPFWVSRMIFQSL-------EFTGR-
SYV_LACSS       ----TEAP---------DFKRYFPTNTLVTGYDIIFFWVSRMIFQSL-------EFTEQ-
SYV_ENTFA       ----EASE---------DYQRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGE-
SYV_LACLA       ----ENSA---------DFIRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGK-
SYV_STRMU       ----TDSE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGC-
SYV_STRA5       ----TEAA---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRA1       ----TEAA---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRA3       ----TEAA---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRT1       ----VDSE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRT2       ----VDSE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRP1       ----TDVE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRPM       ----TDVE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRP6       ----TDSE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTER-
SYV_STRP3       ----TDVE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQTL-------EFTGR-
SYV_STRP8       ----TDVE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRPN       ----VDSE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_STRR6       ----VDSE---------DFKRYFPTSTLVTGYDIIFFWVSRMIFQSL-------EFTGR-
SYV_LISIN       ----TENP---------DYKHFFPTNTLVTGYDIIFFWVSRMIFQSV-------EFTGE-
SYV_LISMF       ----TENP---------DFQHFFPTNTLVTGYDIIFFWVSRMIFQSV-------EFTGE-
SYV_LISMO       ----TESP---------DFQHFFPTNTLVTGYDIIFFWVSRMIFQSV-------EFTGE-
SYV_OCEIH       ----EDSA---------DLKRYFPTNVLVTGYDIIFFWVSRMIFQSK-------EFMNE-
SYV_BACC1       ----EDAA---------DFKRYYSTDALVTGYDIIFFWVSRMIFQGL-------EFTGE-
SYV_BACCZ       ----EDAA---------DFKRYYSTDALVTGYDIIFFWVSRMIFQGL-------EFTGE-
SYV_BACCR       ----EDSA---------DFKRYYSTDALVTGYDIIFFWVSRMIFQGL-------EFTGE-
SYV_BACAN       ----EDAA---------DFKRYYSTDALVTGYDIIFFWVSRMIFQGL-------EFTGE-
SYV_BACHK       ----EDAA---------DFKRYYSTDALVTGYDIIFFWVSRMIFQGL-------EFTGE-
SYV_BACSK       ----EEAP---------DYKRYYPTNVLVTGYDIIAFWVSRMIFQGK-------AFTGQ-
SYV_BACHD       ----EEAP---------DYKRYYSTDALVTGYDIIFFWVSRMIFQGL-------EFTGQ-
SYV_GEOSE       ----TDSP---------DYKRYYPTDVLVTGYDIIFFWVSRMIFQGL-------EFTGK-
SYV_GEOKA       ----TESP---------DYKRYYPTDVLVTGYDIIFFWVSRMIFQGL-------EFTGK-
SYV_BACLD       ----IDEE---------DFKRYYPTNVLVTGYDIIFFWVSRMIFQGI-------EFTGE-
SYV_BACSU       ----VTAE---------DFKRYYPTDVLVTGYDIIFFWVSRMIFQGI-------EFTGE-
SYV_THEMA       ----ET-E---------DLKRYYPTDLLVTGFDIIFFWVARMIMMGY-------EFMND-
SYV_CARHZ       ----NT-E---------ELKYYYPTSVLVTGRDIIFFWVARMLFMGL-------EFMKE-
SYV_CALS4       ----ET-E---------DLKYFYPTDVLVTGYDIIFFWVARMIFMSL-------EFMKE-
SYV_CLOPE       ----RT-D---------DLEFFYPTSTLVTGYDIIFFWVARMIFSGI-------HNMGE-
SYV_CLOAB       ----KN-E---------DLEYFYPTDTLVTGYDIIFFWVARMVFSGI-------YNMGE-
SYV_CLOTE       ----KT-E---------DLEYFYPTDVLATGYDIIFFWVARMIFSGL-------HNMKE-
                                             :. :::  *  .*                  

SYV_MYCGA       ------------IPFHDLLLHGLI-------LDEHN------------------------
SYV_MYCGE       ------------LPFKTVLIHGLV-------RDEQN------------------------
SYV_MYCPN       ------------LPFKQVLIHGLV-------RDAQN------------------------
SYV_MYCPE       ------------VPFKHCYITGLI-------RDEHN------------------------
SYV_MYCS5       ------------RPFKEVFMHGLI-------RDKDG------------------------
SYV_MYCH2       ------------KPFEKVLLHGLI-------RDEIG------------------------
SYV_MYCH7       ------------KPFEKVLLHGLI-------RDEIG------------------------
SYV_MYCHJ       ------------KPFEKVLLHGLI-------RDEIG------------------------
SYV_MYCMO       ------------IPFKKALIHGLI-------RDEQG------------------------
SYV_MYCPU       ------------KPFNDVLLHGLI-------RDEQR------------------------
SYV_PARUW       ------------PPFPETYLLGLIYGKSYWRQESNGGILYVNEQERSDFDMGKPIPKEVF
SYV_CHLPN       ------------KPFSEVFLHGLIFGKSYKRYNDFGEWSYISGKEKLAYDMGEALPDGVV
SYV_CHLMU       ------------KPFADVFLHGLIFGKSYKQYDDNGEWTYVSGDQKREYDKGKALPKNVV
SYV_CHLTR       ------------EPFSDVFLHGLIFGKSYREYDEKGEWFYVSGERKRDYDKGKALPKNVV
SYV_CHLAB       ------------KPFSDVFLHGLIFGKSYKRYNDLGEWTYITGEEKYAYDMGKALPKGVI
SYV_CHLCV       ------------KPFSDVFLHGLIFGKSYKRYNDLGEWTYISGEEKHAYDMGKALPKDVV
SYV_ONYPE       ------------DPFKDVLLHGLV-------RDNKG------------------------
SYV_UREPA       ------------KPFKDVLIHGLI-------RDSQG------------------------
SYV_PORGI       ------------KPFDNVYLTGIV-------RDGQG------------------------
SYV_BACFN       ------------MPFKNVYFTGIV-------RDKLG------------------------
SYV_BACFR       ------------MPFKNVYFTGIV-------RDKLG------------------------
SYV_BACTN       ------------MPFKNVYFTGIV-------RDKLG------------------------
SYV_WIGBR       ------SFGNPQIPFKNIFITGLI-------RDKNG------------------------
SYV_DEIRA       ------------APFSTVMLHGLY-------LDAKG------------------------
SYV_THET8       ------------RPFKTVLLHGLV-------LDEKG------------------------
SYV_THETH       ------------RPFKTVLLHGLV-------LDEKG------------------------
SYV_THET2       ------------RPFKTVLLHGLV-------LDEKG------------------------
SYV_HELPJ       ------------LPFKDIYLHALV-------RDEKG------------------------
SYV_HELPY       ------------LPFKDIYLHALV-------RDEKG------------------------
SYV_CAMJE       ------------LPFKDIYLHALV-------KDEQG------------------------
SYV_CAMJR       ------------LPFKDIYLHALV-------KDEQG------------------------
SYV_HELHP       ------------LPFKDVYLHALV-------RDENG------------------------
SYV_WOLSU       ------------LPFKDIYLHALV-------RDEKG------------------------
SYV_BORBU       ------------VPFKDVYITPLL-------RDKQG------------------------
SYV_BORBP       ------------TPFRDVYITPLL-------RDKQG------------------------
SYV_MESFL       ------------IPFKDVLIHGLV-------RDEHG------------------------
SYV_MYCMS       ------------IPFKDVLIHGLV-------RDESN------------------------
SYV_PELUB       ------------EPFKDVYVHALV-------KDEKG------------------------
SYV_TREDE       ------------APFKDIFIHGLV-------RDKQG------------------------
SYV_TREPA       ------------VPFRDVYLHGLV-------RDKQG------------------------
SYV_GLOVI       ------------IPFETVYINGLV-------RDEKG------------------------
SYV_PROMP       ------------IPFKDVYIHGLV-------RDENN------------------------
SYV_PROMA       ------------MPFADVYIHGLV-------RDEQN------------------------
SYV_PROMT       ------------MPFADVYIHGLV-------RDEQN------------------------
SYV_PROMM       ------------MPFADVYIHGLV-------RDEQN------------------------
SYV_SYNPX       ------------MPFQDVYIHGLV-------RDEQN------------------------
SYV_THEEB       ------------IPFRDVYIHGLV-------RDENN------------------------
SYV_SYNP6       ------------MPFKDVYIHGLV-------RDENN------------------------
SYV_NOSS1       ------------MPFQTVYIHGLV-------RDENN------------------------
SYV_SYNY3       ------------IPFKDVYIHGLV-------RDENG------------------------
SYV_LEPIC       ------------PPFHKVLIHGLV-------RDKDG------------------------
SYV_LEPIN       ------------PPFHKVLIHGLV-------RDKDG------------------------
SYV_STRAW       -----------TPPFHTIALHGMV-------RDQFG------------------------
SYV_STRCO       -----------TPPFHTIALHGMV-------RDQNG------------------------
SYV_CORJK       -----GKDGRPQIPFNDIFLHGLV-------RDEHG------------------------
SYV_CORDI       -----GTDGRPQIPFNDLFLHGLV-------RDEQG------------------------
SYV_COREF       -----GTDGRPQVPFTDLFLHGLV-------RDEHG------------------------
SYV_CORGL       -----GKDGRPQVPFTDLFLHGLV-------RDEHG------------------------
SYV_NOCFA       ALTAGKDPGQVQVPFKDIFLHGLI-------RDQHG------------------------
SYV_MYCLE       DAITLGGCRGPQVPFTDVFLHGLI-------RDEFG------------------------
SYV_MYCBO       AAITLDGRRGPQVPFTDVFLHGLI-------RDESG------------------------
SYV_MYCTU       AAITLDGRRGPQVPFTDVFLHGLI-------RDESG------------------------
SYV_MYCPA       DAITLDGRRGPQVPFTDVFLHGLI-------RDESG------------------------
SYV_BUCBP       ------HNGNGRVPFKKVYITGLI-------CDEHG------------------------
SYV_BLOFL       ------QNNNAQIPFKKIYITGLM-------RDKFG------------------------
SYV_BLOPB       ------DNGSAQIPFKTVYITGLI-------RDELG------------------------
SYV_BUCAI       ------KHNNPEVPFKNIYITGLI-------RDEFG------------------------
SYV_BUCAP       ------SYGNPQIPFKDVYITGLI-------RDEEG------------------------
SYV_FRATT       ------------VPFRDIYITGLI-------RDSEG------------------------
SYV_COXBU       ------------IPFHSVYIHGLI-------RDSQG------------------------
SYV_XYLFA       ------------VPFHDVYITGLI-------RDAQG------------------------
SYV_XYLFT       ------------VPFHDVYITGLI-------RDAQG------------------------
SYV_XANC8       ------------VPFRDVYITGLI-------RDAQG------------------------
SYV_XANCP       ------------VPFRDVYITGLI-------RDAQG------------------------
SYV_XANOR       ------------VPFRDVYITGLI-------RDAQG------------------------
SYV_XANC5       ------------VPFRDVYITGLI-------RDAQG------------------------
SYV_XANAC       ------------VPFRDVYITGLI-------RDAQG------------------------
SYV_LEGPA       ------------IPFKEVFITGLI-------RDSEG------------------------
SYV_LEGPH       ------------IPFKEVFITGLI-------RDSEG------------------------
SYV_LEGPL       ------------IPFKEVFITGLI-------RDSEG------------------------
SYV_METCA       ------------VPFREVYIHGLV-------RDAEG------------------------
SYV_NITOC       ------------VPFHEVYIHGLV-------RDAEG------------------------
SYV_ACIAD       ------EDGTPQVPFKTVYVHGLV-------RDGEG------------------------
SYV_PSYA2       ------EDGTPQIPFKTVYVHGLV-------RDGNG------------------------
SYV_PSEAE       ------PDGTPQIPFKTVYVHGLV-------RDGQG------------------------
SYV_PSEPK       ------EDGTPQVPFKTVYVHGLV-------RDGQG------------------------
SYV_PSEF5       ------EDGTPQVPFKTVYVHGLV-------RDGQG------------------------
SYV_PSESM       ------EDGTPQVPFKTVYVHGLV-------RDGQG------------------------
SYV_PSE14       ------EDGTPQVPFKTVYVHGLV-------RDGQG------------------------
SYV_PSEU2       ------EDGTPQVPFKTVYVHGLV-------RDGQG------------------------
SYV_IDILO       ------EEGQPQVPFKKVYVTGLI-------RDEEG------------------------
SYV_MANSM       ------ENGKPQVPFKTVYVTGLI-------RDEQG------------------------
SYV_PASMU       ------ENGKPQVPFKTVYVTGLI-------RDEQG------------------------
SYV_HAEDU       ------ENGKPQVPFKTVYVTGLI-------RDEQG------------------------
SYV_HAEI8       ------ENGKPQVPFKTVYVTGLI-------RDEQG------------------------
SYV_HAEIN       ------ENGKPQVPFKTVYVTGLI-------RDEQG------------------------
SYV_COLP3       ------ENGKAQIPFKKIYMTGLI-------RDENG------------------------
SYV_PHOPR       ------EEGNAQVPFKTVYMTGLI-------RDENG------------------------
SYV_ALIF1       ------EEGNAQVPFKTVYMTGLI-------RDENG------------------------
SYV_VIBCH       ------EDGKAQVPFKTVYVTGLI-------RDENG------------------------
SYV_VIBVU       ------ENGKPQVPFKTVYVTGLI-------RDENG------------------------
SYV_VIBVY       ------ENGKPQVPFKTVYVTGLI-------RDENG------------------------
SYV_VIBPA       ------ENGKPQVPFKTVYVTGLI-------RDENG------------------------
SYV_PHOLL       ------ENGKPQVPFKTVYMTGLI-------RDEEG------------------------
SYV_YERPE       ------ENGKPQVPFKTVYMTGLI-------RDDEG------------------------
SYV_YERPS       ------ENGKPQVPFKTVYMTGLI-------RDDEG------------------------
SYV_PECAS       ------EDGKPQVPFNTVYMTGLI-------RDEEG------------------------
SYV_SHIDS       ------ENGTPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_ECOL6       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_ECOLI       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_ECO57       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SHIBS       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SHISS       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SHIFL       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SALPA       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SALTI       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SALCH       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_SALTY       ------ENGKPQVPFHTVYMTGLI-------RDDEG------------------------
SYV_PSEHT       ------ENGKPQVPFKTVYVTGLI-------RDDNG------------------------
SYV_SHEON       ------EDGKPQVPFKTVYVTGLI-------RDEAG------------------------
SYV_CHRVO       ------------VPFKDVYIHGMV-------RDHEG------------------------
SYV_NEIG1       ------------VPFKAVYIHGIV-------RDHEG------------------------
SYV_NEIMA       ------------VPFKDVYIHGIV-------RDHEG------------------------
SYV_NEIMB       ------------VPFKDVYIHGIV-------RDHEG------------------------
SYV_NITEU       ------------VPFREVYITGLI-------RDAEG------------------------
SYV_THIDA       ------------VPFREVYVTGLV-------RDSEG------------------------
SYV_BORPE       ------------VPFKHVYVHGLI-------RDADG------------------------
SYV_BORBR       ------------VPFKHVYVHGLI-------RDADG------------------------
SYV_BORPA       ------------VPFKHVYVHGLI-------RDADG------------------------
SYV_BURMA       ------------VPFGTVYVHGLV-------RDAEG------------------------
SYV_BURPS       ------------VPFGTVYVHGLV-------RDAEG------------------------
SYV_CUPPJ       ------------VPFHTVYVHGLV-------RDSEG------------------------
SYV_RALSO       ------------VPFQTVYVHGLV-------RDSEG------------------------
SYV_AROAE       ------------IPFRDVYVHGLI-------RDAEG------------------------
SYV_DECAR       ------------IPFKHVYVHGLI-------RDGEG------------------------
SYV_FUSNN       ------------IPFKNVFFHGIV-------RDEIG------------------------
SYV_BDEBA       ------------VPFRTVYIHGLV-------RDSQG------------------------
SYV_GLUOX       ------------VPFRTVLIHGLV-------RDEKG------------------------
SYV_RHOS4       ------------VPFKTVYVHALV-------RDEKG------------------------
SYV_RUEPO       ------------VPFHTVYLHQLV-------RDEKG------------------------
SYV_SPHEL       ------------VPFKTLYLHGLV-------RAADG------------------------
SYV_ZYMMO       ------------VPFPKLYLHGLV-------RAADG------------------------
SYV_CAUVC       ------------APFKQVFINALV-------RDEKG------------------------
SYV_NITWN       ------------APFSTVYIHALV-------RDEKG------------------------
SYV_BRADU       ------------VPFSTIYIHALV-------RDEKG------------------------
SYV_RHOPA       ------------VPFPTVYIHALV-------RDEKG------------------------
SYV_BARHE       ------------VPFPTVYVHALV-------RDQKG------------------------
SYV_BARQU       ------------VPFPTVYVHALV-------RDQKG------------------------
SYV_AGRFC       ------DAGNPVEPFSTVYIHALV-------RDKNG------------------------
SYV_RHIME       ------ADGTPVEPFHTVYVHALV-------RDKNG------------------------
SYV_RHILO       ------------EPFHTVYVHALV-------RDKNG------------------------
SYV_BRUME       ------------IPFHTVYLHALV-------RDKHG------------------------
SYV_BRUSU       ------------IPFHTVYLHALV-------RDKHG------------------------
SYV_DESPS       ------------VPFKDVYLHALV-------RDKHG------------------------
SYV_DESVH       ------------VPFKHVYLHALV-------RDGEG------------------------
SYV_GEOSL       ------------VPFSDVYIHALV-------RDAQG------------------------
SYV_PELCD       ------------VPFKDVYIHALV-------RDAQG------------------------
SYV_DEHM1       ------------VPFRTVYLHGLI-------RDDKG------------------------
SYV_DEHMC       ------------VPFRTVYLHGLI-------RDDKG------------------------
SYV_SYMTH       ------------IPFHTVVLHGLV-------RDAQG------------------------
SYV_LACCA       ------------RPFQYTLIHGLM-------RDEQG------------------------
SYV_LACAC       ------------RPFKDVVLHGLI-------RDEQG------------------------
SYV_LACJO       ------------RPFDDVVLHGLI-------RDPQG------------------------
SYV_STAS1       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAAR       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAAC       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAAN       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAAS       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAAW       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAAM       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAEQ       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAES       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_STAHJ       ------------RPFNDVLLHGLV-------RAEDG------------------------
SYV_LACPL       ------------RPFKNVLLHGLI-------RDEHG------------------------
SYV_LACSS       ------------RPFEHVLIHGLI-------RDEQG------------------------
SYV_ENTFA       ------------RPFQNVLIHGLI-------RDEQG------------------------
SYV_LACLA       ------------SPFHNVLIHGLI-------RDEEG------------------------
SYV_STRMU       ------------RPFQNVLIHGLI-------RDEQG------------------------
SYV_STRA5       ------------QPFSNVLIHGLI-------RDEEG------------------------
SYV_STRA1       ------------QPFSNVLIHGLI-------RDEEG------------------------
SYV_STRA3       ------------QPFSNVLIHGLI-------RDEEG------------------------
SYV_STRT1       ------------QPFKNVLIHGLI-------RDEQG------------------------
SYV_STRT2       ------------QPFKNVLIHGLI-------RDEQG------------------------
SYV_STRP1       ------------QPFQNVLIHGLI-------RDEEG------------------------
SYV_STRPM       ------------QPFQNVLIHGLI-------RDEEG------------------------
SYV_STRP6       ------------QPFQNVLIHGLI-------RDEEG------------------------
SYV_STRP3       ------------QPFQNVLIHGLI-------RDEEG------------------------
SYV_STRP8       ------------QPFQNVLIHGLI-------RDEEG------------------------
SYV_STRPN       ------------QPFQNVLIHGLI-------RDEQG------------------------
SYV_STRR6       ------------QPFQNVLIHGLI-------RDEQG------------------------
SYV_LISIN       ------------RPFKDTLIHGLV-------RDSEG------------------------
SYV_LISMF       ------------RPFKDTLIHGLV-------RDSEG------------------------
SYV_LISMO       ------------RPFKDTLIHGLV-------RDSEG------------------------
SYV_OCEIH       ------------KPFEDTLLHGLI-------RDADG------------------------
SYV_BACC1       ------------RPFKDVLIHGLV-------RDEQG------------------------
SYV_BACCZ       ------------RPFKDVLIHGLV-------RDEQG------------------------
SYV_BACCR       ------------RPFKDVLIHGLV-------RDEQG------------------------
SYV_BACAN       ------------RPFKDVLIHGLV-------RDEQG------------------------
SYV_BACHK       ------------RPFKDVLIHGLV-------RDEQG------------------------
SYV_BACSK       ------------RPFKDVLIHGLI-------RDAEG------------------------
SYV_BACHD       ------------PPFKDVLIHGLV-------RDAEG------------------------
SYV_GEOSE       ------------RPFKDVLIHGLV-------RDAQG------------------------
SYV_GEOKA       ------------RPFKDVLIHGLV-------RDAQG------------------------
SYV_BACLD       ------------RPFKDVLIHGLI-------RDDQG------------------------
SYV_BACSU       ------------RPFKDVLIHGLI-------RDEQG------------------------
SYV_THEMA       ------------KPFSHVYIHQLV-------RDKYG------------------------
SYV_CARHZ       ------------VPFKEVLIHGLV-------LDAQG------------------------
SYV_CALS4       ------------IPFKYVLIHGLV-------RDALG------------------------
SYV_CLOPE       ------------TPFDTVLIHGII-------RDAQG------------------------
SYV_CLOAB       ------------VPFKHVYIHGLV-------RDAEG------------------------
SYV_CLOTE       ------------IPFKTVLIHGIV-------RDSEG------------------------
                             **    .  :                                     

SYV_MYCGA       ---RKMSKSLNNGVDPIQIID---------------------------------------
SYV_MYCGE       ---RKMSKSLNNGIDPVDLIR---------------------------------------
SYV_MYCPN       ---RKMSKSLNNGINPMDLIR---------------------------------------
SYV_MYCPE       ---NKMSKSLGNGVDPNDVIE---------------------------------------
SYV_MYCS5       ---RKMSKSLNNGIDPIEVVE---------------------------------------
SYV_MYCH2       ---RKMSKSLGNGLDPMEIIE---------------------------------------
SYV_MYCH7       ---RKMSKSLGNGLDPMEIIE---------------------------------------
SYV_MYCHJ       ---RKMSKSLGNGLDPMEIIE---------------------------------------
SYV_MYCMO       ---RKMSKSLGNGIDPMDLIE---------------------------------------
SYV_MYCPU       ---RKMTKSLGNGIDPMVLID---------------------------------------
SYV_PARUW       SKWEKMSKSKGNIIDPLEMID---------------------------------------
SYV_CHLPN       AKWEKLSKSKGNVIDPLEMIA---------------------------------------
SYV_CHLMU       AKWEKLSKSKGNVIDPIEMID---------------------------------------
SYV_CHLTR       AKWEKLSKSKGNVIDPIEMIE---------------------------------------
SYV_CHLAB       AKWEKLSKSKGNVIDPLEMIA---------------------------------------
SYV_CHLCV       AKWEKLSKSKGNVIDPLEMIG---------------------------------------
SYV_ONYPE       ---QKMSKSKGNGVDPLEVVA---------------------------------------
SYV_UREPA       ---RKMSKSLGNGIDPFDIID---------------------------------------
SYV_PORGI       ---RKMSKSLGNSPDPIMLME---------------------------------------
SYV_BACFN       ---RKMSKSLGNSPDPLELIE---------------------------------------
SYV_BACFR       ---RKMSKSLGNSPDPLELIE---------------------------------------
SYV_BACTN       ---RKMSKSLGNSPDPLELID---------------------------------------
SYV_WIGBR       ---IKMSKSKGNVIDPIDIIDGISLEDLIKKRTKEISNIKLIKKIEKITKKEF-------
SYV_DEIRA       ---QKMSKSKGNGIDPLELFG---------------------------------------
SYV_THET8       ---QKMSKSKGNVIDPLEMVE---------------------------------------
SYV_THETH       ---QKMSKSKGNVIDPLEMVE---------------------------------------
SYV_THET2       ---QKMSKSKGNVIDPLEMVE---------------------------------------
SYV_HELPJ       ---EKMSKSKGNVIDPLEMIE---------------------------------------
SYV_HELPY       ---EKMSKSKGNVIDPLEMIE---------------------------------------
SYV_CAMJE       ---RKMSKSLGNVIDPNESIK---------------------------------------
SYV_CAMJR       ---RKMSKSLGNVIDPNESIK---------------------------------------
SYV_HELHP       ---QKMSKSKGNIIDPMEIIS---------------------------------------
SYV_WOLSU       ---QKMSKSKGNVIDPLELIE---------------------------------------
SYV_BORBU       ---KKMSKSLGNGIDPLDIIN---------------------------------------
SYV_BORBP       ---KKMSKSLGNGIDPLDIIH---------------------------------------
SYV_MESFL       ---AKMSKSLGNGIDPMDVIV---------------------------------------
SYV_MYCMS       ---RKMSKSLGNGIDPMDVIN---------------------------------------
SYV_PELUB       ---QKMSKSKGNVINPLDLIE---------------------------------------
SYV_TREDE       ---RKMSKSLGNGIDPLVAIE---------------------------------------
SYV_TREPA       ---RKMSKSLNNGVDPLHIIR---------------------------------------
SYV_GLOVI       ---QKMSKTKGNGIDPIEMMD---------------------------------------
SYV_PROMP       ---KKMSKSSGNGIDPLLLID---------------------------------------
SYV_PROMA       ---RKMSKSAGNGIDPLLLID---------------------------------------
SYV_PROMT       ---RKMSKSAGNGIDPLLLIE---------------------------------------
SYV_PROMM       ---RKMSKSAGNGIDPLLLIE---------------------------------------
SYV_SYNPX       ---RKMSKSAGNGIDPLLLID---------------------------------------
SYV_THEEB       ---KKMSKSANNGIDPLILIE---------------------------------------
SYV_SYNP6       ---KKMSKSAGNGIDPLILID---------------------------------------
SYV_NOSS1       ---KKMSKSANNGIDPLLLID---------------------------------------
SYV_SYNY3       ---KKMSKSANNGIDPLLLIN---------------------------------------
SYV_LEPIC       ---KKFSKSVGNVIDPLVMMD---------------------------------------
SYV_LEPIN       ---KKFSKSVGNVIDPLVMMD---------------------------------------
SYV_STRAW       ---KKMSKSFGNAVNPLDWMD---------------------------------------
SYV_STRCO       ---KKMSKSFGNVVNPLDWMD---------------------------------------
SYV_CORJK       ---RKMSKSLGNGIDPMDWVR---------------------------------------
SYV_CORDI       ---RKMSKSLGNGIDPMDWVE---------------------------------------
SYV_COREF       ---RKMSKSLGNGIDPMDWVD---------------------------------------
SYV_CORGL       ---RKMSKSLGNGIDPMDWVE---------------------------------------
SYV_NOCFA       ---KKMSKSRGNGIDPLDWIR---------------------------------------
SYV_MYCLE       ---RKMSKSRGNVIDPLAWMD---------------------------------------
SYV_MYCBO       ---RKMSKSKGNVIDPLDWVE---------------------------------------
SYV_MYCTU       ---RKMSKSKGNVIDPLDWVE---------------------------------------
SYV_MYCPA       ---RKMSKSKGNVIDPLDWVD---------------------------------------
SYV_BUCBP       ---KKMSKSKGNVVDPLDMIDGISLDALIQKRIKSTVFSTHSKKIITQIQSLY-------
SYV_BLOFL       ---QKMSKSKGNGIDPIDIIDGISKKKLLKKQLKENSQSKSISSIIKYINTQF-------
SYV_BLOPB       ---QKMSKSKGNIIDPIDIIDGISIENLLKKRTKNMLQPQLSKHIINNTIKQF-------
SYV_BUCAI       ---KKMSKSKGNVIDPLDMIDGISLSELIKKRTNNLLQPNLSDKIIQRTIKQF-------
SYV_BUCAP       ---KKMSKSKGNVIDPIDMIDGISLNELIEKRTSNLLQPHLSQKIRYHTIKQF-------
SYV_FRATT       ---QKMSKSKGNVLDPVDLIDGISLDELLKKRTTGLMQPQMKAKIEKATKKEF-------
SYV_COXBU       ---RKMSKSKGNVIDPIDIIDGISLDALIEKRTHALLQPKMAKTIEKMTRKEF-------
SYV_XYLFA       ---QKMSKSKGNVLDPLDIIDGITLDDLVAKRTTGLMQPKLAEKIAKATRKEF-------
SYV_XYLFT       ---QKMSKSKGNVLDPLDIIDGITLDDLVAKRTTGLMQPKLAEKIAKATRKEF-------
SYV_XANC8       ---QKMSKSKGNVLDPLDIIDGISIEDLVAKRTSGLMQPRMAEKIEKATRKEF-------
SYV_XANCP       ---QKMSKSKGNVLDPLDIIDGISIEDLVAKRTSGLMQPRMAEKIEKATRKEF-------
SYV_XANOR       ---QKMSKSKGNVLDPLDIIDGISIEDLVAKRTNGLMQPRMAEKIEKATRKEF-------
SYV_XANC5       ---QKMSKSKGNVLDPLDIIDGISIEDLVAKRTHGLMQPRMAEKIEKATRKEF-------
SYV_XANAC       ---QKMSKSKGNVLDPLDIIDGISIEDLVAKRTSGLMKPKDAPKIEKATRKEF-------
SYV_LEGPA       ---HKMSKSKGNVLDPLDIVDGIDLDSLIAKRTSNLMLNSVRDRITKATRKEF-------
SYV_LEGPH       ---HKMSKSKGNVLDPLDIVDGIDLDSLIAKRTSNLMLNSVRDRITKATRKEF-------
SYV_LEGPL       ---HKMSKSKGNVLDPLDIVDGIELDSLIAKRTSNLMLNSVRDRITKATRKEF-------
SYV_METCA       ---QKMSKSKGNVLDPIDLIDGISLEDLVAKRTQGLMQPQMAARIEKRTRQDF-------
SYV_NITOC       ---QKMSKSKGNVLDPLDLIDGIDLETLVTKRTGGLMQPAMAKRIEKATRKEF-------
SYV_ACIAD       ---QKMSKSKGNVLDPLDLIDGIDLESLVQKRTFGLMNPKQAEKIEKATRKEF-------
SYV_PSYA2       ---QKMSKSKGNVLDPIDIIDGIELEALVEKRTSNMMNPKDAAKIEKQTRKEF-------
SYV_PSEAE       ---QKMSKSKGNVLDPLDIVDGIDLDTLLQKRTSGMMQPKLAEKIAKQTRAEF-------
SYV_PSEPK       ---QKMSKSKGNVLDPLDIVDGITLDALLEKRTSGMMQPKLAEKIAKQTKAEF-------
SYV_PSEF5       ---QKMSKSKGNVLDPLDIIDGIDLETLVQKRTTGLMQPKLQKAIEKQTRAEF-------
SYV_PSESM       ---QKMSKSKGNVLDPLDIVDGIDLETLVEKRTSGLMQPQLAKKIEKQTRQEF-------
SYV_PSE14       ---QKMSKSKGNVLDPLDIVDGIDLETLVEKRTSGLMQPQLAKKIEKQTRQEF-------
SYV_PSEU2       ---QKMSKSKGNVLDPLDIVDGIDLETLVEKRTSGLMQPQLAKKIEKQTRQEF-------
SYV_IDILO       ---QKMSKSKGNVLDPLDMIDGISADELVAKRTANLMQPKMREKIEKRTRKEF-------
SYV_MANSM       ---QKMSKSKGNVIDPLDMIDGIDLESLLAKRTGNMMQPQLAEKIAKATKKEF-------
SYV_PASMU       ---QKMSKSKGNVIDPLDMIDGIDLESLLEKRTGNMMQPQLAEKIAKATIKAF-------
SYV_HAEDU       ---QKMSKSKGNVLDPIDMIDGISLADLLEKRTGNMMQPQLAEKIAKATRKEFAATPTLP
SYV_HAEI8       ---QKMSKSKGNVLDPIDMIDGISLEDLLEKRTGNMMQPQLAEKIAKATRKEF-------
SYV_HAEIN       ---QKMSKSKGNVLDPIDMIDGISLEDLLEKRTGNMMQPQLAEKIAKATRKEF-------
SYV_COLP3       ---DKMSKSKGNVVDPLDMIDGISLEDLLQKRTGNMMQPKLAKKIEKLTRKEY-------
SYV_PHOPR       ---DKMSKSKGNVLDPIDMIDGIGLEELVEKRCGNMMQPKLAAKIEKQTRKAF-------
SYV_ALIF1       ---DKMSKSKGNVLDPIDMIDGIDLESLVEKRCGNMMQPQLAKKIEKNTRKTF-------
SYV_VIBCH       ---DKMSKSKGNVLDPIDMIDGIDLESLVAKRTGNMMQPQLAAKIEKNTRKTF-------
SYV_VIBVU       ---DKMSKSKGNVLDPIDMIDGIDLESLVEKRTGNMMQPQLAAKIEKNTRKTF-------
SYV_VIBVY       ---DKMSKSKGNVLDPIDMIDGIDLESLVEKRTGNMMQPQLAAKIEKNTRKTF-------
SYV_VIBPA       ---DKMSKSKGNVLDPIDMIDGIDLESLVEKRTGNMMQPQLAKKIEKNTRKTF-------
SYV_PHOLL       ---QKMSKSKGNVIDPLDMVDGISLEELLEKRTGNMMQPQLAEKIRKRTEKQF-------
SYV_YERPE       ---QKMSKSKGNVIDPLDMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQF-------
SYV_YERPS       ---QKMSKSKGNVIDPLDMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQF-------
SYV_PECAS       ---QKMSKSKGNVIDPLDMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQF-------
SYV_SHIDS       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_ECOL6       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_ECOLI       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_ECO57       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_SHIBS       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_SHISS       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_SHIFL       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQLADKIRKRTEKQF-------
SYV_SALPA       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQF-------
SYV_SALTI       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQF-------
SYV_SALCH       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQF-------
SYV_SALTY       ---QKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQF-------
SYV_PSEHT       ---DKMSKSKGNVLDPLDMIDGIELEELVQKRTGNMMQPKLAAKIEKDTRKVF-------
SYV_SHEON       ---NKMSKSKGNVLDPLDMIDGIDLETLVEKRTGNMMQPQLAAKIEKSTRKEF-------
SYV_CHRVO       ---KKMSKSEGNVIDPVDLIDGIALEPLVEKRTTGLRRPEKAPQIAKATEKLF-------
SYV_NEIG1       ---KKMSKSEGNVIDPVDLIDGIGLDKLLMKRTTGLRKPETAPKVEEATKKLF-------
SYV_NEIMA       ---KKMSKSEGNVIDPVDLIDGIDLEKLLVKRTTGLRKPETAPKVEEASRKLF-------
SYV_NEIMB       ---KKMSKSEGNVIDPVDLIDGIGLEKLLVKRTTGLRKPETAPKVEEATKKLF-------
SYV_NITEU       ---QKMSKSKGNVLDPLDLIDGVSLTELIRKRTTGLMNPKQAESIEKTTRKQF-------
SYV_THIDA       ---QKMSKSKGNVLDPIDLIDGIAVGDLVAKRTQGLMNPKQAASIEKRTRKEF-------
SYV_BORPE       ---QKMSKSKGNTLDPVDLIDGIDLKGLVRKRTFGLMHPKQAGAIEKATRRQY-------
SYV_BORBR       ---QKMSKSKGNTLDPVDLIDGIDLEGLVRKRTFGLMNPKQAGAIEKATRRQY-------
SYV_BORPA       ---QKMSKSKGNTLDPVDLIDGIDLEGLVRKRTFGLMNPKQAGAIEKATRRQY-------
SYV_BURMA       ---QKMSKSKGNTLDPIDIVDGIGLDALVAKRTTGLMNPRQAATIEKKTRKEF-------
SYV_BURPS       ---QKMSKSKGNTLDPIDIVDGIGLDALVAKRTTGLMNPKQAATIEKKTRKEF-------
SYV_CUPPJ       ---KKMSKSEGNTLDPVDLIDGIDLDTLLKKRTTGLRRPKDAPKIEKKTKKEF-------
SYV_RALSO       ---KKMSKSEGNTLDPVDLIDGIALEPLLVKRTTGLRRPKDAPNVEKRTRKEF-------
SYV_AROAE       ---QKMSKSKGNVLDPIDLIDGISADELAKKRTFGLMNPKQAQSIEKKTRKEF-------
SYV_DECAR       ---QKMSKSKGNVLDPIDLIDGIGLEALIEKRTTGLMNPKQAESIAKKTKKEF-------
SYV_FUSNN       ---RKMSKSLGNSPDPLDLIK---------------------------------------
SYV_BDEBA       ---RKMSKSLGNSIDPVEMIE---------------------------------------
SYV_GLUOX       ---QKMSKSKGNGLDPLDLVA---------------------------------------
SYV_RHOS4       ---KKMSKSLGNVLDPLELID---------------------------------------
SYV_RUEPO       ---KKMSKTTGNVIDPLEIVD---------------------------------------
SYV_SPHEL       ---QKMSKSKGNTVDPLGMID---------------------------------------
SYV_ZYMMO       ---SKMSKSKGNTVDPLGLID---------------------------------------
SYV_CAUVC       ---AKMSKSKGNVMDPLILID---------------------------------------
SYV_NITWN       ---AKMSKSKGNVIDPLNLVD---------------------------------------
SYV_BRADU       ---AKMSKSKGNVIDPLHLID---------------------------------------
SYV_RHOPA       ---AKMSKSKGNVIDPLNLID---------------------------------------
SYV_BARHE       ---AKMSKSKGNIIDPLELID---------------------------------------
SYV_BARQU       ---AKMSKSKGNIIDPLELID---------------------------------------
SYV_AGRFC       ---QKMSKSKGNVIDPLELID---------------------------------------
SYV_RHIME       ---QKMSKSKGNVIDPLELID---------------------------------------
SYV_RHILO       ---AKMSKSKGNVIDPLDLID---------------------------------------
SYV_BRUME       ---AKMSKSKGNVIDPLELMD---------------------------------------
SYV_BRUSU       ---AKMSKSKGNVIDPLELMD---------------------------------------
SYV_DESPS       ---KKMSKSTGNVIDPLEIMA---------------------------------------
SYV_DESVH       ---RKMSKSTGNVIDPLAMID---------------------------------------
SYV_GEOSL       ---QKMSKSKGNVIDPLVVID---------------------------------------
SYV_PELCD       ---QKMSKSKGNVIDPLTVID---------------------------------------
SYV_DEHM1       ---EKMSKTKGNVIDPLKVID---------------------------------------
SYV_DEHMC       ---EKMSKTKGNVIDPLKVID---------------------------------------
SYV_SYMTH       ---RKMSKSLGNGVDPIDVID---------------------------------------
SYV_LACCA       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_LACAC       ---RKMSKSLGNGIDPMDVID---------------------------------------
SYV_LACJO       ---RKMSKSLGNGVDPMDVVD---------------------------------------
SYV_STAS1       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAAR       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAAC       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAAN       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAAS       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAAW       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAAM       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAEQ       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAES       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_STAHJ       ---RKMSKSLGNGVDPMDVIE---------------------------------------
SYV_LACPL       ---VKMSKSLGNGIDPMDVIE---------------------------------------
SYV_LACSS       ---RKMSKSLGNGIDPMEVIE---------------------------------------
SYV_ENTFA       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_LACLA       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRMU       ---RKMSKSLGNGIDPMDVVD---------------------------------------
SYV_STRA5       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRA1       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRA3       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRT1       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRT2       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRP1       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRPM       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRP6       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRP3       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRP8       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRPN       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_STRR6       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_LISIN       ---RKMSKSLGNGVDPIEVID---------------------------------------
SYV_LISMF       ---RKMSKSLGNGVDPIEVID---------------------------------------
SYV_LISMO       ---RKMSKSLGNGVDPIEVID---------------------------------------
SYV_OCEIH       ---RKMSKSLGNGVDPMDVIE---------------------------------------
SYV_BACC1       ---RKMSKSLGNGIDPMEVIE---------------------------------------
SYV_BACCZ       ---RKMSKSLGNGIDPMEVIE---------------------------------------
SYV_BACCR       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_BACAN       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_BACHK       ---RKMSKSLGNGIDPMDVIE---------------------------------------
SYV_BACSK       ---RKMSKSLGNGVDPQEVID---------------------------------------
SYV_BACHD       ---QKMSKSLGNGVDPMEVID---------------------------------------
SYV_GEOSE       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_GEOKA       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_BACLD       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_BACSU       ---RKMSKSLGNGVDPMDVID---------------------------------------
SYV_THEMA       ---RKMSKSLGNGIDPLEVID---------------------------------------
SYV_CARHZ       ---RKMSKSLGNGVDPVEVIA---------------------------------------
SYV_CALS4       ---RKMSKSLGNGIDPLEVIE---------------------------------------
SYV_CLOPE       ---RKMSKSLGNGVDPLEVID---------------------------------------
SYV_CLOAB       ---RKMSKSLGNGVDPLDVID---------------------------------------
SYV_CLOTE       ---KKMSKSLGNGVDPLEVID---------------------------------------
                    *::*: .*  :*   .                                        

SYV_MYCGA       -----QYGADALRLFLTS-NTSPGEDVSYNVEK-------INAAASFLNKLWNLARYLKL
SYV_MYCGE       -----NYGADAVRLFLCS-NHTPGDDLIFSEQK-------IKSAWNFLNKLWNVTKFVIQ
SYV_MYCPN       -----DYGADATRLFLTS-NHTPGDDLIFNEQK-------LKSAANFLNKLWNVTKYVLQ
SYV_MYCPE       -----KYGADALRLFLLS-SSSPGEDLCYVEEK-------VKSCWGFINKLWNSFRYVEM
SYV_MYCS5       -----KYGSDALRWFLIT-NTAPGMDIRYNQEK-------IESAWKISNKLYNVALYISS
SYV_MYCH2       -----KYGSDTLRQALIF-NSSPGKDIKFNIEK-------LNTAWNLNNKIWNIAKYIAD
SYV_MYCH7       -----KYGSDTLRQALIF-NSSPGKDIKFNIEK-------LNTAWNLNNKIWNIAKYIAD
SYV_MYCHJ       -----KYGSDTLRQALIF-NSSPGKDIKFNIEK-------LNTAWNLNNKIWNIAKYIAD
SYV_MYCMO       -----KYGADSLRWFLMT-NSTPGQDIRFNYDK-------IESAWSLINKIWNISRYIKM
SYV_MYCPU       -----QYGSDSLRWFLIT-NTTPGLDITYNEEK-------IKSSWNFMNKLWNIARFINL
SYV_PARUW       -----QFGTDAVRMALCA-SATQARQIDLDRRR-------FEEFKNFTNKIWNGARFVLM
SYV_CHLPN       -----TYGTDAVRLTLCS-CANRGEQIDLDYRL-------FEEYKHFANKVWNGARFIFG
SYV_CHLMU       -----MYGADAVRFTLCS-CANRGEQIDLDYRL-------FEEYKNFVNKLWNGARFIFG
SYV_CHLTR       -----AYGADAVRLTLCS-CANRGEQIDLDYHL-------FEEYKNFINKLWNGARFIFG
SYV_CHLAB       -----KYGADAVRMALCS-CANRGEQIDLDYRL-------FEEYKNFANKIWNGARFIFS
SYV_CHLCV       -----KYGADAVRMTLCS-CANRGEQIDLDYRL-------FEEYKNFANKIWNGARFIFG
SYV_ONYPE       -----KYGTDALRWFLTT-NAAPGFDLFYDETK-------VASSWNFINKLWNISRFVKL
SYV_UREPA       -----KYGLDAMRLFFAS-CTTIGEDLNFSTER-------LGANWNYLNKIWNIAKYIEN
SYV_PORGI       -----KYGADGVRMGLMM-AAPAGNDVLFDESL-------SEQGRNFCNKIWNAFRLV--
SYV_BACFN       -----KYGADGVRMGMML-SAPAGNDILFDDAL-------CEQGRNFCNKIWNAFRLV--
SYV_BACFR       -----KYGADGVRMGMML-SAPAGNDILFDDAL-------CEQGRNFCNKIWNAFRLV--
SYV_BACTN       -----KYGADGVRMGMML-AAPAGNDILFDDAL-------CEQGRNFCSKIWNAFRLI--
SYV_WIGBR       PNGIQNHGADAVRLSMAS-ISCSNRKINIDIKK-------IIGYKNFCNKLWNVSKFIII
SYV_DEIRA       -----QYGVDACRFAFTF-LSTGGQDIKHDARR-------FEQGRNFANKLWNATRFALM
SYV_THET8       -----RYGADALRFALIY-LATGGQDIRLDLRW-------LEMARNFANKLYNAARFVLL
SYV_THETH       -----RYGADALRFALIY-LATGGQDIRLDLRW-------LEMARNFANKLYNAARFVLL
SYV_THET2       -----RYGADALRFALTY-LATGGQDIRLDLRW-------LEMARNFANKLYNAARFVLL
SYV_HELPJ       -----KYGADSLRFTLAN-LCATGRDIKLSTTH-------LENNKNFANKLFNAASYLKL
SYV_HELPY       -----KYGADSLRFTLAN-LCATGRDIKLSTTH-------LENNKNFANKLFNAASYLKL
SYV_CAMJE       -----EYSADILRFTLAL-LAIQGRDIKLSNDK-------LLQVRNFTNKIYNAKNYLLL
SYV_CAMJR       -----EYSADILRFTLAL-LAIQGRDIKLSNDK-------LLQVRNFTNKIYNAKNYLLL
SYV_HELHP       -----SYGADTLRFTLAI-LCAQGRDVKLSTQS-------LEISKNFTNKLYNATNFLNM
SYV_WOLSU       -----KYGCDSTRFTLAI-LCAQGRDVRLSSQQ-------LEISKNFTNKLYNAANFLLL
SYV_BORBU       -----EYGSDSLRFTLSF-LSVQGQDLNIDAKD-------FMFGAKFANKVFNASKFILL
SYV_BORBP       -----EYGSDSLRFTLSF-LSVQGQDLNIDAKD-------FMLGAKFANKVFNASKFILL
SYV_MESFL       -----NNGSDSLRFSLLT-NSTPGQDIRYSDSK-------VKAAWNFINKLWNASRYVLM
SYV_MYCMS       -----NNGCDSLRLFLLT-NSTPGQDIRYSNEK-------ILASWNFINKLWNASRYVFL
SYV_PELUB       -----KYSADALRFTLLS-MASPGTDVKLSEDR-------VKGYRNFLNKLWNANNFLIT
SYV_TREDE       -----EFGADAMKFTLTFMCGSQSQDFLIDMES-------FKLGSKFANKVWNASRYILG
SYV_TREPA       -----TYGADALRFTLAF-MCAQGQDVLIEMDS-------FKMGSRFANKVWNASRYILG
SYV_GLOVI       -----KYGTDALRYTLVREVTGAGQDVRFDYNRKTGESGAVDASKRFANKIWNASRFVLM
SYV_PROMP       -----KYGSDALRFALLREVAGAGQDIRLDYDRKENTSSTVEASRNFANKLWNATKFVLI
SYV_PROMA       -----RYGTDALRFALVKEVAGAGQDIRIDYDRAKDTSATVEAARNFANKLWNATRFALI
SYV_PROMT       -----RYGTDALRFALVREVAGAGQDIRLDFDRKNQTSATVEASRNFANKLWNATRFALI
SYV_PROMM       -----RYGTDALRFALVREVAGAGQDIRLDYDRKSDTSATVEAARNFANKLWNATRFALM
SYV_SYNPX       -----RYGTDALRFALVREVAGAGQDIRLDYDRKTDTSATVEASRNFANKLWNATRFALM
SYV_THEEB       -----KYGTDALRYSLVKEVVGAGQDIRLAYNRKTDESATVEAARNFANKLWNASRFVLL
SYV_SYNP6       -----RYGTDALRYALIREVVGAGQDIRLDYNRKTDESATVETSRNFANKVWNASRFVML
SYV_NOSS1       -----KYGTDALRYTLVREVAGAGQDIRLEYDRKKDESPSVEASRNFANKLWNAARFVMM
SYV_SYNY3       -----KYGTDALRYTLIREVAGAGQDISLQYDRQKDESESVEASRNFANKLWNAARFVMM
SYV_LEPIC       -----KYGTDSFRFFLAA-TLPEGKDILFDESR-------LDGYRSFCNKIWNSSRFILM
SYV_LEPIN       -----KYGTDSFRFFLAA-TLPEGKDILFDESR-------LDGYRSFCNKIWNSSRFILM
SYV_STRAW       -----KYGSDALRFTLAR-GANPGVDVPIGEDW-------VQGSRNFANKIWNATRFALM
SYV_STRCO       -----KYGSDALRFTLAR-GANPGVDVPIGEDW-------VQGSRNFANKIWNATRFALM
SYV_CORJK       -----DYGADALRFTLAR-GANPGSDLPVGEDA-------AQSSRNFATKLYNATKFALM
SYV_CORDI       -----RFGADALRFTLAR-GANPGVDLPVGEDS-------AQSSRNFATKLFNATKFALM
SYV_COREF       -----NYGADALRFTLAR-GANPGVDLPVGEDS-------AQSSRNFATKLFNATRFALM
SYV_CORGL       -----NYGADALRFTLAR-GANPGVDLPVGEDS-------AQSSRNFATKLFNATKFALM
SYV_NOCFA       -----SYGADALRFTLAR-GAQPGGDLSVGEPH-------ALASRSFVTKLFNATKFALL
SYV_MYCLE       -----MFGADALRFTLAR-GSSPGGDLAIGEDH-------VRASRNFGTKLFNATRYALL
SYV_MYCBO       -----MFGADALRFTLAR-GASPGGDLAVSEDA-------VRASRNFGTKLFNATRYALL
SYV_MYCTU       -----MFGADALRFTLAR-GASPGGDLAVSEDA-------VRASRNFGTKLFNATRYALL
SYV_MYCPA       -----MFGADALRFTLAR-GASPGGDLAIGEDH-------VRASRNFCTKLFNATRYALL
SYV_BUCBP       PNGINSSGVDALRFTCAA-LSTPTRYIKWNINR-------LYGYRNFCNKLWNASRFILM
SYV_BLOFL       PNGIKPYGADTLRLTLTA-LASSGQDIHWDMHK-------LESYHNFCNKLWNVSKFVIT
SYV_BLOPB       PNGIKPHGTDALRFTLVA-LASSGRDIHWDMQR-------LTGYRNFCNKLWHASRFVLM
SYV_BUCAI       PEGIKSTGTDALRFTFSA-LASSTRDIQWDMNR-------LKGYRNFCNKLWNASRFVLI
SYV_BUCAP       PNGISATGTDALRFTFSA-LASNTRDIQWDMNR-------LKGYRNFCNKLWNASRFVLK
SYV_FRATT       PEGISAYGADAVRFTYAA-LASTSRDISFDTAR-------VEGYRNFCNKLWNASRFVMM
SYV_COXBU       PNGIASFGTDALRFTFCA-LASRGRDINFDMGR-------IDGYRNFCNKIWNAARFVTM
SYV_XYLFA       PEGIAPHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFVLM
SYV_XYLFT       PDGIAPHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFVLM
SYV_XANC8       PDGIIAHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFALM
SYV_XANCP       PDGIIAHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFALM
SYV_XANOR       PDGIIAHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFVLM
SYV_XANC5       PDGIIVHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFVLM
SYV_XANAC       PDGIIAHGADALRFTIAA-LATHGRDIKFDLGR-------AEGYKNFCNKLWNATRFVLM
SYV_LEGPA       PEGISAYGTDALRFTYCS-LASTGRNVRFDLGR-------VEGYRNFCNKLWNAARYVLL
SYV_LEGPH       PEGISAYGTDALRFTYCS-LASTGRNVRFDLGR-------VEGYRNFCNKLWNAARYVLL
SYV_LEGPL       PEGISAYGTDALRFTYCS-LASTGRNVRFDLGR-------VEGYRNFCNKLWNAARYVLL
SYV_METCA       PEGIPSYGTDALRFTFAS-LASTGRDIRFDLKR-------VEGCRNFCNKLWNAARYVLM
SYV_NITOC       PQGIPSFGCDALRFTFAI-LATRGRDIRFDLGR-------IEGYRNFCNKLWNAARYVLI
SYV_ACIAD       PEGINSYGTDAVRFTFCA-LANTGRDIKFDLKR-------VEGYRNFCNKIWNATRFVLM
SYV_PSYA2       PEGIPAFGTDALRFTFTS-LASTGRDINFDLKR-------VEGYRNFCNKIWNASRFVLM
SYV_PSEAE       PEGIASYGTDALRFTFCS-LASTGRDIKFDMGR-------VEGFRNFCNKIWNAANFVIE
SYV_PSEPK       PEGIASYGTDALRFTFCS-LASTGRDIKFDMGR-------VEGYRNFCNKIWNAARYVLD
SYV_PSEF5       ADGIASYGTDALRFTFCS-LATTGRDIKFDMGR-------VEGYRNFCNKIWNAARYVLD
SYV_PSESM       ADGIASYGTDALRFTFCS-LASTGRDIKFDMGR-------VEGYRNFCNKIWNAARYVLD
SYV_PSE14       ADGIASYGTDALRFTFCS-LASTGRDIKFDMGR-------VEGYRNFCNKIWNAARYVLD
SYV_PSEU2       ADGIASYGTDALRFTFCS-LASTGRDIKFDMGR-------VEGYRNFCNKIWNAARYVLD
SYV_IDILO       PEGITAHGTDALRFTLTA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVLM
SYV_MANSM       PEGIQPHGTDALRFTLSA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLT
SYV_PASMU       PEGIAEHGTDALRFTLTA-LATNGRDINWDMKR-------LEGYRNFCNKLWNASRFVLT
SYV_HAEDU       AGGIAAHGTDALRFTLAA-LASNGRDINWDMKR-------LEGYRNFCNKLWNASRFVLT
SYV_HAEI8       ADGIAAHGTDALRFTLAA-LASNGRDINWDMKR-------LEGYRNFCNKLWNASRFVLT
SYV_HAEIN       AEGIAAHGTDALRFTLAA-LASNGRDINWDMKR-------LEGYRNFCNKLWNASRFVLT
SYV_COLP3       PEGIEAHGTDALRFTLTS-VATTGRDISWDMKR-------LEGYRNFTNKLWNASRYVMM
SYV_PHOPR       EGGIEPYGTDALRFTLAA-MASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVLM
SYV_ALIF1       ENGIEPYGTDALRFTLAA-MASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVLM
SYV_VIBCH       ENGIEAYGTDSLRFTLAA-MASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVLM
SYV_VIBVU       ENGIEAYGTDALRFTLAA-MASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVMM
SYV_VIBVY       ENGIEAYGTDALRFTLAA-MASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVMM
SYV_VIBPA       ENGIEAYGTDALRFTLAA-MASTGRDINWDMKR-------LEGYRNFCNKLWNASRYVMM
SYV_PHOLL       PAGIETHGTDALRFTLAA-LASTGRDINWDMKR-------LQGYRNFCNKLWNASRFVLM
SYV_YERPE       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_YERPS       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_PECAS       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SHIDS       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_ECOL6       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_ECOLI       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_ECO57       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SHIBS       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SHISS       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SHIFL       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SALPA       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SALTI       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SALCH       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_SALTY       PNGIEPHGTDALRFTLAA-LASTGRDINWDMKR-------LEGYRNFCNKLWNASRFVLM
SYV_PSEHT       AGGIEAHGTDALRFTLAA-MASTGRDINWDMNR-------LEGYRNFCNKLWNASRYVLM
SYV_SHEON       ENGIEAHGTDALRFTLAA-MASTGRDINWDMKR-------LDGYRSFCNKLWNASRYVLM
SYV_CHRVO       PEGIPAYGTDALRFTMAS-YATLGRSVNFDFKR-------AEGYRNFCNKLWNATRFVMM
SYV_NEIG1       PEGIPSMGADALRFTMAS-YASLGRSVNFDFKR-------AEGYRNFCNKIWNATNFVLM
SYV_NEIMA       PEGIPSMGADALRFTMAS-YASLGRSVNFDFKR-------AEGYRNFCNKIWNATNFVLM
SYV_NEIMB       PEGIPSMGADALRFTMAS-YASLGRSVNFDFKR-------AEGYRNFCNKIWNATNFVLM
SYV_NITEU       PQGIPAFGTDALRFTFAS-LASHGRDIKFDLQR-------CEGYRNFCNKLWNATRFVLM
SYV_THIDA       PDGIAAYGTDALRFTFAS-LATHGRDIKFDLQR-------AEGYRNFCNKLWNATRFALM
SYV_BORPE       PDGIPAFGTDALRFTMAA-YATLGRNINFDLKR-------CEGYRNFCNKLWNATRFVLM
SYV_BORBR       PDGIPAFGTDALRFTMAA-YATLGRNINFDLKR-------CEGYRNFCNKLWNATRFVLM
SYV_BORPA       PDGIPAFGTDALRFTMAA-YATLGRNINFDLKR-------CEGYRNFCNKLWNATRFVLM
SYV_BURMA       PDGIPAFGTDALRFTMAS-MATLGRNVNFDLAR-------CEGYRNFCNKLWNATRFVLM
SYV_BURPS       PDGIPAFGTDALRFTMAS-MATLGRNVNFDLAR-------CEGYRNFCNKLWNATRFVLM
SYV_CUPPJ       PEGIPAFGADALRFTFAS-LATLGRNINFDTGR-------CEGYRNFCNKLWNATRFVLM
SYV_RALSO       PDGIPAFGADALRFTFAS-LATLGRNINFDSSR-------CEGYRNFCNKLWNATRFVLM
SYV_AROAE       PEGIPAFGTDALRFTFAS-LATPGRDIKFDLSR-------CEGYRNFCNKLWNATRFVLM
SYV_DECAR       PEGIASFGTDALRFTFAS-LASPGRDIKFDLNR-------CDGYRNFCNKLWNATRFVLM
SYV_FUSNN       -----EYGVDAIRFSMIY-NTSQGQDVHFSTDL-------LGMGRNFANKIWNATRFVIM
SYV_BDEBA       -----KHGADALRFTFAA-HLYSGKDFKFSEQR-------LEGYRNFMNKVWNAARFALS
SYV_GLUOX       -----EFGADATRLAICA-GTGPGRDIKLGRKR-------VEEHRAFVTKLWNAARFLEM
SYV_RHOS4       -----EFGADAVRFTLTA-MAAMGRDLKLSTAR-------IQGYRNFGTKLWNACRFAEM
SYV_RUEPO       -----EFGADALRFTNAS-MAAIGGVLKLSKER-------ITGYRNFTTKLWNAIRFAEM
SYV_SPHEL       -----KYGADALRFFMAA-MESQGRDIKMDEKR-------LEGYRNFATKLWNAARFCQA
SYV_ZYMMO       -----KYGADALRFTLCA-MESQGRDIKLDEKR-------VEGYRNFATKLWNAVRFAQN
SYV_CAUVC       -----ELGCDAVRFTLTA-MSGQARDIKLSKQR-------IEGYRNFGTKLWNASRFAQM
SYV_NITWN       -----KYGADALRFTLAA-MAVQGRDIKLSPQR-------VEGYRNFATKFWNACRFAEM
SYV_BRADU       -----EYGADALRFTLAA-MAAQGRDIKLATSR-------VEGYRNFATKLWNASRFAEM
SYV_RHOPA       -----EYGADALRFTLAA-MAAQGRDIKLATSR-------VEGYRNFATKLWNACRFAEM
SYV_BARHE       -----QYSADSLRFTLAI-MAAQGRDVKLDPSR-------IAGYRNFATKLWNATRFAQM
SYV_BARQU       -----QYSADSLRFTLAV-MAAQGRDVKLDPSR-------IAGYRNFATKLWNATRFAKI
SYV_AGRFC       -----EYGADALRFTLAI-MAAQGRDVKLDPAR-------IAGYRNFGTKLWNATRFAEM
SYV_RHIME       -----EYGADALRFTLAI-MAAQGRDVKLDPAR-------IAGYRNFGTKLWNATRFAEM
SYV_RHILO       -----EYGADALRFTLTV-MAAQGRDVKLDPAR-------IAGYRNFGTKLWNATRFAEM
SYV_BRUME       -----EYGADALRFTLAI-MAAQGRDVKLDPAR-------IAGYRNFGTKLWNATRFAQM
SYV_BRUSU       -----EYGADALRFTLAI-MAAQGRDVKLDPAR-------IAGYRNFGTKLWNATRFAQM
SYV_DESPS       -----QYGTDSMRFTLTA-FAAQGREIKLDEDR-------IEGYRHFINKIWNAARFAQM
SYV_DESVH       -----KYGTDSLRFTLAA-FAAMGRDIKLSEDR-------IEGYRHFVNKVWNAARFSLM
SYV_GEOSL       -----QYGTDAFRFTLAA-FAAQGRDIKLAEER-------IAGYRNFVNKIWNASRFALM
SYV_PELCD       -----EYGTDAFRFTLAA-FAAQGRDVKLSVDR-------IAGYRNFVNKLWNASRFALM
SYV_DEHM1       -----QYGTDALRFAVTF-GTSPGNDSKLGQTK-------LEAARNFVNKLWNASRFVIM
SYV_DEHMC       -----QYGTDALRFAVTF-GTSPGNDSKLGQTK-------LEAARNFANKLWNASRFVIM
SYV_SYMTH       -----QYGTDALRFMLVT-GSSPGNDIRFHTER-------VENARNFANKLWNASRFVLM
SYV_LACCA       -----KYGADALRWFLIT-GNKPGQDTRFSYKQ-------VEAAWNFINKIWNISRFVMM
SYV_LACAC       -----KYGADALRWFLLN-GTAPGQDTRFSYTK-------MDAAWNFINKIWNVSRFVIM
SYV_LACJO       -----EYGADALRWFLLN-GTAPGQDTRYDPKK-------MGAAWNFINKIWNASRFVIM
SYV_STAS1       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESIWNFINKIWNAARFSIM
SYV_STAAR       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_STAAC       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_STAAN       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_STAAS       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_STAAW       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_STAAM       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_STAEQ       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNAARFSLM
SYV_STAES       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNAARFSLM
SYV_STAHJ       -----EYGADSLRYFLAT-GSSPGHDLRYSTEK-------VESVWNFINKIWNGARFSLM
SYV_LACPL       -----KYGADALRWFLSN-GSTAGQDVRFSYTK-------MDAAWNFINKIWNASRYVIM
SYV_LACSS       -----KYGADALRWFLTS-GSTPGQDVRFSYTK-------MDAAWNFINKIWNASRFVIM
SYV_ENTFA       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNASRFVIM
SYV_LACLA       -----KYGADALRWFLSN-GSAPGQDVRFSYDK-------MDAAWNFINKIWNVSRYILM
SYV_STRMU       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDAAWNFINKIWNISRYILM
SYV_STRA5       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRA1       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRA3       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRT1       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRT2       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRP1       -----KYGADSLRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRPM       -----KYGADSLRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRP6       -----KYGADSLRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRP3       -----KYGADSLRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRP8       -----KYGADSLRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRPN       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_STRR6       -----KYGADALRWFLSN-GSAPGQDVRFSYEK-------MDASWNFINKIWNISRYILM
SYV_LISIN       -----KYGADSLRYTLAT-GSSPGQDLKFSFEK-------VESTWNFINKIWNASRFVLM
SYV_LISMF       -----KYGADSLRYTLAT-GSSPGQDLKFSYEK-------VESTWNFINKIWNASRFVLM
SYV_LISMO       -----KYGADSLRYTLAT-GSSPGQDLKFSYEK-------VESTWNFINKIWNASRFVLM
SYV_OCEIH       -----KYGADSLRYFLMT-GSTPGQDLRFHWEK-------VESTWNFANKVWNASRFSIM
SYV_BACC1       -----KYGADAMRFFLST-GSAPGQDLRFSMEK-------VESTWNFINKIWNASRFVLM
SYV_BACCZ       -----KYGADAMRFFLST-GSAPGQDLRFSMEK-------VESTWNFINKIWNASRFVLM
SYV_BACCR       -----KYGADAMRFFLST-GSAPGQDLRFSMEK-------VESTWNFINKIWNASRFVLM
SYV_BACAN       -----KYGADAMRFFLST-GSAPGQDLRFSMEK-------VESTWNFINKIWNASRFVLM
SYV_BACHK       -----KYGADAMRFFLST-GSAPGQDLRFSMEK-------VESTWNFINKIWNASRFVLM
SYV_BACSK       -----KYGADSLRFFLAT-GSTPGNDLRFYWEK-------VESTWNFGNKIWNASRFALM
SYV_BACHD       -----KYGADALRFFLAT-GSSPGNDLRFYWEK-------VESTWNFGNKIWNASRFALM
SYV_GEOSE       -----QYGADALRYFLAT-GSSPGQDLRFSTEK-------VEATWNFANKIWNASRFALM
SYV_GEOKA       -----QYGADALRYFLAT-GSSPGQDLRFSTEK-------VEATWNFANKIWNASRFALM
SYV_BACLD       -----KYGADSLRYFLAT-GSSPGQDLRFSFEK-------VESTWNFANKIWNASRFALM
SYV_BACSU       -----KYGADSLRYFLAT-GSSPGQDLRFSYEK-------VESTWNFANKIWNASRFALM
SYV_THEMA       -----EYGADPMRFTLAI-LAAQGRDIKLDPRY-------FDAYKKFANKIWNATRFVLM
SYV_CARHZ       -----SHGADSLRFMLVT-GNTPGNDLRFHFER-------LDGARNFANKLWNASRFVLM
SYV_CALS4       -----KYGADTLRFTLVI-GNAPGNDMRFSWEK-------VEHSRNFANKLWNASRYVLL
SYV_CLOPE       -----EYGADALRFMLVT-GNAPGNDIRYIPER-------VEAARNFANKIWNASRFVMM
SYV_CLOAB       -----TFGADALRFMLIT-GNAPGNDIRYKTEK-------VEAARNFANKIWNASRFVLM
SYV_CLOTE       -----KYGADALRFMLIT-GNAPGNDIRFYEER-------VESARNFANKIWNASRYVMM
                       . *  .                                   .*.::       

SYV_MYCGA       I-------------------------DQSKLT-D--------------------------
SYV_MYCGE       L--------------------------ENDQE----------------------------
SYV_MYCPN       L-------------------------GEQAKT-V--------------------------
SYV_MYCPE       N------------------------SSDFNFD-E--------------------------
SYV_MYCS5       M--------------------------PDNNL----------------------------
SYV_MYCH2       L--------------------------DTFFA----------------------------
SYV_MYCH7       L--------------------------DTFFA----------------------------
SYV_MYCHJ       L--------------------------DTFFA----------------------------
SYV_MYCMO       L------------------------DSDKKEI----------------------------
SYV_MYCPU       Q--------------------------ENTKK----------------------------
SYV_PARUW       N-------------------------LDGNEQNRTMSLT---------------------
SYV_CHLPN       H----------------------ISDLQGKDL----------------------------
SYV_CHLMU       H------------------------ISELTSR-DLEEGV---------------------
SYV_CHLTR       H------------------------ISELTSR-DLEEGV---------------------
SYV_CHLAB       H------------------------ISNLTSQ-DLARGI---------------------
SYV_CHLCV       H------------------------ISNLTSK-DLVYGI---------------------
SYV_ONYPE       N-------------------------TSTLDT-D--------------------------
SYV_UREPA       L--------------------------DEINDNL----N---------------------
SYV_PORGI       ---------------------------KGWQQ-------------------------A-E
SYV_BACFN       ---------------------------KGWEN-------------------------GMG
SYV_BACFR       ---------------------------KGWEN-------------------------GMG
SYV_BACTN       ---------------------------KGWTV-D----D------------------NIQ
SYV_WIGBR       N----------L---------------KNKKV-----------SF---------------
SYV_DEIRA       R--------------------LGEARIEGSDD-L----SAYVRAAVTLPDGVLLRSKDVL
SYV_THET8       S-------------------------REGFQA------K---------------------
SYV_THETH       S------------------------R-EGFQA------K---------------------
SYV_THET2       S------------------------R-EGFQA------K---------------------
SYV_HELPJ       K----------Q---------------ESFKD-K----E---------------------
SYV_HELPY       K----------Q---------------ESFKD-K----E---------------------
SYV_CAMJE       N--------------------------ESKFE------D---------------------
SYV_CAMJR       N--------------------------ESKFE------D---------------------
SYV_HELHP       YLEQLGGKEALK---------------KGFGD-I----N---------------------
SYV_WOLSU       N-------------------------ASSFKT----------------------------
SYV_BORBU       N--------------------------LKNRK----------------------------
SYV_BORBP       N-------------------------LENREI----------------------------
SYV_MESFL       N------------------------LEEDFKP-W----E------------------EQA
SYV_MYCMS       N------------------------LDEDFKF-D----P---------------------
SYV_PELUB       N----------N---------------CDFSK-I----D---------------------
SYV_TREDE       N----------L---------------AGRTI-V----P----VG------------R--
SYV_TREPA       N-------------------------LEGRRV----------------------------
SYV_GLOVI       N----------L---------------DELTP------A------------------ALG
SYV_PROMP       N----------K---------------TFSEN------C------------------SLN
SYV_PROMA       N--------------------------LGDTT-FKETFD---------------------
SYV_PROMT       N--------------------------LEDQD-Y-ENLE---------------------
SYV_PROMM       N--------------------------LGGET-P-ASLG---------------------
SYV_SYNPX       N--------------------------LGDET-P-AQLG---------------------
SYV_THEEB       N----------L---------------EGQTP-GQL--G---------------------
SYV_SYNP6       N----------L---------------DDKTP------E------------------QLG
SYV_NOSS1       N----------L---------------DGLST-G----D------------------LGL
SYV_SYNY3       N-------------------------LDGQTP----------------------------
SYV_LEPIC       N------------------------LEESFVP-IGITPD---------------------
SYV_LEPIN       N------------------------LEESFVP----------------------------
SYV_STRAW       N---------------------------GATV-E----G---------------------
SYV_STRCO       N--------------------------GATVE------G----PL------------P--
SYV_CORJK       N---------------------------GARV-G----E---------------------
SYV_CORDI       N---------------------------GAEV-G----T---------------------
SYV_COREF       N---------------------------GAVS-E----G---------------------
SYV_CORGL       N--------------------------GAVSE------G---------------------
SYV_NOCFA       N---------------------------GAAP-G----E---------------------
SYV_MYCLE       N---------------------------GAAL-V----P---------------------
SYV_MYCBO       N---------------------------GAAP-A----P---------------------
SYV_MYCTU       N---------------------------GAAPAP--------------------------
SYV_MYCPA       N--------------------------GAQLA------E---------------------
SYV_BUCBP       N----------L----------------THEV------E----PVKL----------I--
SYV_BLOFL       H----------T---------------DNYHY------D----IDTK-------------
SYV_BLOPB       H----------T---------------KNQDC------G------------------ISI
SYV_BUCAI       N----------T---------------QDHNF-S----K---------------------
SYV_BUCAP       N----------T---------------KDHDY-F----N---------------------
SYV_FRATT       N----------L---------------DDYKV-C--------------------------
SYV_COXBU       N-------------------------TQEKDL----------------------------
SYV_XYLFA       N----------TADDTAHSPAQHQAGQDGQDA-P----R---------------------
SYV_XYLFT       N----------TAGDTAHSPAQHQAGQDGQDV----------------------------
SYV_XANC8       N----------T---------------EGAQF-S----G---------------------
SYV_XANCP       N----------T---------------EGAQF------S------------------G--
SYV_XANOR       N----------T---------------EGARF-T----G---------------------
SYV_XANC5       N----------T---------------EGARF-T----G---------------------
SYV_XANAC       N----------S---------------EGARF------T------------------G--
SYV_LEGPA       N----------T---------------DEEQI------D----FG------------D--
SYV_LEGPH       N----------T---------------DEEQI------D----FG------------D--
SYV_LEGPL       N----------T---------------DEEQI------D----FG------------D--
SYV_METCA       N----------T---------------EGQDC-G----S---------------------
SYV_NITOC       N--------------------------VSSEI-SVERQG---------------------
SYV_ACIAD       N----------V---------------EGQTV-A----Q---------------------
SYV_PSYA2       N----------------------CVDKEGNAQ----------------------------
SYV_PSEAE       N-------------------------TDGQDT------G---------------------
SYV_PSEPK       K---------------------------GEDC------G----QN------------G--
SYV_PSEF5       K---------------------------GEDC------G----QN------------G--
SYV_PSESM       K---------------------------GEDC-G----Q---------------------
SYV_PSE14       K---------------------------GEDC------G----QN------------G--
SYV_PSEU2       K---------------------------GEDC------G----QN------------G--
SYV_IDILO       S-------------------------TEEHDC------G---------------------
SYV_MANSM       N--------------------------DKLDL-S----T---------------------
SYV_PASMU       N--------------------------DKLDL-S----E---------------------
SYV_HAEDU       N--------------------------DKLDL-S----A---------------------
SYV_HAEI8       N--------------------------EKLDL-S----E---------------------
SYV_HAEIN       N--------------------------EKLDL----------------------------
SYV_COLP3       N----------T---------------EEFDC------G----QSS-------PEGKA--
SYV_PHOPR       N----------T---------------EEHDC------G---------------------
SYV_ALIF1       N----------T---------------EEHDC------G---------------------
SYV_VIBCH       N-------------------------TEEQDC------G---------------------
SYV_VIBVU       N-------------------------TEEQDC------G---------------------
SYV_VIBVY       N-------------------------TEEQDC------G---------------------
SYV_VIBPA       N-------------------------TEEQDC------G---------------------
SYV_PHOLL       N----------T---------------EGQDC------G---------------------
SYV_YERPE       N----------T---------------EGQDC------G---------------------
SYV_YERPS       N----------T---------------EGQDC------G---------------------
SYV_PECAS       N----------T---------------EDQDC------G---------------------
SYV_SHIDS       N----------T---------------EGQDC------G---------------------
SYV_ECOL6       N----------T---------------EGQDC------G---------------------
SYV_ECOLI       N----------T---------------EGQDC------G---------------------
SYV_ECO57       N----------T---------------EGQDC------G---------------------
SYV_SHIBS       N----------T---------------EGQDC------G---------------------
SYV_SHISS       N----------T---------------EGQDC------G---------------------
SYV_SHIFL       N----------T---------------EGQDC------G---------------------
SYV_SALPA       N----------T---------------EEQDC------G---------------------
SYV_SALTI       N----------T---------------EEQDC------G---------------------
SYV_SALCH       N----------T---------------EEQDC------G---------------------
SYV_SALTY       N----------T---------------EEQDC------G---------------------
SYV_PSEHT       N----------T---------------EEQDC------G---------------------
SYV_SHEON       N----------T---------------EGQDC------G----PNS-------PDYQG--
SYV_CHRVO       N----------V---------------DGKDC-G----Q---------------------
SYV_NEIG1       N----------T---------------ENQDC------G----YGA---------TAA--
SYV_NEIMA       N----------T---------------ENQDC------G----YGA---------TAT--
SYV_NEIMB       N----------T---------------ENQDC------G----YGA---------TAA--
SYV_NITEU       N-------------------------CEGKDT------G---------------------
SYV_THIDA       N-------------------------LEGHDC------G---------------------
SYV_BORPE       N----------T---------------EGHAL-D----G---------------------
SYV_BORBR       N----------T---------------EGHAL-D----G---------------------
SYV_BORPA       N----------T---------------EGHAL-D----G---------------------
SYV_BURMA       N----------C---------------EGHDC------G----FDKPEVCGAGDCGPG--
SYV_BURPS       N----------C---------------EGHDC------G----FDKPEVCGAGDCGPG--
SYV_CUPPJ       N----------T---------------EGHDC------G----MGP---C-NNDCGPD--
SYV_RALSO       N----------T---------------EGQDC------G----LQE---C-VGDCGPE--
SYV_AROAE       N----------C---------------EGQDC-GISAAA------------------GSA
SYV_DECAR       N----------V---------------EGHDL------A----LEHQ--QNGPACGGS--
SYV_FUSNN       N----------L---------------KGFDV-K----S---------------------
SYV_BDEBA       N------------------LSDFKAPTEGVKA----------------------------
SYV_GLUOX       N--------------------------GAKPT-E----D---------------------
SYV_RHOS4       N-----------------------GVWEGHAT-Q----A---------------------
SYV_RUEPO       N--------------------------EVFTD-A----V---------------------
SYV_SPHEL       N--------------------------GIAAS-K----S---------------------
SYV_ZYMMO       N--------------------------NCAVN-T----S---------------------
SYV_CAUVC       N--------------------------ECVRV-E----G---------------------
SYV_NITWN       N--------------------------DCVVP-A----R---------------------
SYV_BRADU       N--------------------------HCAVP-E----G---------------------
SYV_RHOPA       N--------------------------GCVAP-A----G---------------------
SYV_BARHE       N--------------------------GVKHD-P----D---------------------
SYV_BARQU       N--------------------------GVKHN-P----A---------------------
SYV_AGRFC       N--------------------------GVKRD-P----H---------------------
SYV_RHIME       N--------------------------GAISS-E----G---------------------
SYV_RHILO       N--------------------------EVARN-D----D---------------------
SYV_BRUME       N--------------------------GVKLA-P----D---------------------
SYV_BRUSU       N--------------------------GVKLA-P----D---------------------
SYV_DESPS       H---------------------------IGDC-D----D------------------SIR
SYV_DESVH       N------------------------L-PEEAP-A---AL---------------------
SYV_GEOSL       N----------L---------------EGFEP-D----T---------------------
SYV_PELCD       N------------------------L-EDFDP-S---GI---------------------
SYV_DEHM1       N--------------------------LGEEK-E--------------------------
SYV_DEHMC       N--------------------------LGEAK------E---------------------
SYV_SYMTH       N----------L---------------ADWQP-A----A---------------------
SYV_LACCA       N----------L---------------GDLDT-P----Q---------------------
SYV_LACAC       N------------------------LPEDAKP-A----H---------------------
SYV_LACJO       N------------------------LPEDAKP-A----H---------------------
SYV_STAS1       N------------------------IGEDFTV-E----Q---------------------
SYV_STAAR       N------------------------IGEDFKV-E----D---------------------
SYV_STAAC       N------------------------IGEDFKV-E----D---------------------
SYV_STAAN       N------------------------IGEDFKV-E----D---------------------
SYV_STAAS       N------------------------IGEDFKV-E----D---------------------
SYV_STAAW       N------------------------IGEDFKV-E----D---------------------
SYV_STAAM       N------------------------IGEDFKV-E----D---------------------
SYV_STAEQ       N------------------------IGEDFKV-E----D---------------------
SYV_STAES       N------------------------IGEDFKV-E----D---------------------
SYV_STAHJ       N------------------------IGDEFKF-E----D---------------------
SYV_LACPL       N----------L---------------GTMDK-P----E---------------------
SYV_LACSS       N------------------------L-EDTPA-P---TK---------------------
SYV_ENTFA       N----------V---------------EGMTA-A----D---------------------
SYV_LACLA       N------------------------A-EDISA-D----A---------------------
SYV_STRMU       N------------------------N-EGLSL-D----Q---------------------
SYV_STRA5       N------------------------N-EGLTL-D----Q---------------------
SYV_STRA1       N------------------------N-EGLTL-D----Q---------------------
SYV_STRA3       N------------------------N-EGLTL-D----Q---------------------
SYV_STRT1       N------------------------N-EGLTL-D----V---------------------
SYV_STRT2       N------------------------N-EGLTL-D----V---------------------
SYV_STRP1       N------------------------N-EGLTL-E----D---------------------
SYV_STRPM       N------------------------N-EGLTL-E----E---------------------
SYV_STRP6       N------------------------N-EGLTL-E----E---------------------
SYV_STRP3       N------------------------N-EGLTL-E----E---------------------
SYV_STRP8       N------------------------N-EGLSL-E----E---------------------
SYV_STRPN       N------------------------N-EGLTL-D----V---------------------
SYV_STRR6       N------------------------N-GGLTL-D----V---------------------
SYV_LISIN       N----------L---------------DGMKY-D----E---------------------
SYV_LISMF       N----------L---------------DGMKY-N----E---------------------
SYV_LISMO       N------------------------L-DGMKY-N----E---------------------
SYV_OCEIH       N----------M---------------EGFTY-E----D---------------------
SYV_BACC1       N----------M---------------DDMKY-E----E---------------------
SYV_BACCZ       N------------------------M-DDMKY-E----E---------------------
SYV_BACCR       N----------M---------------DDMKY-E----E---------------------
SYV_BACAN       N----------M---------------DDMKY-E----E---------------------
SYV_BACHK       N------------------------M-DDMKF-E----E---------------------
SYV_BACSK       N----------M---------------DGFSY-S----D---------------------
SYV_BACHD       N----------M---------------DGMSY-D----E---------------------
SYV_GEOSE       N----------M---------------GGMTY-E----E---------------------
SYV_GEOKA       N------------------------M-GGMTY-E----E---------------------
SYV_BACLD       N----------M---------------DGMTY-E----E---------------------
SYV_BACSU       N------------------------M-DGMTY-D----E---------------------
SYV_THEMA       N---------------------------LEDY-K--------------------------
SYV_CARHZ       N----------L---------------EGFTP-Q----G---------------------
SYV_CALS4       N-------------------------LDENDT----------------------------
SYV_CLOPE       N------------------------L-DRELM-D----K---------------------
SYV_CLOAB       N------------------------L-DKEIM-D----K---------------------
SYV_CLOTE       N------------------------L-DKNLM-E----K---------------------
                                                                            

SYV_MYCGA       --QP--------------L-------DSLDHWIIHRFNEVNAGIQDKLKEYRFALSNKQL
SYV_MYCGE       --IS---YDLDK------L-------SLSETWILAKLDKVIQKITKLLDKFQLALANQIL
SYV_MYCPN       --PS----THLP------S-------TLSERWIWAKLKQLIVQTTKLLDKYQLALANQAL
SYV_MYCPE       --DK----TPKN------L-------EDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKI
SYV_MYCS5       --EA----KSSK------L-------SEQSKWILNKLSALNKQIQKVFKTYDFSIIGVEI
SYV_MYCH2       --KP----------------------DLIDLWMENKIYILKRQIVKNIKKYNFSVIGTEI
SYV_MYCH7       --KP----------------------DLIDLWMENKIYILKRQIVKNIKKYNFSVIGTEI
SYV_MYCHJ       --KP----------------------DLIDLWMENKIYILKRQIVKNIKKYNFSVIGTEI
SYV_MYCMO       --IP----EEIE--------------QNANSWILEKFENLKILIYEKSETFEFSVIGKEI
SYV_MYCPU       --VS--------------M-------SKYDYWISDKFNKVESYVKKFMKKYEFTLIGKEI
SYV_PARUW       --SQ----GFSQGLDEALF-------TLEDRWILSVLNRTVESVNVHLNHYQFDQAAIEA
SYV_CHLPN       --LA--GIDEDS------L-------GLEDFYILDGFNQLIHQLEEAYATYAFDKVATLA
SYV_CHLMU       --NK------DL------L-------GLEDFYILDRFNELLALIDSHYNCYSFDKIAALA
SYV_CHLTR       --NQ------DL------L-------GLEDFYILDRFNELLDLIDGHYNCYSFDKIASLA
SYV_CHLAB       --DT------TL------L-------GLEDYYILDGFNRLLKELHSAYQNYAFDKITTMA
SYV_CHLCV       --DK------DL------L-------GLEDFYILDGFNQLLKQLESAYQSYAFDKITTMA
SYV_ONYPE       --FD----INLL--------------TLTQKALLTQLHLTTQKVTTLYQKYELKEIGKIL
SYV_UREPA       --FE----DVDK------F-------CDVNKWILTELSKLTLEINKNMDKYNLVVATKYL
SYV_PORGI       TSTQ----PEAS--------------ALAVKWFGYRLDEVKTELDDLFSKYRLSEALTLV
SYV_BACFN       TIDI----PADA--------------HLAVQWFDQRLDAAAVEVADLFSKYRLSEALMLI
SYV_BACFR       TIDI----PADA--------------HLAVQWFDQRLDAAAVEVADLFSKYRLSEALMLI
SYV_BACTN       ASDA------AK---------------LAVHWFESKQNEVAAEVADLFSKYRLSEALMAV
SYV_WIGBR       --EE----KEIN------L-------HKIDNWILHKYNKVFKYYKYNIDNFRLDLVVNIL
SYV_DEIRA       AQLK----ERDD------L-------TLADRWIISRLNDVTAEASAQLDAFDIGAAIRTL
SYV_THET8       --------EDTP--------------TLADRFMRSRLSRGVEEITALYEALDLAQAAREV
SYV_THETH       --ED------TP--------------TLADRFMRSRLSRGVEEITALYEALDLAQAAREV
SYV_THET2       --ED------TP--------------TLADRFMRSRLSQGVEEITALYEALDLAQAAREV
SYV_HELPJ       --RL----NEYQ--------------TALGRYAKSRLNLVTKEVRNALDNYRFNDATTLL
SYV_HELPY       --RL----NEYQ--------------TPLGRYAKSRLNSATKEARNALDNYRFNDATTLL
SYV_CAMJE       --LE----NITL------H-------SELAKYIYAKFQTCVKDVRENLDNYRFNDAANTL
SYV_CAMJR       --LE----NITL------H-------SELAKYIYAKFQTCVKDVRENLDNYRFNDAANTL
SYV_HELHP       --HI----H-IN--------------TPLGQYMLVRFYTATNEVRAALENYRFNDGASIL
SYV_WOLSU       --LD----EITP------Q-------TPLGRYMASRFSLCVEELRGALDGYRFNDGATVL
SYV_BORBU       --IL----NDLK------F-------NDIDKWLLTSLNSTILGVESSFANYKYNEASKFV
SYV_BORBP       --FN-----NLK------F-------NDIDKWLLTSLNSTILGVESSFANYKYNEASKFV
SYV_MESFL       ILNS------NS------L-------NETDKWVLTEFSKVSKQVNYLIDKYEFAIAGKML
SYV_MYCMS       --NF----YKTD------L-------EITNQWILTQLSKTQTYVYEKMNKYEFSLAGNHL
SYV_PELUB       --EK----PILS------I--------NINKWIYAELIETKNKIEKNLKDYRFDEAAKNA
SYV_TREDE       --DG----SLNS------L-------KELDRWIYHELNEAAQTVRSSLDSYRYNEAAQKV
SYV_TREPA       --YA---IAHVS------L-------TELDRWIFHTFNETVQQVRTALEAYRFNDAAQAV
SYV_GLOVI       AADP------GS------L-------TLEDRWILGRLGQTARQIDELLGRYALGEAARSL
SYV_PROMP       ESDE------KN------L-------ELSDKWILSKLNQLNTKVSNLLIEYKLGESAKLL
SYV_PROMA       --EL----EHNR------L-------ELSDQWILSKLSKVNNETAKRYKKYALGEAAKGL
SYV_PROMT       --SY----DSSK------L-------QLSDRWILSRLARVNHETANRYENYALGEAAKGL
SYV_PROMM       --EP----DPAS------L-------QLADRWILSRLARMNRDVVERYDSYRLGEAAKCL
SYV_SYNPX       --DP----DPAA------L-------QLADRWILSRLARVNRETAERYSNYGLGEAAKGL
SYV_THEEB       --TP----RRQD------L-------TASDRWILSRYHTAIQTTRERIESYGLGEAAKGL
SYV_SYNP6       MAAT------AD------L-------ELADRWILSRYHATTEALINQIEAYDLGAAAKQL
SYV_NOSS1       GTGN----SQSL------ELSDGVPPSLADRWIISRYHQVIKQTTHYIDNYGLGEAAKGI
SYV_SYNY3       --QQLGLAPGED------L-------ELADRWILSRLNQVIQQTREQIEDYGLGEAAKGL
SYV_LEPIC       --IE------KD------L-------EPMDQWILSRFNHCLEEYNKAHSKFHFYEMAAAI
SYV_LEPIN       --IGITPDIEKD------L-------EPMDQWILSRFNHCLEEYNKAHSKFHFYEMAAAI
SYV_STRAW       -ELP----PVEQ------Q-------SATDRWILSRLNATVAEVDALYDDYQFAKLSDAL
SYV_STRCO       --DA------SR------M-------SSTDRWILSRLNSVVAEVDAYYEDYQFAKLSDAL
SYV_CORJK       --LP----ARET------L-------TDADRWILDRLEEVRQLVDDALDRYEFSLANENL
SYV_CORDI       --LP----ERSE------L-------TDADRWILDRLEEVRVSVDDYFDRYQFAKGNEAL
SYV_COREF       --LP----ERAE------L-------TDADRWILDRLEEVRGHVDDYLDNYQFAKANEEL
SYV_CORGL       --LP----AREE------L-------TDADRWIVDLLEQVRLDVDAYLDNYQFAKANEEL
SYV_NOCFA       --LP----DRGS------L-------TDADRWILDRLDEVLAEVDAAFDAYEFGKACEAL
SYV_MYCLE       --LP----ALTA------L-------TDADRWILGRLEQVRAEVDSAFDGYEFSRACEAL
SYV_MYCBO       --LP----SPNE------L-------TDADRWILGRLEEVRAEVDSAFDGYEFSRACESL
SYV_MYCTU       --LP----SPNE------L-------TDADRWILGRLEEVRAEVDSAFDGYEFSRACESL
SYV_MYCPA       --LP----PLDE------L-------TDADRWILGRLEEVRAEVDSAFDNYEFSRACESL
SYV_BUCBP       --LI------KP------M-------SLSDRWIVAEFHNLVKRYRTALDNYRFDIAANVL
SYV_BLOFL       --NK------KI------F-------SLSDRWITSKLHQTIQKFSQALNDYRFDHTVNIL
SYV_BLOPB       NINE------KS------F-------SLADRWIITKFHQTVQIFHKKLEIYRFDEIANIL
SYV_BUCAI       --FD----VKRK------M-------LLINKWILIEFNNTVKLYRESLDTYRFDIAANIL
SYV_BUCAP       --FS----VNDN------M-------LLINKWILIKFNNTVKSYRNSLDSYRFDIAANIL
SYV_FRATT       --DN------YE------L-------GVADKWIWSVLNTATADVHRHLANYRFDLVTNTI
SYV_COXBU       --NP---EKPLS------Y-------SAADEWIRTRLQQTIKNAEEALSQYRFDLLAQTL
SYV_XYLFA       --TP------QP------R-------TDAEQWILSRLTAITAEAHAQFAAYRFDLLAQAL
SYV_XYLFT       --PR----TPQP------R-------TDAEQWILSRLAAVTAEAHAQFAAYRFDLLAQAL
SYV_XANC8       --VP------QP------Q-------TETERWILARLDAVAAEAQAHYANYRFDLLAQTL
SYV_XANCP       --VP------QP------Q-------TETERWILARLDAVAAEAQAHYANYRFDLLAQTL
SYV_XANOR       --VP------QP------R-------TEAEKWILARLDKVTAETHAHYANYRFDLLAQSL
SYV_XANC5       --VP------QP------R-------TEAEKWILARLDKATAETHAHYANYRFDLLAQSL
SYV_XANAC       --VP------QP------R-------TEAEKWILARLDKVTAETHAHYANYRFDLLAQSL
SYV_LEGPA       --GA------FQ------Y-------SPADQWILSRLQNTVSKVHHYFETYRFDLLANTL
SYV_LEGPH       --GA------FQ------Y-------SPADQWILSRLQNTVSKVHHYFETYRFDLLANTL
SYV_LEGPL       --GA------FQ------Y-------SPADQWILSRLQNTVSKVHHYFETYRFDLLANTL
SYV_METCA       --GG----GACS------Y-------SLPDRWIRSRFQAAVGTVTEAMGQYRFDLAAQAL
SYV_NITOC       --KPEQAEENLM------L-------GAPERWIISRFHSTTQEVIEGIENYRFDRVAQAI
SYV_ACIAD       --EA----RPEL------W-------ELPEQWIMSRLQKAEQAVHQAFATYRLDLAAQTI
SYV_PSYA2       --AIDQTANADV------W-------ELPEKWIMSRLNSTITNIHQHFDQYRLDMVSHDI
SYV_PSEAE       --VN---GEPVE------L-------SSVDRWIISQLQRTEQEVTRQLDAFRFDLAAQAL
SYV_PSEPK       --EA------YE------L-------SLADRWIISQLQRTEAEVTRQLEQFRFDLASQAL
SYV_PSEF5       --EA------YE------L-------SLADRWIISQLQRTEAEVTRQLDQFRFDLAAQAL
SYV_PSESM       --NG----EAVE------L-------SLADRWIISQLQRTEAEVTRQLDQFRFDLAAQAL
SYV_PSE14       --EA------VE------L-------SLADRWIISQLQRTEAEVTRQLDQFRFDLAAQAL
SYV_PSEU2       --EA------VE------L-------SLADRWIISQLQRTEAEVTRQLDQFRFDLAAQAL
SYV_IDILO       --LE---NDDMT------L-------SLADEWIIARFNSTVKDFRQALDTYRFDQAAAIA
SYV_MANSM       --GE------RE------L-------SLADKWIQAEFNKTVQNFRNALDQYRFDLAATEL
SYV_PASMU       --GS------VE------Y-------SVADRWIQSEFNRTVEAFRNALAQFRFDLCATAL
SYV_HAEDU       --GE------VE------Y-------SLADRWIESSFNRTVGEFREALTQYRFDLAANAI
SYV_HAEI8       --GE------IE------F-------SLADRWIQSEFNRTVETFRNSLSQYRFDLCANAI
SYV_HAEIN       --SQ----GEIE------F-------SLADRWIQSEFNRTVETFRSSLSQYRFDLCANAI
SYV_COLP3       --GD------ME------L-------SLADRWIIGQFEQTVKTVHEAFDTYRFDLASQAL
SYV_PHOPR       --MA----EGAE----LEF-------SLADQWITSQFEVAAKEFNAHLDNYRLDMAANTL
SYV_ALIF1       --MSLSAEERAN----MEF-------SLADKWIESQFELAAKEFNAHLDNYRLDMAANTL
SYV_VIBCH       --FA--AGAELE------Y-------SLADKWIESQFELAAKEFNGHIDNFRLDMAANTL
SYV_VIBVU       --FG---AGEIE------Y-------SLADKWIESQFELAAKAFNNHIDNYRLDMAANTL
SYV_VIBVY       --FG---AGEIE------Y-------SLADKWIESQFELAAKAFNNHIDNYRLDMAANTL
SYV_VIBPA       --FN---GGEIE------Y-------SLADKWIESQFELAAKAFNNHIDNFRLDMASNTL
SYV_PHOLL       --QH-----GGE----MAL-------SLADRWILAEFNQTVKAYREALDTYRFDMAANIL
SYV_YERPE       --QN-----GGE----MVL-------SLADRWILAEFNQTIKAYREAMDTYRFDLAAGIL
SYV_YERPS       --QN-----GGE----MVL-------SLADRWILAEFNQTIKAYREAMDTYRFDLAAGIL
SYV_PECAS       --FN-----GGE----MEL-------SLADRWILAEFNRTVKAYRDALDGYRFDIAANIL
SYV_SHIDS       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_ECOL6       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_ECOLI       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_ECO57       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_SHIBS       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_SHISS       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_SHIFL       --FN-----GGE----MTL-------SLADRWILAEFNQTIKAYREALDSFRFDIAAGIL
SYV_SALPA       --FN-----GGE----MTL-------SLADRWILAEFNQTVKAYREALDNFRFDIAAGIL
SYV_SALTI       --FN-----GGE----MTL-------SLADRWILAEFNQTVKAYREALDNFRFDIAAGIL
SYV_SALCH       --FN-----GGE----MTL-------SLADRWILAEFNQTVKAYREALDNFRFDIAAGIL
SYV_SALTY       --FN-----GGE----MTL-------SLADRWILAEFNQTVKAYRDALDSFRFDIAAGIL
SYV_PSEHT       --FA--TDAQKE------L-------SLADRWILGQFESTVKSYTEHLDNYRFDLAANTL
SYV_SHEON       --GE------ME------L-------SLADRWIIDLFNQTVKTYDEHMASYRFDLAANTL
SYV_CHRVO       --DE---SLPLE------Y-------SFVDQWIIGRLQQAEIDVTNALETYRFDIAAQVI
SYV_NEIG1       --EP------RG------H-------SFPDMWIIGRLNQTIEQVTQAYETYRFDLAAETL
SYV_NEIMA       --EP------RG------Y-------SFPDMWIVDRLNQTIEQVTQAYETYRFDLAAETL
SYV_NEIMB       --EP------RG------Y-------SFPDMWIVGRLNQTIEQVTQAYETYRFDLAAETL
SYV_NITEU       --LD--ETLPLN------F-------SQADKWIVGRLQQAEQGVVQAFDEYRFDLAAREM
SYV_THIDA       --QE--ADQPMD------F-------SDADRWIAARLQQAIGDVHEAFAAYRFDQAARAV
SYV_BORPE       --DG------GE------L-------SFADRWIVSQLQALEAEVERGFADYRFDNVANAL
SYV_BORBR       --DG------GE------L-------SFADRWIVSQLQALEAEVERGFADYRFDNVANAL
SYV_BORPA       --DG------GE------L-------SFADRWIVSQLQALEAEVERGFADYRFDNVANAL
SYV_BURMA       --GY------LD------F-------SPADRWIVSLMQRVEADIAKGFADYRFDNIANAI
SYV_BURPS       --GY------LD------F-------SPADRWIVSLMQRVEADIAKGFADYRFDNIANAI
SYV_CUPPJ       --GY------LH------F-------SQADRWIVSLLQRVEADVEKGFAEYRFDNIASAI
SYV_RALSO       --GA------LH------F-------SPADRWIVSLLQRVETEVEKGFADYRFDNIASAI
SYV_AROAE       ACNT----ANLD------F-------SFADRWIVSKLQRTEAEVAQHFRDYRFDLVSKAV
SYV_DECAR       --AP------LE------F-------SFADRWIVSQLQRVEQEVEQHFTDYRFDLIAQAI
SYV_FUSNN       -VDK----TKLD------Y-------ELVDKWIISRLNETAKDVKDCLEKFELDNAAKAV
SYV_BDEBA       --LP----NKVH------I-------SVFDQWIITKLEEVTKTVEEAMEQERFSDASTAL
SYV_GLUOX       --FD----PASV------K-------SALGRWILTEANDAITEAGRALSVYRFDEYASCC
SYV_RHOS4       --AP----PAAT--------------ATVNRWIIGETGRVREEVDAALAAYRFDSAANAL
SYV_RUEPO       --PQLSAAELAP------K-------AAVNRWIIGETARVREEVDAALDSYRFNDAANAL
SYV_SPHEL       --LE----APTA------E-------LAVNRWIIAETIATVXALDLALADLRFDEAANCI
SYV_ZYMMO       --KQ----PPEA------T-------LTTNRWIIAETAKVARALDQHIEDMRYDELANSL
SYV_CAUVC       --FD----PSTV------Q-------QPINKWIRGETVKTVAEVTKALEAPSFDEAAGAL
SYV_NITWN       --FD----PTAA------T-------ETLNRWIVHETARTACEVTEAIESSRFNDAASAI
SYV_BRADU       --FE----PAKA------K-------ETLNRWIAHESAHTTREVTEAIEAYRFNDAAGAI
SYV_RHOPA       --FD----YTAA------K-------ETLNRWIAHETVRAVREVTEAIESYRFNDAAEAA
SYV_BARHE       --FK----PEKA------K-------LALNRWILTELSKTVVAVTTGIENYKFNESASAL
SYV_BARQU       --FK----PEKV------K-------LALNRWILTELSKTVSAVTTGIENYKFNESADAL
SYV_AGRFC       --FL----AETA------S-------LTINRWILTELANTARDVTAALENFRFNDASGIL
SYV_RHIME       --FI----PEAA------S-------LTINRWILTELSRTIRDVSEAIEDYRFNEAAGAL
SYV_RHILO       --FW----LNDA------K-------LAVNRWILTELTRAARQITDGITSYRFNEAAGAA
SYV_BRUME       --FR----PENA------K-------LAVNRWILTELTRATRAVTEGIATYRFNEAAGAA
SYV_BRUSU       --FR----PENA------K-------LAVNRWILTELTRATRAVTEGIATYRFNEAAGAA
SYV_DESPS       VAVE----TPKD------L-------ALGHRWILSRTAKLVEGIHRSLRGYLFNEVASLN
SYV_DESVH       --DL----DNVK--------------GMHHKWILHRLEELKASQAAGIDGYRFNEVAQGL
SYV_GEOSL       -VDP----ATLD------L-------SNADRWILHRLNSAAAETAEALEAYRFNDAAGTL
SYV_PELCD       --DL----DDCQ------L-------TLAERWILTRLIDVAAETGKALEEYKFNEAASVL
SYV_DEHM1       --LL----PEAG------L-------PLEDRWILSRMNRVTADVIRLMEEFQFGEAQRVL
SYV_DEHMC       --LT----PEAE------L-------PLEDRWIISRMNRVTADVTRLMEEFQFGEAQRVL
SYV_SYMTH       --EG----AALQ------Y-------DVADRWIRHRFNEAARAVNELLGEYQYGEAARTI
SYV_LACCA       --QP----DPST------F-------DLSDKWLFAQLNETIKQVMDLSARFEFGEMGRTL
SYV_LACAC       --MP----DTSK------F-------DLSDKWIFDRLNHTIGEVTRLFGEYQFGEAGREA
SYV_LACJO       --MP----DTSK------F-------DLADSWIFDRLNHTVSEVTRLFDEYQFGEAGREL
SYV_STAS1       --VD----LSGD------L-------SLADKWILTRLNETIENVTELSDKYEFGEVGRTL
SYV_STAAR       --ID----LSGN------L-------SLADKWILTRLNETIATVTDLSDKYEFGEVGRAL
SYV_STAAC       --ID----LSGN------L-------SLADKWILTRLNETIATVTDLSDKYEFGEVGRAL
SYV_STAAN       --ID----LSGN------L-------SLADKWILTRLNETIATVTDLSDKYEFGEVGRAL
SYV_STAAS       --ID----LSGN------L-------SLADKWILTRLNETIATVTDLSDKYEFGEVGRAL
SYV_STAAW       --ID----LSGN------L-------SLADKWILTRLNETIATVTDLSDKYEFGEVGRAL
SYV_STAAM       --ID----LSGN------L-------SLADKWILTRLNETIATVTDLSDKYEFGEVGRAL
SYV_STAEQ       --ID----LSGN------L-------SLADQWILTRLNETISTVTELSDKYEFGEVGRAL
SYV_STAES       --ID----LSGN------L-------SLADQWILTRLNETISTVTELSDKYEFGEVGRAL
SYV_STAHJ       --ID----LTGN------L-------SLADKWILTRLNETIETVTNLSEKYEFGEVGRAL
SYV_LACPL       --LP----AASD------W-------TLADKWILSRLNATVKQVTTTFDKFDFGEAGRAL
SYV_LACSS       --VP----EAAN------L-------DLTDKWILSQLNQTVADVTRLYEGFEFGEAGRTL
SYV_ENTFA       --ID----FSGE------K-------TVADRWILTRLNETVARVTELFDRFEFGEAGRQL
SYV_LACLA       --VS----SALT------KVANKTAGNVTDRWILTRLNDTVERVTEQMDKFEFGVAGHIL
SYV_STRMU       --AS----KNVV------LVTNGKAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRA5       --AR----ENVE------KVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHIL
SYV_STRA1       --AR----ENVE------KVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHIL
SYV_STRA3       --AR----ENVE------KVVNSQVGNVTDRWILHNLNETVGKVTESFDKFEFGVAGHIL
SYV_STRT1       --AR----ENVA------KVAAGQAGNVTDRWILHNLNETIGKVTENFDKFEFGVAGHIL
SYV_STRT2       --AR----ENVA------KVAAGQAGNVTDRWILHNLNETIRKVTENFDKFEFGVAGHIL
SYV_STRP1       --AE----SNVA------KVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRPM       --AE----SNVA------KVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRP6       --AE----SNVA------KVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRP3       --AE----SNVA------KVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRP8       --AE----SNVA------KVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRPN       --AH----DNVT------KVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_STRR6       --AH----DNVT------KVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHIL
SYV_LISIN       --ID----LSNV------T-------EVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTL
SYV_LISMF       --ID----LSNV------T-------EVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTL
SYV_LISMO       --ID----LSNV------T-------EVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTL
SYV_OCEIH       --ID----LTGE------L-------SLPDRWILARLNETIEQVTRNSNKYEFGEAGRHL
SYV_BACC1       --ID----LTGE------K-------SVADKWILTRLNETIESVTRNMDKYEFGEAGRSL
SYV_BACCZ       --ID----LTGE------K-------SVADKWILTRLNETIESVTRNMDKYEFGEAGRSL
SYV_BACCR       --ID----LTGE------K-------SVADKWILTRLNETIESVTRNMDKYEFGEAGRSL
SYV_BACAN       --ID----LTGE------K-------SVADKWILTRLNETIESVTRNMDKYEFGEAGRSL
SYV_BACHK       --ID----LTGE------K-------SVADKWILTRLNETIESVTRNMDKYEFGEAGRSL
SYV_BACSK       --ID----INQE------K-------SIADKWILTRLQETVESVTRLIDAYEFGEAGRVL
SYV_BACHD       --ID----LTGE------K-------SIADQWILTRLQETIETVTRLIDAYEFGEVGRHL
SYV_GEOSE       --LD----LSGE------K-------TVADHWILTRLNETIETVTKLAEKYEFGERGRTL
SYV_GEOKA       --LD----LSGE------K-------TVADHWILTRLNETIETVTKLAEKYEFGEVGRTL
SYV_BACLD       --LD----LSGE------K-------SVADKWILTRLNETIETVTQLADKYEFGEVGRHL
SYV_BACSU       --LD----LSGE------K-------SVADKWILTRLNETIEHVTQLADRYEFGEVGRHL
SYV_THEMA       --EV----PLEN------L-------KTVDKWILTRLNKTVEEVTNALENYDFNIAARTI
SYV_CARHZ       --IK-----QEE------L-------TLADRWILARLNAVIDRVTAFLDEYELGEAAREL
SYV_CALS4       --NL----YLDN------L-------ALADKWILTRYNNIVKEITDNLEKFELGVAASKL
SYV_CLOPE       --YK----DCQE------Y-------SLADQWILSRTNSLIKEVTENMEKYELGIALQKV
SYV_CLOAB       --YK----DLEE------Y-------SLADRWILSRCNSLVREVTDNIEKFELGIASQKV
SYV_CLOTE       --YK----DCKD------Y-------NIADTWILSRLNEVIKEVTDNIEKFELGMASQKV
                                                                            

SYV_MYCGA       SDFIWDDFANVYIELNKKAQW--SK----------------AKFELANDIFRKFLIMLHP
SYV_MYCGE       VKFVWDDFCNTFIEAIKKEPNQLKP----------------QLFYTAKSVLSNIAILLSI
SYV_MYCPN       VNFIWNDFCNTFIETIKQEDTALLP----------------QLYTTAKTVLSTAVVMLST
SYV_MYCPE       LDFTWDDFCNTYIELSKNRTS--------------NQE---SKLWVLNYLIKKILILFHP
SYV_MYCS5       YQFIFTDLSSWYIELIKSL----------------------NIKNEAMYVFKKILIMLHP
SYV_MYCH2       NNFIYGDFSSRYIELIKTR----------------------KNGFYARKLLRKVLIILHP
SYV_MYCH7       NNFIYGDFSSRYIELIKTR----------------------KNGFYARKLLRKVLIILHP
SYV_MYCHJ       NNFIYGDFSSRYIELIKTR----------------------KNGFYARKLLRKVLIILHP
SYV_MYCMO       FKFINEDFSSVYIEIIK------GT----------------DSKEFISKIWSNFLILLHP
SYV_MYCPU       YKFIINDFSSWYLEFSKIT----------------------KNIDFQKVIFKRLLLLLHP
SYV_PARUW       YDFFWKEFCAYYVEIAKPILF--GK-----IGTAQERT---NKQKLLVIVLCQAIRLIHP
SYV_CHLPN       YEFFRNDLCSTYIEIIKPTLF--GK-----QGNEASQS---TKRTLLAVLLINVLGVLHP
SYV_CHLMU       YDFFKNDLCSTYLEIIKPTLF--GK-----QGNDEQRA---TKRKLLATLLVNILGVLHP
SYV_CHLTR       YDFFKNDLCSTYLEIIKPTLF--GK-----QDSDQQRA---TKRKLLATLLINILGVLHP
SYV_CHLAB       YEFFRNNFCSTYIEIIKPTLY--GK-----QRSKEDQL---TKQKLLAVLLVNILGVLHP
SYV_CHLCV       YEFFRNDFCSTYIEIIKPTLY--GK-----QGNEEDRL---TKQKLLAVLLVNILGVLHP
SYV_ONYPE       YHFVWEDFANWHLEFAKHDLD--QN-----NSNLTNLH---NSQKFLVYMMKHILQLLHP
SYV_UREPA       YDFIWNTFASYYLEYTKVLLQ---------DLT--LKN---ETIKTIRYVFNKILIMLQP
SYV_PORGI       YKLFWDDFSSWYLEMVKPAYG--QP----------MDA---KTYGSTIGFFDQLLRLLHP
SYV_BACFN       YKLFWDEFSSWLLEIVKPAYG--QP----------VNG---FIYSMTLSAFERLLAMLHP
SYV_BACFR       YKLFWDEFSSWLLEIVKPAYG--QP----------VNG---FIYSMTLSAFERLLAMLHP
SYV_BACTN       YKLFWDEFSSWYLEMIKPAYG--QG----------IDR---TTYSATLCFLDNLLHLLHP
SYV_WIGBR       YEFIWHQFCDWYIENSKIIFK---------NNIISRLN---NTCYTLFFILENSLKMLHP
SYV_DEIRA       YSFTWDEFCDWYIEAAKPELA--SG-----NL---------GTMATLKVVLEHVLKLLHP
SYV_THET8       YELVWSEFCDWYLEAAKPALK--AG-----NA---------HTLRTLEEVLAVLLKLLHP
SYV_THETH       YELVWSEFCDWYLEAAKPALK--AG-----NA---------HTLRTLEEVLAVLLKLLHP
SYV_THET2       YELVWSEFCDWYLEAAKPALK--AG-----NA---------HTLRTLEEVLAVLLKLLHP
SYV_HELPJ       YRFLWGEFCDWFIEFSKV-----EN----------------EAIDELGSVLKEALKLLHP
SYV_HELPY       YRFLWGEFCDWFIEFSKV-----EN----------------EAIDELGSVLKEALKLLHP
SYV_CAMJE       YKFFWDDFCDWGIELSK------------------AEK---SSVKELGSIFKEALKLLNP
SYV_CAMJR       YKFFWDDFCDWGIELSK------------------AEK---SSVKELGSIFKEALKLLNP
SYV_HELHP       YRFLWGEFCDWGIELAK------------------ASK---DSIYELGAIFKAALILLHP
SYV_WOLSU       YRFLWGEFCDWGIELSK------------------ANK---EAINELGAIFREAMKLLHP
SYV_BORBU       YEFFWNDFCDWYIEISKIDLN---------NENVDIQN---MAISKLLFFLKKSLLILHP
SYV_BORBP       YEFFWNDFCDWYIEISKIDLN---------SENVDIQN---MAISKLLFFLKKALLILHP
SYV_MESFL       YDFVWNTYCSWYIEFAKVNLN---------NPK--TKE---ATQQTIVYLLKNILIMLHP
SYV_MYCMS       WDFVWNKYCSWYIEFSKVNLN---------NDK--FTH---QTKQTLFYVLKEILIMLHP
SYV_PELUB       YQFTWHSYCDWYLELSKTILF--SE-----DEK--AKD---EVRQVSAYVFKQILILLHP
SYV_TREDE       YEFFWNNFCDWYVEGTKLSFK--YG-----DEK--EKD---RAASVLLAVLEESLRLLHP
SYV_TREPA       YEFFWNSFCDWYVEASKCSFQ--KP-----DEQ--EKD---RAASVLCTLLEETLRLLHP
SYV_GLOVI       YEFIWDDFCDWYVELAKPRLE-----------ALETRR---GAQQVLAAVLDRTLRLLHP
SYV_PROMP       YEFAWNDFCDWYVEFAKQKFN---------NKETHNRK---ISEKILIKVLTDVLVMMHP
SYV_PROMA       YEFAWNDFCDWYLELIKRRLN-LGE-----SPSEADLSNRKKSQIVMFKVLRELLVMMHP
SYV_PROMT       YEFAWNDFCDWYLELIKRRLNNSEN---LSSDELLDRK---IAKSVLYKVLSDLLIMLHP
SYV_PROMM       YEFAWNDICDWYLELSKRRLH-PGE-----DASGEVLADQCTARQVLAKVLADLLVMLHP
SYV_SYNPX       YEFAWNDVCDWYLELSKRRLN-PGE-----NPSAEALADQRVAKQVLAKVISQMHQMLHP
SYV_THEEB       YEFIWGDFCDWYIELVKPRLQ--GE-----NAK--AKR---TAQQVLATVLDGTLKLLHP
SYV_SYNP6       YEFIWGDFCDWYIELVKPRLY--GE-----DAQ--SRL---VAQQTLAQILEGILRLLHP
SYV_NOSS1       YEFIWGDFCDWYIELVKSRLQ--------KDADPLSRK---AAQQTLAYVLEGILKLLHP
SYV_SYNY3       YEFIWGDFCDWYIELAKPRLWNKEG-----GDVGTQRQL--VARQVLAHTLDSIIKLLHP
SYV_LEPIC       YEFIWGDFCDWYIELVKPRAY--GK-----VSPRSAE----VAKQVLSDVLIRALGLLHP
SYV_LEPIN       YEFIWGDFCDWYIELVKPRAY--GK-----VSPRSAE----VAKQVLSDVLIRALGLLHP
SYV_STRAW       FHFAWDEVFDWYVELSKTTFM--GG--------GEAAK---VSGRVLGEVLDVTLRLLHP
SYV_STRCO       FHFAWDEVFDWYVELSKTTFQ--AG--------GEAAE---VSKRVLGEVLDVTLRLLHP
SYV_CORJK       YRFAWGEFCDWYLEIAKVQIP--RDWDSATEEQVQRGI---RTQIVLGRVLDSVLRLLHP
SYV_CORDI       YQFAWGEFCDWYLEIAKVQIP--RDMEAASAQEQARGR---NTQIVLGQVLDALLRMLHP
SYV_COREF       YHFAWNEFCDWYLEIAKVQIP--RE------GVTERGR---NTQQVLGHVLDALLRLLHP
SYV_CORGL       YHFAWNEFCDWYLEIAKVQIP--RE------GTSAQGE---NTQKVLGHVLDALLRLLHP
SYV_NOCFA       YHFAWDELCDWYLELAKVQFA--AD--------GARAE---STRTVLGTVLDAVLRLLHP
SYV_MYCLE       YHFAWDEFCDWYLELAKAQLA--DG-----------LT---HTTAVLAAALDTLLRLLHP
SYV_MYCBO       YHFAWDEFCDWYLELAKTQLA--QG-----------LT---HTTAVLAAGLDTLLRLLHP
SYV_MYCTU       YHFAWDEFCDWYLELAKTQLA--QG-----------LT---HTTAVLAAGLDTLLRLLHP
SYV_MYCPA       YHFAWDEFCDWYVELAKTQLA--EG-----------IT---HTTAVLATTLDTLLRLLHP
SYV_BUCBP       YEFVWNKFCDFYIELVKSFIN--SC-----SML--ELK---STRCTLVYILDSVLRLAHP
SYV_BLOFL       YEFIWHQFCDWYIEFTKPILY--HS------TNTLQLI---STRYTLITSLESILRLSHP
SYV_BLOPB       HEFIWHQFCDWYLELTKPILY--HG-------NALELR---GTRYTLITLLESLLRLTHP
SYV_BUCAI       YDFIWNIFCDWYLEFVKIVIK--LG-----SSK--EVY---CTKNVLVYVLELLLKLAHP
SYV_BUCAP       YDFIWNVFCDWYLEFVKSVIK--SG-----SYQ--DIY---FTKNVLIHVLELLLRLSHP
SYV_FRATT       YDLVWNNYCDWYVEFAKVALK--DD-----SLSEQQKN---GVKYTLTKVLENILALAHP
SYV_COXBU       YEFTWNEYCDWYVEFAKCILY--DK-----QAKPAQLR---GTRVALLEVLEILLRLLHP
SYV_XYLFA       YEFAWNEFCDWFVELAKPALN--SD-----DTQ--AAA---STRHTLLYVLETLLRLLHP
SYV_XYLFT       YEFAWNEFCDWFVELAKPALN--GD-----DTQ--AAA---STRHTLLYVLETLLRLLHP
SYV_XANC8       YEFAWNAFCDWFVELAKPALN--GA-----VQD--AAD---STRHTLLYVLEALLRLLHP
SYV_XANCP       YEFAWNAFCDWFVELAKPALN--GA-----VQD--AAD---STRHTLLYVLEALLRLLHP
SYV_XANOR       YEFAWNAFCDWFVELAKPALN--NQ-----DTD--AAA---STRHTLLYVLESLLRLLHP
SYV_XANC5       YEFAWNAFCDWFVELAKPALN--NQ-----DAD--AAA---STRHTLLYVLESLLRLLHP
SYV_XANAC       YEFAWNAFCDWFVELAKPALN--HQ-----DAD--AAA---STRHTLLFVLESLLRLLHP
SYV_LEGPA       YEFVWHEYCDWYLELSKPILQ--DD-----QALSAMKR---GTRRTLIHVLDQILKLLHP
SYV_LEGPH       YEFVWHEYCDWYLELSKPILQ--DD-----QALSAMKR---GTRRTLIHVLDQILKLLHP
SYV_LEGPL       YEFVWHEYCDWYLELSKPILQ--DD-----QALSAMKR---GTRRTLIHVLDQILKLLHP
SYV_METCA       YEFVWNEYCDWYLELAKVVLQ--SG-----NEA--ERR---GTRQTLAGVLESLLRLAHP
SYV_NITOC       YNFTWNEYCDWYLELSKPVLN--NP-----ASPEAAKR---RTRHTLVHVLEALLRLAHP
SYV_ACIAD       YDFIWNEYCDWYVELTKPVLN--DA-----EVSEERKA---EVRRVLLAVMEASLRLAHP
SYV_PSYA2       YEFIWNEYCDWYVELAKASLN--DD-----SVSDERKA---QIRYVLLHVLETALRFSHP
SYV_PSEAE       YEFIWDEYCAWYLELVKPVLW--DE-----NAPIERQR---GTRRTLIRVLETALRLAHP
SYV_PSEPK       YEFIWNQYCDWYLELSKPVLW--DE-----NAPVERAR---GTRRTLVRVLEVALRLAHP
SYV_PSEF5       YEFIWNQYCDWYLELSKPVLW--DE-----NSPVERQR---GTRRTLVRVLEVALRLAHP
SYV_PSESM       YEFIWNQYCDWYLELSKPVLW--DE-----TASIERQR---GTRRTLVRVLEVALRLAHP
SYV_PSE14       YEFIWNQYCDWYLELSKPVLW--DE-----TAPVERQR---GTRRTLVRVLEVALRLAHP
SYV_PSEU2       YEFIWNQYCDWYLELSKPVLW--DE-----TAPVERQR---GTRRTLVRVLEVALRLAHP
SYV_IDILO       YEFTWNQFCDWYLELTKPVLQ--NG-----TES--QQR---GTRHTLVNVLEQLLRLLHP
SYV_MANSM       YEFTWNQFCDWYLELTKPVFA--NG-----TDA--QIR---AASFTLVNVLEKLLRLAHP
SYV_PASMU       YEFTWNQFCDWYLELTKPVLV--NG-----SVA--QKR---GASQTLINVLEKLLRLTHP
SYV_HAEDU       YEFTWNQFCDWYLELTKPVFA--NG-----SDA--QKR---ATSKTLVSLLEKLLRLAHP
SYV_HAEI8       YEFTWNQFCDWYLELTKPVFA--NG-----NAA--QIR---AASQTLVHVLEKLLRLAHP
SYV_HAEIN       YEFTWNQFCDWYLELTKPVFA--NG-----NAA--QIR---AASQTLVHVLEKLLRLAHP
SYV_COLP3       YEFTWNQFCDWYLELTKPVLF--KE-----NEA--QQR---GTRHTLVNVLEALLRLMHP
SYV_PHOPR       YEFIWNQFCDWYLELTKPVLW--KG-----TEA--QQR---ATRYTLITVLEKTLRLAHP
SYV_ALIF1       YEFIWNQFCDWYLELTKPVLW--KG-----TEA--QQQ---ATRYMLITVLEKTLRLAHP
SYV_VIBCH       YEFIWNQFCDWYLELTKPVLW--KG-----TEA--QQR---ATRRTLITVLEKTLRLAHP
SYV_VIBVU       YEFIWNQFCDWYLELTKPVLW--KG-----TEA--QQR---GTRRTLITVLEKTLRLAHP
SYV_VIBVY       YEFIWNQFCDWYLELTKPVLW--KG-----TEA--QQR---GTRRTLITVLEKTLRLAHP
SYV_VIBPA       YEFIWNQFCDWYLELTKPVLW--KG-----TEA--QQR---GTRRTLITVLEKTLRLAHP
SYV_PHOLL       YEFTWNQFCDWYLELSKPAIN--KG-----SEA--EVR---GARHTLIEVLEGLLRLAHP
SYV_YERPE       YEFTWNQFCDWYLELTKPVMN--SG-----SEA--ELR---GTRHTLIQVLEALLRLAHP
SYV_YERPS       YEFTWNQFCDWYLELTKPVMN--SG-----SEA--ELR---GTRHTLIQVLEALLRLAHP
SYV_PECAS       YEFTWNQFCDWYLELTKPVMN--GG-----SEA--ELR---GTRHTLVTVLEALLRLAHP
SYV_SHIDS       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTHHTLVTVLEGLLRLAHP
SYV_ECOL6       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTRHTLVTVLEGLLRLAHP
SYV_ECOLI       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTRHTLVTVLEGLLRLAHP
SYV_ECO57       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SHIBS       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SHISS       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SHIFL       YEFTWNQFCDWYLELTKPVMN--GG-----TEA--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SALPA       YEFTWNQFCDWYLELTKPVMT--GG-----SES--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SALTI       YEFTWNQFCDWYLELTKPVMT--GG-----SES--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SALCH       YEFTWNQFCDWYLELTKPVMT--GG-----SES--ELR---GTRHTLVTVLEGLLRLAHP
SYV_SALTY       YEFTWNQFCDWYLELTKPVMT--GG-----SES--ELR---GTRHTLVTVLEGLLRLAHP
SYV_PSEHT       YEFTWHQFCDWYLELTKPVLF--KG-----NEA--QQR---GTRNTLITVLESLLRLMHP
SYV_SHEON       YEFTWNQFCDWYLELTKPVLQ--NG-----TEA--QMR---GTRHTLVNVLEAMQRLMHP
SYV_CHRVO       YEFIWNEYCDWYVELAKVQIQ--GG-----NEA--QQR---ATRRTLVRVLEVALRLNHP
SYV_NEIG1       YSFVWNDYCDWYLELAKVQLQ--TG-----CAS--RQR---ATRHTLLRVLEAALRLLHP
SYV_NEIMA       YSFMWNDYCDWYLELAKVQLQ--TG-----CAS--RQR---ATRHTLLRVLEAALRLLHP
SYV_NEIMB       YSFVWNDYCDWYLELAKVQLQ--TG-----CAS--RQR---ATRHTLLRVLEAALRLLHP
SYV_NITEU       YEFVWDEYCDWYVELAKVQLS--SA-----DEA--HQR---ATRRTLVRVLEAALRLAHP
SYV_THIDA       YEFVWDEYCDWYLELAKVQLN--HG-----TPE--QQR---ATRRTLATVLETTLRLAHP
SYV_BORPE       YRYVWDEYCDWYLELAKVQIQ--QG-----TPA--QQL---GTRRTLIRVLEAVLRLAHP
SYV_BORBR       YRYVWDEYCDWYLELAKVQIQ--QG-----TPA--QQL---GTRRTLIRVLEAVLRLAHP
SYV_BORPA       YRYVWDEYCDWYLELAKVQIQ--QG-----TPA--QQL---GTRRTLIRVLEAVLRLAHP
SYV_BURMA       YKFVWDEYCDWYLELAKVQIQ--NG-----TSE--QQR---ATRRTLLRVLETVLRLAHP
SYV_BURPS       YKFVWDEYCDWYLELAKVQIQ--NG-----TPE--QQR---ATRRTLLRVLETVLRLAHP
SYV_CUPPJ       YKFVWDEYCDWYLELAKVQIQ--TG-----TEA--QQR---ATRRTLLRVLETVLRLAHP
SYV_RALSO       YKFVWDEYCDWYLELAKVQIQ--TG-----TPA--QQR---ATRRTLLRVLETVLRLAHP
SYV_AROAE       YEFVWDEYCDWYVELAKVQIQ--SG-----TEA--QQR---ATRRTLLRVLETVLRLAHP
SYV_DECAR       YKFIWDEFCDWYLEIAKVEIQ--TG-----NDA--QQR---GARRTLVRTLEAVLRLAHP
SYV_FUSNN       YEFLRGDFCDWYVEIAKIRLY--ND-----DED--KKISKLTAQYMLWTILEQGLRLLHP
SYV_BDEBA       YQFIWNQFCDWYIEFTKPILN--GN-----NAE--EKA---ATQLVIAQVLNRIMRLLHP
SYV_GLUOX       YRFVWSRFCDWFVEFSKPVFA--AE-----NEE--TA----ELRAVSAHVLGLILRLMQP
SYV_RHOS4       YAFVWGKVCDWYVEFSKPLFD--TE----------AAA---ETRATMGWVLDQCMVLLHP
SYV_RUEPO       YAFVWGKVCDWYVELSKPLLQ--GE-----DTE--AQA---ETRATMRWVMDQCLVLLHP
SYV_SPHEL       YQFVWSRFCDWYLELIKPVLQ--GE-----GVAAAQAE---ETRAVAGWALDQILVMLHP
SYV_ZYMMO       YHFVWNDFCDWYLELIKPILT--ST-----EDQ--NQGELQETLAVLGWVIDQILIMLHP
SYV_CAUVC       YRFVWNVFCDWYLELAKPILN--GD-----DAA--AKA---ETRATAAWALDVILKLLHP
SYV_NITWN       YRFVWNVYCDWYLELAKPVIL--GE-----DSP--AKS---ETRAMVAWARDEILKLLHP
SYV_BRADU       YRFVWNVYCDWYVELAKPVLL--GP-----DSP--AKD---ETRAMVAWARDEILKLLHP
SYV_RHOPA       YRFVWNVYCDWYLELAKPVLM--GE-----EGA--AKT---ETRAMVAWARDEILKILHP
SYV_BARHE       YRFIWNTLCDWYLELLKPIFQ--GS-----NED--AKN---EVQACTAWVLDEVYKLLHP
SYV_BARQU       YRFIWNTLCDWYLELLKPVFQ--SF-----NEE--AKN---EAQACTAWVLDEVYKLLHP
SYV_AGRFC       YRFVWNQFCDWYLELLKPVFS--GE-----DEE--AKR---ESQACAAYVLEEIYKLLHP
SYV_RHIME       YRFVWNQFCDWYLELLKPVFN--GD-----DEA--AKR---ESQACTAYVLDEIYKLLHP
SYV_RHILO       YRFVWNLFCDWYLELLKPVFM--GT-----DEA--AKA---ESRACVAFVLDEIYKLLHP
SYV_BRUME       YRFVWNQFCDWYLEFLKPIFM--GD-----DEA--AKA---EAQATAAYCLDQVYKLLHP
SYV_BRUSU       YRFVWNQFCDWYLEFLKPIFM--GD-----DEA--AKA---EAQATAAYCLDQVYKLLHP
SYV_DESPS       YQFIWKEFCDWYLEWIKSDLF--SD-----DLV--ARD---QARGCLMVVLETILKTLHP
SYV_DESVH       YRFWWNEFCDWYLELIKPDMQ--AG-----GE---RQA---TAQYVLWTVLREALLLLHP
SYV_GEOSL       YRFTWSEFCDWYIELAKDDLY--RG-----DDA--RKE---TARYVLWLVLENLLRLLHP
SYV_PELCD       YAFTWHEFCDWYIELSKDDLY--GE-----DAA--RKA---TSQAVLYTVLEQLLRLLHP
SYV_DEHM1       QDFVWGEFCDWYIELAKVRLR--DE----------ASV---SPRPVLVKVLSTILRLLHP
SYV_DEHMC       QDFIWGEFCDWYIELAKVRLR--DE----------ASV---SPRPVLVRVLSSILRLLHP
SYV_SYMTH       YDFIWSEFCDWYIELVKPRLY--NP-----ADP--TRA---AAQETLARVLEGTLRLLHP
SYV_LACCA       YNFTWNVLADWYVEMSKEVLY--GD-----DEQ--AKA---AKRVNLAYALDQILRLLHP
SYV_LACAC       YNFIWNDFCDWYIEISKVALN--GD-----DEE--LKA---RKQENLIWILDQILRLMHP
SYV_LACJO       YNFIWNDFCDWYIEISKVALN--GD-----DEE--LKT---RKQENLIWILDQILRLLHP
SYV_STAS1       YNFIWDEFCDWYIEMSKIPMN--GE-----DEA--QKQ---ITRSVLTYVLDNTMRMLHP
SYV_STAAR       YNFIWDDFCDWYIEMSKIPMN--GN-----DEE--QKQ---VTRSVLSYTLDNIMRMLHP
SYV_STAAC       YNFIWDDFCDWYIEMSKIPMN--SN-----DEE--QKQ---VTRSVLSYTLDNIMRMLHP
SYV_STAAN       YNFIWDDFCDWYIEMSKIPMN--SN-----DEE--QKQ---VTRSVLSYTLDNIMRMLHP
SYV_STAAS       YNFIWDDFCDWYIEMSKIPMN--SN-----DEE--QKQ---VTRSVLSYTLDNIMRMLHP
SYV_STAAW       YNFIWDDFCDWYIEMSKIPMN--SN-----DEE--QKQ---VTRSVLSYTLDNIMRMLHP
SYV_STAAM       YNFIWDDFCDWYIEMSKIPMN--SN-----DEE--QKQ---VTRSVLSYTLDNIMRMLHP
SYV_STAEQ       YNFIWDEFCDWYIEMSKIPMN--GE-----DES--QKQ---TTRSVLSYVLDKIMKMLHP
SYV_STAES       YNFIWDEFCDWYIEMSKIPMN--GE-----DES--QKQ---TTRSVLSYVLDKIMKMLHP
SYV_STAHJ       YNFIWDEFCDWYIEMSKIPMN--GE-----DEA--QKQ---TTRSVLSYTLDQIMRMLHP
SYV_LACPL       YNFIWNDFCDWYIEMSKEVLT--GD-----DAQ--AKA---NTQNVLAYVLDQILRLLHP
SYV_LACSS       YNFIWNDFCDWYIEMAKEVLY--GD-----DQE--AIA---NKRYNLAYVLDQTLRLLHP
SYV_ENTFA       YNFIWDDFCDWYIEMSKEILY--GD-----NEA--AKQ---TTRSILVYTLDQILRLLHP
SYV_LACLA       YNFIWDEFANWYLELTKEVMF--GE-----DEA--EKD---ITRAVLLHVLDQVLRLLHP
SYV_STRMU       YNFIWDEFADWYVELTKEVLY--SE-----DEA--EKV---ITRSVLLYTLDKILRLLHP
SYV_STRA5       YNFIWEEFANWYVELTKEVLY--SD-----NED--EKV---ITRSVLLYTLDQILRLLHP
SYV_STRA1       YNFIWEEFANWYVELTKEVLY--SD-----NED--EKV---VTRSVLLYTLDQILRLLHP
SYV_STRA3       YNFIWEEFANWYVELTKEVLY--SD-----NED--EKV---VTRSVLLYTLDQILRLLHP
SYV_STRT1       YNFIWDEFADWYVELTKEVLY--SD-----NED--EKV---ITRSVLLYTLDQILRLLHP
SYV_STRT2       YNFIWDEFADWYVELTKEVLY--SD-----NED--EKV---ITRSVLLYTLDQILRLLHP
SYV_STRP1       YNFIWEEFANWYVELTKEVLY--SD-----NEA--EKV---ITRSVLLYTLDKILRLLHP
SYV_STRPM       YNFIWEEFANWYVELTKEVLY--SD-----NEA--EKV---ITRSVLLYTLDKIVRLLHP
SYV_STRP6       YNFIWEEFANWYVELTKEVLY--SD-----NEA--EKV---ITRSVLLYTLDKILRLLHP
SYV_STRP3       YNFIWEEFANWYVELTKEVLY--SD-----NEA--EKV---ITRSVLLYTLDKILRLLHP
SYV_STRP8       YNFIWEEFANWYVELTKEVLY--SD-----NEA--EKV---ITRSVLLYTLDKILRLLHP
SYV_STRPN       YNFIWEEFANWYVELTKEVLY--SD-----NED--DKV---ITRSVLLYTLDKILRLLHP
SYV_STRR6       YNFIWEEFANWYVELTKEVLY--SD-----NED--DKV---ITRSVLLYTLDKILRLLHS
SYV_LISIN       YNFIWDDFCDWYIEIAKIPLY--GE-----DEV--AKQ---TTRSVLAYTLNTTMRLLHP
SYV_LISMF       YNFIWDDFCDWYIEIAKIPLY--GE-----DEV--AKQ---TTRSVLAYTLNATMRLLHP
SYV_LISMO       YNFIWDDFCDWYIEIAKIPLY--GE-----DEV--AKQ---TTRSVLAYTLNATMRLLHP
SYV_OCEIH       YNFIWDEFCDWYIEMAKLSLY--GE-----DEN--KKK---TTRSVLAHVLDQTMRMLHP
SYV_BACC1       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILAYVLDQTMRLLHP
SYV_BACCZ       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILAYVLDQTMRLLHP
SYV_BACCR       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILAYVLDQTMRLLHP
SYV_BACAN       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILAYVLDQTMRLLHP
SYV_BACHK       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILSYVLDQTMRLLHP
SYV_BACSK       YSFIWDDVCDWYIEMAKLALY--GE-----NEQ--AKQ---ATRSVLAHVLDQTMRMLHP
SYV_BACHD       YNFIWDDLCDWYIEMAKLPLY--GE-----DEV--AKK---TTRSVLAYVLDQTMRLLHP
SYV_GEOSE       YNFIWDDLCDWYIEMAKLPLY--GD-----DEA--AKK---TTRSVLAYVLDNTMRLLHP
SYV_GEOKA       YNFIWDDLCDWYIEMAKLPLY--GA-----DEA--AKK---TTRSVLAYVLDNTMRLLHP
SYV_BACLD       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILAYVLDQTMRLLHP
SYV_BACSU       YNFIWDDFCDWYIEMAKLPLY--GE-----DEA--AKK---TTRSILAYVLDQTMRLLHP
SYV_THEMA       YNFFWDDFCDWYIEASKPRLK--TE----------ERN---LVQTVLVKVLDASLRLLHP
SYV_CARHZ       YEFIWDEFCDWYVELTKPRLY--GK------MP--GGD---TAREVLYAVLKTTLELLHP
SYV_CALS4       YDFVWSEFCDWYIELSKPVLY--SD-----NEE--AKK---VTKSVLRYVLDNTLRLLHP
SYV_CLOPE       HDFLWTEFCDYYIELVKPVLY--GD-----DEK--AKG---VVFNVLYTVLNTGLKLLHP
SYV_CLOAB       YDFMWNEFCDWYIELVKPVMY--GE-----DEK--AKG---IAYNVLYKVLTVGLQLLHP
SYV_CLOTE       YDFMWNEFCDWYIELSKPVLY--GE-----DEK--AKG---VTFNVLFNVLTSGLKLLHP
                            :*  *                                           

SYV_MYCGA       SVPFITEQIYNTF--------------------EFSDSKP--------------------
SYV_MYCGE       TVPFLSERIYQQF------------------------NNK--------------------
SYV_MYCPN       VTPFLAERIYQQF------------------------HSG--------------------
SYV_MYCPE       MCPFVTSNLYDNF--------------------KF--KTK-------------------D
SYV_MYCS5       FLPFTSDYLFNKL------------------------YNE--------------------
SYV_MYCH2       FLPFLTDFLMEKI------------------------FKM--------------------
SYV_MYCH7       FLPFLTDFLMEKI------------------------FKM--------------------
SYV_MYCHJ       FLPFLTDFLMEKI------------------------FKM--------------------
SYV_MYCMO       FLPFLTDHLYFEL------------------------NKK--------------------
SYV_MYCPU       FIPFLTDHLFKII------------------------YDQ--------------------
SYV_PARUW       MAPFITEELFHIL-KERLEGVEALTNADPYTKECIQALQS-------------------S
SYV_CHLPN       VAPFITESLFLRI-QDTLGALPE-GDGDAFTGHALRMLRS-------------------R
SYV_CHLMU       IVPYITETLFQKI-KTTLGVVGD-GLGDAVTGHAVSMLRS-------------------E
SYV_CHLTR       IVPYITETLFQKL-KATLGTVEN-GKGDSVTGHAVSMLRS-------------------E
SYV_CHLAB       IAPFVTETLFLKL--KEVIGEIKEECSDAITAHALAMLRA-------------------D
SYV_CHLCV       ITPFVTETLFLKL-KATLGDVDA-PCADTITAHALDMLRA-------------------E
SYV_ONYPE       FIPFVTDALYENF------------------------DNK-------------------T
SYV_UREPA       FAPNISEEIWLCL-N----------------------QTN-------------------N
SYV_PORGI       FMPFITEELWHAL-EPR--------------------HDG-------------------E
SYV_BACFN       FMPFITEELWQQL-RER--------------------EPG-------------------A
SYV_BACFR       FMPFITEELWQQL-RER--------------------EPG-------------------A
SYV_BACTN       FMPFITEELWQQM-YERNA------------------EEG-------------------E
SYV_WIGBR       FIPFITEEIWKNL-SKMVRN-----------------ERK-------------------N
SYV_DEIRA       FMPFITSELYAAL-G----------------------HRR--------------------
SYV_THET8       MMPFLTSELYQAL------------------------TGK-------------------E
SYV_THETH       MMPFLTSELYQAL------------------------TGK-------------------E
SYV_THET2       MMPFLTSELYQAL------------------------TGK-------------------E
SYV_HELPJ       FMPFISESLYHKL-SNTEL------------------ENA-------------------H
SYV_HELPY       FMPFISESLYHKL-SNTEL------------------ENT-------------------E
SYV_CAMJE       FMPFISEYLYHKL-SDTEL------------------KTS-------------------P
SYV_CAMJR       FMPFISEYLYHKL-SDTEL------------------KTS-------------------P
SYV_HELHP       YMPFITDALWHTL-NASDI------------------QTS-------------------D
SYV_WOLSU       YMPFISEHLYQKL-GGARL------------------EES-------------------T
SYV_BORBU       FIPFVTEKIYSEF-A----------------------EKE-------------------D
SYV_BORBP       FIPFVTEKIYSEF-S----------------------EKG-------------------D
SYV_MESFL       YLPFVTEHIYKTL------------------------DMK-------------------N
SYV_MYCMS       LIPFVSEEIYLNM------------------------MLK-------------------E
SYV_PELUB       FIPFVTEEIWLNN--------------------KFDNTGK-------------------D
SYV_TREDE       FLAFVTEEIYSKLPGNCAEGALP--------------RAK--------------------
SYV_TREPA       FLPFVTEEIYRSL-SPSVHDTTQ----------AIPSGAH-------------------A
SYV_GLOVI       WMPHLSEEIWQLL------------------------HQP------------------LE
SYV_PROMP       FMPHITEELWHKL-Q----------------------IKP-------------------E
SYV_PROMA       LMPHLTEELWHGV-T----------------------GFS-------------------N
SYV_PROMT       LMPHLTEELWHGL--------------------TGLDEDQ--------------------
SYV_PROMM       LMPHLSEELWHGL-TGAP-------------------KDT--------------------
SYV_SYNPX       LMPHLTEELWHSV-T----------------------GKS-------------------E
SYV_THEEB       FMPHITEEIWHTL------------------------HQV------------------AD
SYV_SYNP6       FMPHVTEEIWHTL-N----------------------QVG-------------------E
SYV_NOSS1       FMPHITEEIWQTL-TQQPED-----------------SPQ--------------------
SYV_SYNY3       FMPHITEELWQTL------------------------HQA-------------------E
SYV_LEPIC       FMPFLTEEVHSVF------------------------SDQ--------------------
SYV_LEPIN       FMPFLTEEVHSVF------------------------SDQ--------------------
SYV_STRAW       IVPFVTETLWTTL------------------------TGG-------------------E
SYV_STRCO       VVPFVTETLWTTL------------------------TGG-------------------E
SYV_CORJK       AMPFVTETLWKAL------------------------TDG--------------EEGYSE
SYV_CORDI       AMPFVTEVLWKAL------------------------TDG-------------------E
SYV_COREF       AMPFVTEVLWKAL------------------------TDG-------------------E
SYV_CORGL       AMPFVTEVLWQAL------------------------TDR-------------------T
SYV_NOCFA       VIPFVTESLWKAL------------------------TGG-------------------E
SYV_MYCLE       VMPFITETLWQAL------------------------TQL-------------------E
SYV_MYCBO       VIPFLTEALWLAL------------------------TGR-------------------E
SYV_MYCTU       VIPFLTEALWLAL------------------------TGR-------------------E
SYV_MYCPA       VIPFITEALWQAL------------------------TGN-------------------E
SYV_BUCBP       IIPFITEEIWQKL-QVFVKK-----------------NDK-------------------N
SYV_BLOFL       IIPFITEKIWQKI-HSIVTT-----------------NNK-------------------H
SYV_BLOPB       IIPFITEKIWQEV-KTVTG------------------NNG-------------------T
SYV_BUCAI       IMPFITETIWQRI-K-LIQN-----------------ISE-------------------K
SYV_BUCAP       IMPFITEAIWQRV-K-IIKH-----------------IKD-------------------R
SYV_FRATT       LIPFITESIYQQL-K-AHLN-----------------DAK-------------------D
SYV_COXBU       VMPFITEEIWQTV-A-PLAG-----------------KEG-------------------K
SYV_XYLFA       LIPFITEELWRQV-A-PRLG-----------------IQA-------------------T
SYV_XYLFT       LIPFITEELWCQV-A-PRLG-----------------IQA-------------------T
SYV_XANC8       LTPFVTEELWQQV-A-PRLG-----------------ITG-------------------D
SYV_XANCP       LTPFVTEELWQQV-A-PRLG-----------------ITG-------------------D
SYV_XANOR       LTPFVTEELWQQV-V-PRLG-----------------ITT-------------------A
SYV_XANC5       LTPFVTEELWQQV-A-PRLG-----------------ITT-------------------A
SYV_XANAC       LTPFVTEELWQQV-A-PRLG-----------------ITT-------------------A
SYV_LEGPA       LMPFITEEIWQKT-T-KFTS-----------------ENG-------------------I
SYV_LEGPH       LMPFITEEIWQKT-T-KFTS-----------------ENG-------------------I
SYV_LEGPL       LMPFITEEIWQKT-T-KFTS-----------------ENG-------------------I
SYV_METCA       FMPFITEEIWTRV-A-PLTG-----------------AFA-------------------P
SYV_NITOC       IIPFITEEIWQQV-G-PLAG-----------------RQG-------------------K
SYV_ACIAD       LMPYLTEEIWQTL-A-PMIG-----------------KGG-------------------D
SYV_PSYA2       IMPYLTEQIWQTI-A-PLLNR----------------KET-------------------D
SYV_PSEAE       FMPFITEEIWQRI-K-GQAG-----------------KEG-------------------P
SYV_PSEPK       FMPFITEEIWQRI-A-PLAG-----------------IDG-------------------K
SYV_PSEF5       FMPFITEEIWQRL-A-PLAG-----------------STG-------------------K
SYV_PSESM       FMPFITEEIWQRL-A-PLAG-----------------VEG-------------------K
SYV_PSE14       FMPFITEEIWQRL-A-PLAG-----------------AQG-------------------K
SYV_PSEU2       FMPFITEEIWQRL-A-PLAG-----------------AQG-------------------K
SYV_IDILO       VMPYITETIWQRV-K-PLVG-----------------NTD-------------------D
SYV_MANSM       LIPFITEEIWQKV-K-DFAG-----------------VEG-------------------E
SYV_PASMU       VMPFITEEIWHKV-K-AFAG-----------------VSG-------------------D
SYV_HAEDU       IMPFITEEIWQKV-K-HFAG-----------------VEG-------------------D
SYV_HAEI8       LIPFITEEIWQKV-K-GFVG-----------------ITA-------------------D
SYV_HAEIN       LIPFITEEIWQKV-K-GFVG-----------------ITA-------------------D
SYV_COLP3       IMPFITETIWQRVQPLSDFS-----------------KNG-------------------D
SYV_PHOPR       ILPYITESIWQSV-KPLVDG-----------------VEG-------------------E
SYV_ALIF1       VLPYITESIWQSV-KPLVDG-----------------VEG-------------------D
SYV_VIBCH       VIPYITETIWQSV-KPLVDG-----------------VEG-------------------D
SYV_VIBVU       VIPYITETIWQSI-KPLVDG-----------------VEG-------------------E
SYV_VIBVY       VIPYITETIWQSI-KPLVDG-----------------VEG-------------------E
SYV_VIBPA       VIPYITETIWQSI-KPLVEG-----------------VEG-------------------E
SYV_PHOLL       IIPFITETIWQRV-K-IVKG-----------------IEA-------------------D
SYV_YERPE       IIPYITETIWQRV-K-NLKG-----------------ITA-------------------D
SYV_YERPS       IIPYITETIWQRV-K-NLKG-----------------ITA-------------------D
SYV_PECAS       IIPFITETIWLRV-K-ALKG-----------------IND-------------------D
SYV_SHIDS       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_ECOL6       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_ECOLI       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_ECO57       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_SHIBS       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_SHISS       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_SHIFL       IIPFITETIWQRV-K-VLCG-----------------ITA-------------------D
SYV_SALPA       IIPFITETIWQRV-K-VICG-----------------ITA-------------------D
SYV_SALTI       IIPFITETIWQRV-K-VICG-----------------ITA-------------------D
SYV_SALCH       IIPFITETIWQRV-K-VICG-----------------ITA-------------------D
SYV_SALTY       IIPFITETIWQRV-K-VICG-----------------ITA-------------------D
SYV_PSEHT       MMPYITETIWQRV-A-PLAG-----------------LET-------------------E
SYV_SHEON       MMPYITETIWQRV-K-PLTG-----------------VQG-------------------D
SYV_CHRVO       LMPFITEELWQTV-A-PLANA----------------KKT-------------------E
SYV_NEIG1       IIPFITEELWQTV-A-PMCDA----------------KTA-------------------D
SYV_NEIMA       IIPFITEELWQTV-A-PMCDA----------------KTA-------------------D
SYV_NEIMB       IIPFITEELWQTV-A-PMCDA----------------KTA-------------------D
SYV_NITEU       IIPFITEELWQAV--APLAG-----------------KTG-------------------T
SYV_THIDA       IIPFITEELWQKV-A-PLAGV-----------------HG-------------------D
SYV_BORPE       VIPFITEELWQKV-A-LVAGK-------------RTAGAV-------------------A
SYV_BORBR       VIPFITEELWQKV-A-LVAGK-------------RTAGAV-------------------A
SYV_BORPA       VIPFITEELWQKV-A-LVAGK-------------RTAGAV-------------------A
SYV_BURMA       IIPFITEALWQKV-A-PLAGRYP----------AGKAEGE-------------------A
SYV_BURPS       IIPFITEALWQKV-A-PLAGRYP----------AGKAEGE-------------------A
SYV_CUPPJ       IIPFITEELWQKV-A-PLAGR-------------AKGDGT-------------------E
SYV_RALSO       IIPFITEELWQKV-A-PMAGR-------------AKGDGT-------------------E
SYV_AROAE       LIPFITEELWQTV-A-PLAGR----------------KDT-------------------D
SYV_DECAR       LIPFITEELWQTV-A-PIAGR----------------KTH-------------------D
SYV_FUSNN       FMPFITEEIWQKI-K----------------------VDG-------------------D
SYV_BDEBA       FAPFISEEIYQKL-P----------------------IKG-------------------T
SYV_GLUOX       VIPFVTATLWQEL-G----------------------YPG--------------------
SYV_RHOS4       IMPFITEDLWATT-----G------------------SRT-------------------K
SYV_RUEPO       IMPFITEELWGLT-A----------------------ERA-------------------K
SYV_SPHEL       FMPFITEELWSKM-----G------------------PRE-------------------H
SYV_ZYMMO       IMPFITEELWHAL-G----------------------DRD-------------------H
SYV_CAUVC       VMPFITEELWEKT-----AEFGP--------------ARE-------------------T
SYV_NITWN       FMPFITEELWAVT-----A------------------ERT-------------------R
SYV_BRADU       FMPFITEELWEVT-----A------------------KRD-------------------G
SYV_RHOPA       FMPFITEELWAVT-AP---------------------RDG--------------------
SYV_BARHE       FMPHMTEELWSLT-----ETLGM--------------KRE-------------------D
SYV_BARQU       FMPHMTEELWCLT-ETPNM------------------QRK-------------------D
SYV_AGRFC       FMPFMTEELWAHT-----AGEGE--------------ERD-------------------D
SYV_RHIME       FMPFMTEELWEKT-----TGPGR--------------ERT-------------------T
SYV_RHILO       MMPFMTEELWAQT-----AGEGK--------------ERE-------------------S
SYV_BRUME       FMPFMTEELWSLT-----ASEGK--------------KRD-------------------T
SYV_BRUSU       FMPFMTEELWSLT-----ASEGK--------------KRD-------------------T
SYV_DESPS       ITPFVTEEIWSVL-PG---------------------ERG--------------------
SYV_DESVH       FMPFVTAEVWQAL---PG-------------------HAG-------------------D
SYV_GEOSL       FMPFITEEIWQTL---PGA------------------RPA-------------------P
SYV_PELCD       LMPFVTEEIWQAL---PGE------------------RPA-------------------V
SYV_DEHM1       YMPFITEELWSYL-RPYLPKS----------------LGE-------------------T
SYV_DEHMC       YMPFITEELWSYL-RPYLPES----------------LRE-------------------T
SYV_SYMTH       FMPYITEAIWQKL-------P----------------LRSPQVETAPEIARAAGRDALPP
SYV_LACCA       VMPFVHGKLWLAL-P----------------------HTG-------------------K
SYV_LACAC       IMPFVTEKLWLSM-P----------------------HEG-------------------K
SYV_LACJO       IMPFVTEKLWLSM-P----------------------HDG-------------------K
SYV_STAS1       FMPFVTEQIWQNL-P----------------------HEG-------------------E
SYV_STAAR       FMPFVTEKIWQSL-P----------------------HEG-------------------E
SYV_STAAC       FMPFVTEKIWQSL-P----------------------HEG-------------------D
SYV_STAAN       FMPFVTEKIWQSL-P----------------------HEG-------------------D
SYV_STAAS       FMPFVTEKIWQSL-P----------------------HEG-------------------D
SYV_STAAW       FMPFVTEKIWQSL-P----------------------HEG-------------------D
SYV_STAAM       FMPFVTEKIWQSL-P----------------------HEG-------------------D
SYV_STAEQ       FMPFVTETIWQSL-P----------------------HHG-------------------E
SYV_STAES       FMPFVTETIWQSL-P----------------------HHG-------------------E
SYV_STAHJ       FMPFVTEKIWQSL-P----------------------HEG-------------------E
SYV_LACPL       IMPFVTEKIWLSM-P----------------------HVG-------------------E
SYV_LACSS       VMPFVTEEIWQSM-P----------------------HTG-------------------E
SYV_ENTFA       IMPFVTEEIWEKI-P----------------------HQG-------------------E
SYV_LACLA       IMPFFTEEIFEKL-------P----------------NTS-------------------G
SYV_STRMU       IMPFVTEEIFGQY------------------------ADG--------------------
SYV_STRA5       IMPFVTEEIFGQY------------------------AEG--------------------
SYV_STRA1       IMPFVTEEIFGQY------------------------AEG--------------------
SYV_STRA3       IMPFVTEEIFGQY------------------------AEG--------------------
SYV_STRT1       IMPFVTEEIFGQI------------------------SEG--------------------
SYV_STRT2       IMPFVTEEIFGQI------------------------SEG--------------------
SYV_STRP1       IMPFVTEEIYAQY------------------------AQG--------------------
SYV_STRPM       IMPFVTEEIYAQY------------------------AQG--------------------
SYV_STRP6       IMPFVTEEIYAQY------------------------AQG--------------------
SYV_STRP3       IMPFVTEEIYAQY------------------------AQG--------------------
SYV_STRP8       IMPFVTEEIYAQY------------------------AQG--------------------
SYV_STRPN       IMPFVTEEIFGQI------------------------SEG--------------------
SYV_STRR6       IMPFVTEEIFGQY------------------------AEG--------------------
SYV_LISIN       FMPFVTEEIWQNL-P----------------------HEG-------------------E
SYV_LISMF       FMPFVTEEIWQNL-P----------------------HEG-------------------E
SYV_LISMO       FMPFVTEEIWQNL-P----------------------HEG-------------------E
SYV_OCEIH       FMPFITEEIWQQL-P----------------------HEG-------------------P
SYV_BACC1       FMPFVTEKIWQHL-P----------------------HEG-------------------E
SYV_BACCZ       FMPFVTEKIWQHL-P----------------------HEG-------------------E
SYV_BACCR       FMPFVTEKIWQHL-P----------------------HEG-------------------E
SYV_BACAN       FMPFVTEKIWQHL-P----------------------HEG-------------------E
SYV_BACHK       FMPFVTEKIWQHL-P----------------------HEG-------------------E
SYV_BACSK       FMPFITEEIWQHL-P----------------------HEG-------------------E
SYV_BACHD       LMPFITEEIWQHL-P----------------------HEG-------------------E
SYV_GEOSE       FMPFITEEIWQNL-P----------------------HEG-------------------E
SYV_GEOKA       FMPFITEEIWQNL-P----------------------HEG-------------------E
SYV_BACLD       FMPFLTEEIWQHL-P----------------------HEG-------------------E
SYV_BACSU       FMPFLTEEIWQHL-P----------------------HQG-------------------E
SYV_THEMA       FMPFLTEELWQKL-P----------------------VAG-------------------E
SYV_CARHZ       FMPFITEEIWQRL-P----------------------HEG-------------------K
SYV_CALS4       FMPFITEEIWQNL-P----------------------HEG-------------------E
SYV_CLOPE       VMPFITEEIYTHL-------S----------------TET-------------------E
SYV_CLOAB       VMPYITEEIYQHL-------------------------GG-------------------E
SYV_CLOTE       IMPFITEEIFINI-Q----------------------EEE-------------------K
                  .     :                                                   

SYV_MYCGA       --SIILEKWP----------------------------------------GLIKI--ENA
SYV_MYCGE       --SVMQATWP---------------------------------LAT----KIKIP-----
SYV_MYCPN       --SVMQASWP---------------------------------TAK----AVKPP-----
SYV_MYCPE       --SILLERLD----------------------------------------FKKIS--NLK
SYV_MYCS5       --ELLEQSWP---------------------------------KFK-----RFKD-----
SYV_MYCH2       --EILEQKMP---------------------------------RIR----QFKEN-----
SYV_MYCH7       --EILEQKMP---------------------------------RIR----QFKEN-----
SYV_MYCHJ       --EILEQKMP---------------------------------RIR----QFKEN-----
SYV_MYCMO       --ELLESDFF---------------------------------ELK----SRKNN-----
SYV_MYCPU       --ELLEHTFE-----------------------------------N----KKL----KTQ
SYV_PARUW       --ACLVAPYP----------------------------------VR----IGEKN--QKV
SYV_CHLPN       --ACMEAPYP---------------------------------KAF----DVKIP--QDL
SYV_CHLMU       --ACMIAGYP---------------------------------QPI----ELSFP--QGL
SYV_CHLTR       --ACMVAEYP---------------------------------KPI----HVAFP--QGL
SYV_CHLAB       --SYVVAPYP---------------------------------QSI----DIVIP--EHL
SYV_CHLCV       --SYVVAPYP---------------------------------QAI----DIAIP--KDL
SYV_ONYPE       --NITQTTLQ---------------------------------KTS------YCN--LDA
SYV_UREPA       --SILLQEYP---------------------------------IIN----FEFET-----
SYV_PORGI       --TIMLCLLP-----------------------------------D----AHETD--RDF
SYV_BACFN       --SLMVQPLG-----------------------------------E----PGEVN--EEF
SYV_BACFR       --SLMVQPLG-----------------------------------E----PGEVN--EEF
SYV_BACTN       --SLMVSALS-----------------------------------M----DTYVD--TAF
SYV_WIGBR       --TTILEFFP---------------------------------KKY----LFLKK--DNS
SYV_DEIRA       --QIAVHSWP---------------------------------QPD----AALHD--AEA
SYV_THET8       --ELALEAWP-----------------------------------E----PGGRD--EEA
SYV_THETH       --ELALEAWP-----------------------------------E----PGGRD--EEA
SYV_THET2       --ELALEAWP-----------------------------------E----PGGRD--EEA
SYV_HELPJ       --SIMVMPYP-----------------------------------K----EIAQD--EKL
SYV_HELPY       --SIMVMPYP-----------------------------------K----DLAQD--EKL
SYV_CAMJE       --SIMISKYP---------------------------------KFK------EQD--KNI
SYV_CAMJR       --SIMISKYP---------------------------------KFK------EQD--KNI
SYV_HELHP       --SIMIHSYP--------------------------------KAME----KNEQH--SQL
SYV_WOLSU       --SIMILPYP---------------------------------KAN------WRE--EKI
SYV_BORBU       --ILALNEYP---------------------------------NFD----IANNF--QEE
SYV_BORBP       --ILALNEYP---------------------------------SFD----ISSNF--KEE
SYV_MESFL       --SILEESWF-----------------------------------D----KEFVF----E
SYV_MYCMS       --SILLEQWT---------------------------------NLN----SNYDT-----
SYV_PELUB       --FLMLANWP-----------------------------------S----GEFER--DTS
SYV_TREDE       --ILMTSDYP---------------------------------EEK----KERID--EAA
SYV_TREPA       --LLMCAPYP---------------------------------VYV----PSRVD--ARA
SYV_GLOVI       VASICVQPFP-----------------------------------T----GTDLP--AEP
SYV_PROMP       QILLSLQKWP---------------------------------VLE----KKYIN--SQI
SYV_PROMA       KKLLALQSWP---------------------------------ALD----KDLID--EDL
SYV_PROMT       --FLALQPWP---------------------------------KSN----EQDLN--LDL
SYV_PROMM       --FLALQSWP---------------------------------ASN----KSFLD--DAL
SYV_SYNPX       TTFLALQPWP---------------------------------ALQ----ESALD--DAL
SYV_THEEB       NEVLAVQPYP---------------------------------KAN----RRAID--PDL
SYV_SYNP6       DQFLALQSFP---------------------------------QPQ----SEWIQ--PEL
SYV_NOSS1       --TLALQAYP---------------------------------QAD----VNLIN--PAL
SYV_SYNY3       GQFLALQAYP---------------------------------TVN----QSLVD--PAL
SYV_LEPIC       --YIVTTPFP---------------------------------ESY----PVASD--SLG
SYV_LEPIN       --YIVTTPFP---------------------------------ESY----PVASD--SLG
SYV_STRAW       --SVVIADWP----------------------------------VD----SGFRD--QAA
SYV_STRCO       --SVVIAEWP----------------------------------TD----SGFRD--AGA
SYV_CORJK       --SLVTADWP---------------------------------TADLTNGGAQTD--ADA
SYV_CORDI       --SLNVAEWP---------------------------------TAAMTNGGVATD--EVA
SYV_COREF       --SIVTSSWP---------------------------------TPADTNGGAAVD--ADA
SYV_CORGL       --SIVVASWP---------------------------------TAADTNGGVAVD--ADA
SYV_NOCFA       --SVVVAAWP---------------------------------TAS----GVTPD--ADA
SYV_MYCLE       --SLVIATWP---------------------------------EPS----GISLD--LVA
SYV_MYCBO       --SLVSADWP---------------------------------EPS----GISVD--LVA
SYV_MYCTU       --SLVSADWP---------------------------------EPS----GISVD--LVA
SYV_MYCPA       --SLVIADWP---------------------------------RSS----GIDLD--QVA
SYV_BUCBP       --TIMLQSFP---------------------------------KYD----VKLVN--KTI
SYV_BLOFL       --TIMLQSFP---------------------------------KYD----SNYID--LES
SYV_BLOPB       --TIMLQPFP---------------------------------KYD----ESVID--MKS
SYV_BUCAI       --TIMLQDFP---------------------------------EYN----HKLFD--KKI
SYV_BUCAP       --TIMLQSFP---------------------------------EYN----DQLFD--KST
SYV_FRATT       --TIMDVSYP---------------------------------VAT----QALEA--PEA
SYV_COXBU       --SIMVEHWP---------------------------------QFN----IHEMN--YDA
SYV_XYLFA       --TLMLRPYP---------------------------------QPQ----QLETAAFANA
SYV_XYLFT       --TLMLRPYP---------------------------------QPQ----QLETTAFANA
SYV_XANC8       --TISLQAFP---------------------------------QRG----DVDTSGYAGA
SYV_XANCP       --TISLQAFP---------------------------------QRG----DVDTSGYAGA
SYV_XANOR       --TISLQRFP---------------------------------QVG----DVDTSGYATA
SYV_XANC5       --TISLQSFP---------------------------------QPG----DVDTSSYATA
SYV_XANAC       --TISLQSFP---------------------------------QPG----DVDTGSYASA
SYV_LEGPA       --SIMLSTYP---------------------------------KVN----EEFIN--PAI
SYV_LEGPH       --SIMLSTYP---------------------------------KVN----EEFIN--PAI
SYV_LEGPL       --SIMLSTYP---------------------------------KVN----EEFIN--PSI
SYV_METCA       --TIMRQSYP---------------------------------EAD----PALAD--PEA
SYV_NITOC       --TIMLQPYP---------------------------------QPE----IDKID--EDA
SYV_ACIAD       --TIMTAKYP---------------------------------VPE----AAKMN--EQA
SYV_PSYA2       --SIVIAAYP---------------------------------QTD----NSQIS--EQT
SYV_PSEAE       --TLMLQPWP---------------------------------VAD----EGRID--AAA
SYV_PSEPK       --TIMLQPWP---------------------------------VAN----EARID--AAA
SYV_PSEF5       --TIMLQPWP---------------------------------VAN----ETRID--QGA
SYV_PSESM       --TIMLQPWP---------------------------------VAN----EARID--QAA
SYV_PSE14       --TIMLQPWP---------------------------------VAN----EARID--QAA
SYV_PSEU2       --TIMLQPWP---------------------------------VAN----EARID--QAA
SYV_IDILO       --TIMLQPFP---------------------------------RVE----DN-VS--HQA
SYV_MANSM       --TIMTQPFP---------------------------------AFD----EALVN--DEA
SYV_PASMU       --TIMLQAFP---------------------------------QFE----QSALD--YQA
SYV_HAEDU       --SIMLQPFP---------------------------------IVE----QAKLD--ADA
SYV_HAEI8       --SIMLQPFP---------------------------------QVE----ENGFD--LEA
SYV_HAEIN       --SIMLQPFP---------------------------------QVE----ESGFD--PEA
SYV_COLP3       --SIMVQAFP---------------------------------QFD----ESKCD--QQA
SYV_PHOPR       --TIMTQALP---------------------------------QFN----EDNFN--ADV
SYV_ALIF1       --TIMTQALP---------------------------------QFN----EENFN--ADV
SYV_VIBCH       --TIMLQALP---------------------------------QYD----VANFN--QEA
SYV_VIBVU       --TIMLQSLP---------------------------------QYD----EANFN--QEA
SYV_VIBVY       --TIMLQSLP---------------------------------QYD----EANFN--QEA
SYV_VIBPA       --TIMLQALP---------------------------------QFD----EANFN--QEA
SYV_PHOLL       --TIMLQPFP---------------------------------EFA----QEKTD--ELA
SYV_YERPE       --TIMLQPFP---------------------------------EYD----ASQVD--EQA
SYV_YERPS       --TIMLQPFP---------------------------------EYD----ASQVD--EQA
SYV_PECAS       --TIMLQPFP---------------------------------EFN----AAQED--TLA
SYV_SHIDS       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_ECOL6       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_ECOLI       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_ECO57       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_SHIBS       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_SHISS       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_SHIFL       --TIMLQPFP---------------------------------QYD----ASQVD--EAA
SYV_SALPA       --TIMLQPFP---------------------------------EYN----AAQVD--EAA
SYV_SALTI       --TIMLQPFP---------------------------------EYN----AAQVD--EAA
SYV_SALCH       --TIMLQPFP---------------------------------EYN----AAQVD--EAA
SYV_SALTY       --TIMLQPFP---------------------------------EYN----AAQVD--EAA
SYV_PSEHT       NTSIMVQAFP---------------------------------VYN----AASVD--AKA
SYV_SHEON       --TIMLAPFP---------------------------------AFD----AAKVD--ATA
SYV_CHRVO       --SLMLAPWP---------------------------------VAD----ESKIS--AAA
SYV_NEIG1       --SIMLARFP---------------------------------ETD----GGEIV--QTA
SYV_NEIMA       --SIMLARFP---------------------------------EAD----SGEIV--QTA
SYV_NEIMB       --SIMLARFP---------------------------------EAD----SGEIV--QTA
SYV_NITEU       --SIMHQPYP---------------------------------QAD----PARMD--EHA
SYV_THIDA       --SIMLSAYP---------------------------------QVD----EAQRH--PGS
SYV_BORPE       --SVSVQPYP---------------------------------RAN----PQAVD--AEA
SYV_BORBR       --SVSVQPYP---------------------------------RAN----PQAVD--AEA
SYV_BORPA       --SVSVQPYP---------------------------------RAN----PQAVD--AEA
SYV_BURMA       --SLMVQAYP---------------------------------VAE----PKKLD--EAC
SYV_BURPS       --SLMVQAYP---------------------------------VAE----PKKLD--EAC
SYV_CUPPJ       --SLALQAYP---------------------------------LPA----MAKID--EAA
SYV_RALSO       --SLAQQEYP---------------------------------RAV----LAKID--EQA
SYV_AROAE       --SIMLARYP---------------------------------EAD----LSRLD--EAS
SYV_DECAR       --SIMLAAYP---------------------------------RAE----EYKID--AAS
SYV_FUSNN       --TIMLQQYP---------------------------------VAD----DSLID--VKI
SYV_BDEBA       --ACIVDQYP---------------------------------NAR-NDKEFLSLGSAQA
SYV_GLUOX       --KFEEIRWP---------------------------------EIM----TVTRA--DEA
SYV_RHOS4       --MLVHSDWP---------------------------------SFG----AELVD--PAA
SYV_RUEPO       --MLVHADWP---------------------------------TYK---AADLVD--DAA
SYV_SPHEL       --DLIVAKWP---------------------------------MAD----ARALD--PSA
SYV_ZYMMO       --DLIVAAWP---------------------------------DYK----NWSVD--ETA
SYV_CAUVC       --MLISAKWP---------------------------------ELP----ADWID--AEA
SYV_NITWN       --LLTLTEWP-NKADQTRKRRTLIAA----ADPFIGSEP-ITDLLE----PYFRD--DAA
SYV_BRADU       --LLALAAWPLKPAEPTPEQLAMFAAAAGPTDPLISPALIVPIFDH----ADFTD--PKA
SYV_RHOPA       --LLALAPWS-RKGGISDEEVSVLAASAATDPMAGPAMLAIPEPQE----PDFTD--DAA
SYV_BARHE       --MLALIQWP-----------------------------------E----ASFSD--EEA
SYV_BARQU       --MLALAQWP---------------------------------EIT------FLD--EAA
SYV_AGRFC       --LLCLTDWP-----------------------------------E----PEFRD--DAA
SYV_RHIME       --LLCHAEWP-----------------------------------A----AFYAD--DAA
SYV_RHILO       --LLCHAAWP-----------------------------------S----PDFED--DEA
SYV_BRUME       --VLALAEWP-----------------------------------E----LSFED--EDA
SYV_BRUSU       --VLALAEWP---------------------------------ELS------FED--EDA
SYV_DESPS       --FLATSAFP---------------------------------EVR----EEWKD--EEA
SYV_DESVH       --DIATKLYP---------------------------------AAR----PGCRD--VKD
SYV_GEOSL       --SIMVAGYP---------------------------------RSV----PERDF--PDG
SYV_PELCD       --SIMSAAFS---------------------------------TVS----ELPED--RQG
SYV_DEHM1       --DIIVAPFP---------------------------------QAD----ETCFD--EQA
SYV_DEHMC       --DIIVAPYP---------------------------------AAD----KTCFD--EQA
SYV_SYMTH       --SISVTAYP---------------------------------TPV----EGWAD--AEA
SYV_LACCA       --SIVTASYP---------------------------------VAN----TAFEN--ADA
SYV_LACAC       --SIMTASYP---------------------------------VTH----KEFEN--KTA
SYV_LACJO       --SIMVAKYP---------------------------------ETH----KEFEN--KEA
SYV_STAS1       --TIVKAAWP---------------------------------KVN----EALVF--DDS
SYV_STAAR       --TIVKASWP---------------------------------EVR----ESLIF--EES
SYV_STAAC       --TIVKASWP---------------------------------EVR----ESLIF--EES
SYV_STAAN       --TIVKASWP---------------------------------EVR----ESLIF--EES
SYV_STAAS       --TIVKASWP---------------------------------EVR----ESLIF--EES
SYV_STAAW       --TIVKASWP---------------------------------EVR----ESLIF--EES
SYV_STAAM       --TIVKASWP---------------------------------EVR----ESLIF--EES
SYV_STAEQ       --TIVKANWP---------------------------------TVD----QALIF--NES
SYV_STAES       --TIVKANWP---------------------------------TVD----QALIF--NES
SYV_STAHJ       --TIVKASWP---------------------------------TVR----EELVF--EES
SYV_LACPL       --SLVVAAYP---------------------------------VDH----PEFDD--ETA
SYV_LACSS       --SIMTASYP---------------------------------EVH----AELDD--QEA
SYV_ENTFA       --SLVVAEYP---------------------------------VVH----EEFND--EAA
SYV_LACLA       --SIVVAEYP---------------------------------KVR----PEFND--DKA
SYV_STRMU       --SIVTAAYP---------------------------------TVN----PAFEN--QTA
SYV_STRA5       --SIVLASYP---------------------------------QVN----ATFEN--QTA
SYV_STRA1       --SIVLASYP---------------------------------QVN----ATFEN--QTA
SYV_STRA3       --SIVLASYP---------------------------------QVN----ATFEN--QTA
SYV_STRT1       --SIVTAEYP---------------------------------VVC----PEFEN--EEA
SYV_STRT2       --SIVTAEYP---------------------------------VAR----PEFEN--EEA
SYV_STRP1       --SIVTVDYP---------------------------------VVR----PAFEN--EAA
SYV_STRPM       --SIVTVDYP---------------------------------VVR----PAFEN--EAA
SYV_STRP6       --SIVTAAYP---------------------------------TVT----PAFEN--EAA
SYV_STRP3       --SIVTAAYP---------------------------------TVT----PAFEN--EAA
SYV_STRP8       --SIVTVDYP---------------------------------TVT----PAFEN--EAA
SYV_STRPN       --SIVTAAYP---------------------------------TVN----LAFED--LAA
SYV_STRR6       --SIVTAAYP---------------------------------TVN----PAFED--LAA
SYV_LISIN       --SITISNWP---------------------------------EVN----EQQMD--SKA
SYV_LISMF       --SITIAEWP---------------------------------KVN----EQQID--TKS
SYV_LISMO       --SITIAEWP---------------------------------KVN----EQQID--TKS
SYV_OCEIH       --SITVSKWP---------------------------------EVN----SEFDN--PQA
SYV_BACC1       --SITVAAWP---------------------------------TVR----EDLQD--AEA
SYV_BACCZ       --SITVAAWP---------------------------------TVR----EDLQD--TEA
SYV_BACCR       --SITVAAWP---------------------------------TVR----EDLQD--TEA
SYV_BACAN       --SITVAAWP---------------------------------TVR----EDLQD--TEA
SYV_BACHK       --SITVAAWP---------------------------------TVR----EDLQD--TEA
SYV_BACSK       --SITVANWP---------------------------------VYD----QSLVF--EEA
SYV_BACHD       --SITVASWP---------------------------------VKS----EEFTF--EQA
SYV_GEOSE       --SITVAPWP---------------------------------QVR----PELSN--EEA
SYV_GEOKA       --SITVAPWP---------------------------------QVR----PELSN--EEA
SYV_BACLD       --SITVAKWP---------------------------------EAV----KEYTD--TEA
SYV_BACSU       --SITVSQWP---------------------------------AVV----PEHTD--TEA
SYV_THEMA       --SITIAKWP---------------------------------EIE----RELID--ETA
SYV_CARHZ       --TIMLAPWP---------------------------------KGR----ADYEN--PEA
SYV_CALS4       --SIMVAEWP---------------------------------KYR----EDLNF--EED
SYV_CLOPE       --SITIATWP---------------------------------TYD----EALNN--EKA
SYV_CLOAB       YKAIAISAWP---------------------------------TYE----EKLKN--ETS
SYV_CLOTE       --TITTSKWP---------------------------------EFK----EELKN--EEV
                                                                            

SYV_MYCGA       LDHFDQIFNLIIKIRNFKQSFDLKNKDTLD-LLYKNEV----------------------
SYV_MYCGE       -KLFDLVLAAINDLRNYRKQYMLNSQQKLV-VILSG------------------------
SYV_MYCPN       -KLFADVVEAVSSLRHYKANNQLVANQNLA-VVLSGKA----------------------
SYV_MYCPE       ESSIEDVLQIINKIRIFNFENKIPNNKVID-IHLEVLN--PKLFK-------------IS
SYV_MYCS5       SSEINLLIDAITKIRKYRDDNNISKKEKLY-LCLKEKI--------------------SK
SYV_MYCH2       -QKVENILEIIDNLRTYREKFQISKKIILE-YCIINDK--------------------FS
SYV_MYCH7       -QKVENILEIIDNLRTYREKFQISKKIILE-YCIINDK--------------------FS
SYV_MYCHJ       -QKVENILEIIDNLRTYREKFQISKKIILE-YCIINDK--------------------FS
SYV_MYCMO       -LFIDETIEIISTLREYRTRFNLSHKIDLNYNLVSINN--SNQCDF-----------NLD
SYV_MYCPU       KNNVDQLILVIRAIREFREKYQISKKEKIK-YWIQDCQ--------------------FL
SYV_PARUW       EAVFALMEQIVYTIRNIRGEMKLSPGTATD-VYIIGQA--DDPEWQ-----------SAR
SYV_CHLPN       RESFTLAQRLVYTIRNIRGEMQLDPRLHLK-AFVVCSD-----TTE------------IQ
SYV_CHLMU       RESFAIAEKLVYTIRNIRGEMQLDPRDLLQ-AFIISSE----KKEL------------LD
SYV_CHLTR       RESFGIAERLVYTIRNIRGEMQLDPREPLQ-AFVISSE----KKEL------------VD
SYV_CHLAB       HESFALAERLVYTVRNIRGEMQLDSRASLE-VFVICPE------GV-----------SIE
SYV_CHLCV       HESFALAERLVYTIRNIRGEMQLDPRASLE-VFVICPE------GI-----------SIE
SYV_ONYPE       LADFENLKNLIIKTRHLRQESNINCKLNLE-LEVASQF--STILQD------------FV
SYV_UREPA       -IIIDKIAKIILEIRKLRLEENINNRINLC-FELISPN--DAFYKS-----------KI-
SYV_PORGI       LQAFDRTREIIAAIRNIRTGKNIPFKEKLT-LEAGNEH--------------------DA
SYV_BACFN       LQQFETAKEIISSVRTIRLQKNIALKEPLE-LQVVGAN-------------------PVE
SYV_BACFR       LQQFETAKEIISSVRTIRLQKNIALKEPLE-LQVVGAN-------------------PVE
SYV_BACTN       VAQFEVVKGVISNIRSIRLQKNIAQKEPLD-LQVLGEN-------------------PVA
SYV_WIGBR       FNEIECIKNIITCIRKLKFEKKTKFNKLVD-VCFINNS--------------------YE
SYV_DEIRA       TKAFDALRSAVDSARSLKSELGLSPQDRLN-VAVDGDL-----ADV------------VR
SYV_THET8       ERAFEALKQAVTAVRALKAEAGLPPAQEVR-VYLEGET------AP------------VE
SYV_THETH       ERAFEALKQAVTAVRALKAEAGLPPAQEVR-VYLEGET------AP------------VE
SYV_THET2       ERAFEALKQAVTAVRALKAEAGLPPAQEVR-VYLEGET------AP------------VG
SYV_HELPJ       EHEFEVIKDCIVSLRRLKIMLETPPIVLKE-ASVGLRE--KIENTE-----------RLQ
SYV_HELPY       EHEFEVIKDCIVSLRRLKIMLETPPIVLKE-ASVGLRE--AIENTE--------------
SYV_CAMJE       EKIFSLLIESIVSIRRAKSLIDLGNSKIEK-AYIKFND--KKIKDE------------IK
SYV_CAMJR       EKIFSLLIESIVSIRRAKSLIDLGNSKIEK-AYIKFND--KKIKDE------------IK
SYV_HELHP       ERTFEVIQDVITSIRRLKAMLELGSTNIEC-IFVKLNA--PFEHSL------------LE
SYV_WOLSU       EMTFEVIMDAIISTRRLKATLELANQKIPV-VFIKAPQ--GMDESL------------IN
SYV_BORBU       FEIFKVLKTFIIAIRTLKSEFNIPASVEID-VALKFDA-DFKYEAY------------FK
SYV_BORBP       FESFKVFKTFIVAVRTLKSEFNISSSIEID-VALKFDS-DFKYEGY------------FK
SYV_MESFL       TDYINVVIELINSIREFRATNNIKNNVLLN-WNATNGN-LEIITKY------------NL
SYV_MYCMS       -SFIDDVIKMITSIREFRNTKNIKNDVCLS-VNISNTN--QNHTKL-----------FKK
SYV_PELUB       INQVEKIISIVSELRSFKNELSVSPGSFID-ISIETVS--KKEQSF------------FT
SYV_TREDE       SIRFRTLQEIVRNIRALRAECGIDPQLKLK-VSLYIEK--NSPAEA------------AR
SYV_TREPA       CAHIGAVQEIVRAVRTLRAACGIDPQKAVS-VRLRPSS-PAQDANAAAQVSCVHDPGAVA
SYV_GLOVI       PAEFALMQQIVRTIRNLRAFAQVPPLRTLPAVRLASRN--AEERAA------------ID
SYV_PROMP       DKSFHELFEIIRLIRNLRVELGLKPSQLVP-VYLISDN--VELTNF------------LK
SYV_PROMA       ELSFSELFGAIRLVRNLRAEAGLKPSQRAP-VRFVTKN--QNLLNL------------LK
SYV_PROMT       ESSFSDLFASIRLIRNLRAVAGLKPSQKVP-VMLVSGK--EVLQKT------------LT
SYV_PROMM       ELSFTELIEAIRVVRNLRAVAGLKPAQTVP-VQFITGR--PELAAL------------LE
SYV_SYNPX       EASFADLIGAIRVVRNLRAVAGLKPSQSVP-VRFVTGR--GELAAV------------LN
SYV_THEEB       EAQFSLLIETIRTIRNLRAEAGIKPGLYIA-ALIEASA---EEAPI------------FE
SYV_SYNP6       DREFQLMIDVIRTLRNLRAEAGLKPGQKIT-AILQSDS--ESERCN------------LE
SYV_NOSS1       ETQFDLLIGTIRTIRNLRAEAEVKPGAKII-ANLQTDS--ESERQI------------LM
SYV_SYNY3       ETQFALLIETLRTIRNLRAEAGIKPGAMVT-VILQSEN--DQERQT------------LQ
SYV_LEPIC       VQKLNLLQEIVTKIRVMRSENGVAPDKKCK-VIVKSSD--NLSSST------------IL
SYV_LEPIN       VQKLNLLQEIVTKIRVMRSENGVAPDRKCK-AIVKSSD--NLSSST------------IL
SYV_STRAW       EKEIETLQSVITEVRRFRADQGLQPGQRVP-ARLTLDD----TA--------------LA
SYV_STRCO       EREIETVQSVITEVRRFRADQGLQPGQRVP-ARLTLAG------SA------------LA
SYV_CORJK       VRRMADVDKLVTELRRFRSDQGVKPSQKVP-AKLDFAA--AD----------------LA
SYV_CORDI       ARRMADVEKLVTEIRRFRSDQGVKPSQKVP-GAVDFAA--AD----------------LA
SYV_COREF       ARRIADVEKLVTEIRRFRSDQGVKPSQKVP-ARLDFAA--CD----------------LT
SYV_CORGL       ARRIGDVEKLVTEVRRFRADQGVKPSQKVP-ARL---D----FVAC-----------DLQ
SYV_NOCFA       ARRIADAQRLITEIRRFRSDQGLADKQKVS-AKLIGVD-----SAE------------LD
SYV_MYCLE       AQRISDMQKLVTEIRRFRSDQGLVDRQKVP-ARLSGVE--DSD---------------LA
SYV_MYCBO       AQRINDMQKLVTEVRRFRSDQGLADRQKVP-ARMHGVR--------------------DS
SYV_MYCTU       AQRINDMQKLVTEVRRFRSDQGLADRQKVP-ARMHGVR--------------------DS
SYV_MYCPA       TQRITDMQKLVTEVRRFRSDQGLADRQKVP-ARLAGVTESD-----------------LD
SYV_BUCBP       LEDMDWIKNIFIIIRSFRMDLKISHTTLIS-ISFKNVS--SKIHKL------------IE
SYV_BLOFL       ISDIEWIQNLIAEIRMIRTYTGISYKIPLD-IGFYNTS--NHIKEC------------IS
SYV_BLOPB       VIDIEWIKNAVLAIRTARVNMNISYNIPLQ-IVFRDTS--SEVKKR------------IT
SYV_BUCAI       LVQMNWMKKIIVFLRNIRTNMNVSSTKLLP-LFLYNIN--SEQEKV------------IK
SYV_BUCAP       LSNINWIKKIIIFIRNTRSKMNISSTKLLS-LFLKNIN--SEKKKV------------IQ
SYV_FRATT       EKAIVWLQNVVTTLRNMRSEVGIKPSLEIS-LIVKDVA--DKDREY------------LA
SYV_COXBU       KVEIEWVKNVITAIRTLRAEIGISPAKRIP-VIFGKGD--EKDKKR------------IA
SYV_XYLFA       AADVEWLKIMVSALRRIRSTLNVPPSRRVS-LLLQGDQ--EVDRRR------------IT
SYV_XYLFT       AADVEWLKIMVSALRRIRSTLNVPPSRRIS-LLLQGGQ--EVDRRR------------IT
SYV_XANC8       EADIEWLKAMVSALRRVRSELNVPPSKQVR-LWLQAGS--SDDRAR------------VA
SYV_XANCP       EADIEWLKAMVSALRRVRSELNVPPSKQVR-LWLQAGS--SDDRAR------------VA
SYV_XANOR       EADVEWLKSMVSALRRVRSELNVPPSKQVR-LLLQADT--ADERPR------------VA
SYV_XANC5       EADVEWLKSMVSALRRVRSELNVPPSKQVR-LLLQADT--ADDRPR------------VA
SYV_XANAC       EADVEWLKSMVSALRRVRSELNVPPSKQVR-LLLQAGT--ADDRPR------------VA
SYV_LEGPA       EEELDWLKSAIQSLRTIRSEMSISPAKLIP-LYIRNIT--PELKER------------IA
SYV_LEGPH       EEELDWLKSAIQSLRTIRSEMSISPAKLIP-LYIRNIT--PELKER------------IA
SYV_LEGPL       EEELDWLKSAIQSLRTIRSEMSISPAKLIP-LYIRNIT--PELKER------------IA
SYV_METCA       EREMAWVMEVILGVRRIRAEMNLAPARPLP-VLLSHGT--GQDRVW------------SA
SYV_NITOC       VAEIEWVIAFVTGVRSIRSQMNIAPGKPIP-LLLQAGK--AHDRTR------------LE
SYV_ACIAD       EADMQWLQGLIGAVRNIRGEMGLGNARLLP-VLLQNIS--DSERTQ------------IE
SYV_PSYA2       EADMAWLQELIASVRNIRGEMKLGNAVRLP-VLLQNIS--AAEDTR------------LS
SYV_PSEAE       EGDIEWVKALMLGVRQIRGEMNISMAKRID-IILKNAS--PSDHRR------------LA
SYV_PSEPK       EGDIEWLKELMVGLRNIRAEMNIGPGKPLP-LFLKNAN--ADDQRR------------LQ
SYV_PSEF5       EDDIEWLKGLMLGTRNIRAEMNIGPGKPLA-LFLKNVS--AEDQRR------------LT
SYV_PSESM       EDDIEWLKGLMLAVRNIRGEMNIGPGKPLQ-LFLKNVS--ADDQRR------------LS
SYV_PSE14       EDDIEWLKGLMLAVRNIRGEMNIGPGKPLQ-LFLKNVS--AEDQRR------------LS
SYV_PSEU2       EDDIEWLKGLMLAVRNIRGEMNIGPGKPLQ-LFLKNVS--AEDQRR------------LS
SYV_IDILO       MQDMEWLKRVILAIRNIRGEMDLSPNKPLP-LLLSNAD--AMAKGR------------IQ
SYV_MANSM       VAQISWIKEVITAVRNIRAESNIAPSKGLD-LLLRNLP--DTEQKT------------LE
SYV_PASMU       EAEINWMKEVIVAVRNIRAESNIPPSKGLD-LLLRNLS--EADQNA------------LE
SYV_HAEDU       EQQINWLKELIIAVRNIRAEANIAPSKALD-LLVRNVT--QQQAVI------------LS
SYV_HAEI8       EAEIEWLKEVIVAVRNIRAESNIAPSKGLD-LLFRNLS--AENAKI------------LE
SYV_HAEIN       EAEIEWLKEVIVAVRNIRAESNIAPSKGLD-LLFRNLS--AENAKI------------LE
SYV_COLP3       IDDLEWVKQFIIAIRNIRGEMDISPSKELP-VLLKNVN--DNDQRR------------LD
SYV_PHOPR       VADLEWVKAFITSIRNLRAEYDIAPSKGLD-VMIKVAD--EKDAAR------------IQ
SYV_ALIF1       VADLEWVKAFITSIRNLRAEYDIAPSKGLE-VMIKVAD--EKDAAR------------IE
SYV_VIBCH       LDDIEWVKAFITSIRNLRAEYDINPGKPLE-VMLKAAN--EQDAAR------------IE
SYV_VIBVU       LDDIEWVKAFITSIRNLRAEYDINPGKPLE-VMLK-AD--EKDAAR------------LE
SYV_VIBVY       LDDIEWVKAFITSIRNLRAEYDINPGKPLE-VMLK-AD--EKDAAR------------LE
SYV_VIBPA       LDDIEWVKAFITSIRNLRAEYDINPGKPLD-VMLKAAN--AEDAAR------------LE
SYV_PHOLL       LTDLEWIKEAIIAVRNIRAEMNIAPGKPLE-VLLRNAD--AGAQRR------------VA
SYV_YERPE       LSDLEWIKQTIIAVRNIRAEMNIAPGKPLE-VMLRGAN--AQAQRR------------VL
SYV_YERPS       LSDLEWIKQTIIAVRNIRAEMNIAPGKPLE-VMLRGAN--AQAQRR------------VL
SYV_PECAS       LNDLEWIKQAIIAVRNIRAEMNIAPGKPLE-VLLRDAT--AEAQRR------------VE
SYV_SHIDS       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_ECOL6       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_ECOLI       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_ECO57       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_SHIBS       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_SHISS       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_SHIFL       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--ADAERR------------VN
SYV_SALPA       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--EEAVRR------------VN
SYV_SALTI       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--EEAVRR------------VN
SYV_SALCH       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--EEAVRR------------VN
SYV_SALTY       LADTEWLKQAIVAVRNIRAEMNIAPGKPLE-LLLRGCS--EEAVRR------------VN
SYV_PSEHT       MDDLEWVKQFILAIRNIRGEMDISPSKPLS-VLLANAS--SDDVRR------------IE
SYV_SHEON       MADLEWVKQVIVAVRNIRAELNIAPSKPLN-ALLRGVS--AQDKAR------------IE
SYV_CHRVO       NARMEAFKDMVNAVRNLRGEMGIGPAVKAP-LFIETAD------AS------------IA
SYV_NEIG1       FGQMTVLQDLIGAVRNLRGETGIQPNVKAP-LFVESAD-------------------DLA
SYV_NEIMA       FEQMTVLQDLIGAVRNLRGEMGIQPNVKAP-LFVESTD-------------------DLA
SYV_NEIMB       FEQMTVLQDLIGAVRNLRGEMGIQPNVKAP-LFVESTD-------------------DLA
SYV_NITEU       AANVQLLKEIVNACRTLRGEMKLSPAERVP-LLIEGDP------SR------------LA
SYV_THIDA       VARMQLLKELVNACRTLRGEMNLSPAQRVP-LVIEGDA------AV------------IN
SYV_BORPE       EAAVAELKSQVEAVRALRGEMNLSPAQRVP-LVAEGPT------DV------------LS
SYV_BORBR       EAAVAELKSQVEAVRALRGEMNLSPAQRVP-LVAEGPT------DV------------LS
SYV_BORPA       EAAVAELKSQVEAVRALRGEMNLSPAQRVP-LVAEGPT------DV------------LS
SYV_BURMA       EQWAAELKAVVDACRNLRGEMNLSPATKVP-LLAAGDA------AQ------------LQ
SYV_BURPS       EQWAAELKAVVDACRNLRGEMNLSPATKVP-LLAAGDA------AQ------------LQ
SYV_CUPPJ       EQWVAQLKAVVDACRNLRGEMNISPAQRIP-LYAQGDT------EF------------LR
SYV_RALSO       EQWVQQLKALVDACRNLRGEMSLSPAQRVP-LYAHGDA------EF------------LQ
SYV_AROAE       EAKIAELKAIVGTCRNLRSEMNISPAQRMP-LVAAGEA------TI------------LT
SYV_DECAR       EAKVERLKALAYACRNLRGEMNVSPALRMP-LLVAGGG--AE----------------IS
SYV_FUSNN       EKSFEYIKEVVSSLRNIRAEKGISPAKPAK-VVVSTSN--SEELET------------LE
SYV_BDEBA       ALEIDIVKEVITAIRNIRGENRISPAVKLN-VRLGVTN--DQTQKI------------LG
SYV_GLUOX       RAELDWVIRLIGDVRTVRSEMNIPPSQKAP-LLLRDAA--PENLER------------AK
SYV_RHOS4       DREMSWVISLIEEIRSARAQVHVPAGLKLP-VVQLALD--AAGREA------------LA
SYV_RUEPO       DREMNWVISVIENTRSARAQMRVPAGLYVP-MIVTEID--DHGQAA------------WD
SYV_SPHEL       AQEIDWLIRLVSEIRAARTELNVPPGARLP-LHVRDAS--AETAXR------------LI
SYV_ZYMMO       QNDIDWLIRLITAIRATRSELNVPPALKVP-LHSHGIP--EKAAHN------------LE
SYV_CAUVC       EAEIGWLVETVGEIRSIRAEMNVPPSAKPG-LTIVGAG--PETKAR------------LA
SYV_NITWN       EAEIGWVVDLVTAIRSVRAEMNIPPATLAP-LVLAGAS--DESRAR------------AQ
SYV_BRADU       EAEIGWVIDLVTQIRSVRAEMNIPPATLTA-LVLAGAS--AETRER------------AP
SYV_RHOPA       EAEIGWVVDLVTAIRSVRAEMNIVPSTLTP-LVLAGAS--ADTNAR------------AS
SYV_BARHE       ASDINWLIDAVSAIRSVRFEMNIPAAALAP-LVIVEGG--ELTLKR------------VE
SYV_BARQU       AADINWLIDVITEIRSVRFEMNIPAGKLAP-LVIVEAG--EITRER------------IQ
SYV_AGRFC       AAEINWLIDLVSGIRSARAEMNVPPGATAS-LVVVGAN--TSTEAR------------LD
SYV_RHIME       ADEINWLIDLVSGIRSVRAEMNVPPAAMAP-LVIVGAK--ALTSER------------LD
SYV_RHILO       AADINWLVDLVSGIRSVRSEMNVPPAAIAP-LVVVGAN--GVTRER------------LV
SYV_BRUME       AADINWLVDLVTGIRSVRAEMNVPAGAIAP-VVVLDAN--KVTVDR------------FA
SYV_BRUSU       AADINWLVDLVTGIRSVRAEMNVPAGAIAP-VVVLDAN--KVTVDR------------FA
SYV_DESPS       EAEMELLMGIITGIRNIRSEAEVHPSTKIN-ATVICHD--SKRADI------------IR
SYV_DESVH       AEHMELVQATISAVRTIRAELNIAPSYRLT-TLVRPAS--AEDAAT------------LE
SYV_GEOSL       AAEMELVMEVIRGIRNIRGEMDVAPSREIA-AILSCGS--AESLHL------------LK
SYV_PELCD       ASHMERIMDVIKGVRNIRGEMNVPPGKRIA-AVLDCKT--SKAAEV------------MA
SYV_DEHM1       ESIMGSLVEVVRSLRNLRAEHNVEISRYIQ-ANIYAGD----MAEV------------LS
SYV_DEHMC       ESVMGSLVEIVRSLRNLRAEHNVEISRYIQ-ANIYA----GDMASV------------LG
SYV_SYMTH       NERMALIIDTIRALRSIRAEFRLGEHTRID-AVVMATS--DQALAI------------LN
SYV_LACCA       TSAMDAIIALIRGVRGIRKEAGAPLKTKVD-ILVKLTD--PALKPI------------FE
SYV_LACAC       DQEMDFLIEVIKAVRNIRMEVNAPMSSEID-IMIKLDD--LNNKHI------------LD
SYV_LACJO       DSQMAFLIEVIKAVRNIRMEVNAPMSSPID-IMIQIDD--DNNKAV------------LD
SYV_STAS1       KETMQQLVEIIKSVRQSRLEVDTPLSKAIP-IFIKAKD--ENIKET------------LL
SYV_STAAR       KQTMQQLVEIIKSVRQSRVEVNTPLSKEIP-ILIQAKD--KEIETT------------LS
SYV_STAAC       KQTMQQLVEIIKSVRQSRVEVNTPLSKEIP-ILIQAKD--KEIETT------------LS
SYV_STAAN       KQTMQQLVEIIKSVRQSRVEVNTPLSKEIP-ILIQAKD--KEIETT------------LS
SYV_STAAS       KQTMQQLVEIIKSVRQSRVEVNTPLSKEIP-ILIQAKD--KEIETT------------LS
SYV_STAAW       KQTMQQLVEIIKSVRQSRVEVNTPLSKEIP-ILIQAKD--KEIETT------------LS
SYV_STAAM       KQTMQQLVEIIKSVRQSRVEVNTPLSKEIP-ILIQAKD--KEIETT------------LS
SYV_STAEQ       KQTMEQLVEIIKSVRQSRVEVNTPLSKAIP-ILIQTKD--EKIKHT------------LM
SYV_STAES       KQTMEQLVEIIKSVRQSRVEVNTPLSKAIP-ILIQTKD--EKIKHT------------LM
SYV_STAHJ       KQTMQQLVEIIKSVRQSRVEVNTPLSKAIP-IYIQAKD--ENIKAT------------LI
SYV_LACPL       ESDMASLIELITAVRSIRAEANAKMSSAVD-LLIKTDN--TRLQAV------------FK
SYV_LACSS       TTQMNALIDLIRSVRNIRSEANAPLSKPID-ILINIQD--TPLMAI------------FK
SYV_ENTFA       ARGMEVLKEVIRSVRNIRAEVNTPLSKPIT-LLIKTND--TEVEEF------------LT
SYV_LACLA       SEGVAMLIELITAVRNIRAEVNTPLSKAVP-MLIKSEH-----ADF------------LN
SYV_STRMU       HSGVESLKDLIRAVRNARAEVNVAPSKPIT-ILVKTSD--SNLEDF------------FK
SYV_STRA5       HKGVESLKDLIRSVRNSRAEVNVAPSKPIT-ILVKTSD--SELESF------------FK
SYV_STRA1       HKGVESLKDLIRSVRNSRAEVNVAPSKPIT-ILVKTSD--SELESF------------FK
SYV_STRA3       HKGVESLKDLIRSVRNSRAEVNVAPSKPIT-ILVKTSD--SELESF------------FK
SYV_STRT1       AAGVEALKDVIRSVRNSRAEVNVAPSKPIT-ILIKTSD--SKLDAF------------FN
SYV_STRT2       AAGVEALKDVIRSVRNSRAEVNVAPSKPIT-ILIKTSD--SKLDAF------------FN
SYV_STRP1       HKGVESLKDLIRAVRNARAEVNVAPSKPIT-ILVKTAD--SELEDF------------FN
SYV_STRPM       HKGVERLKDLIRAVRNARAEVNVAPSKPIT-ILVKTAD--SELEDF------------FT
SYV_STRP6       HKGVESLKDFIRAVRNARAEVNVAPSKPIT-ILVKTAD--SELEDF------------FN
SYV_STRP3       HKGVESLKDLIRAVRNARAEVNVAPSKPIT-ILVKTAD--SELEDF------------FT
SYV_STRP8       HKGVESLKDLIRAVRNARAEVNVAPSKPIT-ILVKTAD--SELEDF------------FT
SYV_STRPN       HTGVESLKDLIRAVRNARAEVNVAPSKPIT-ILVKTSD--SDLEAF------------FN
SYV_STRR6       HTGVESLKDLIRAVRNARAEVNVAPSKPIT-ILVKTSD--SDLEAF------------FN
SYV_LISIN       STAMRTLVEVIRAVRNIRAEVNTPLSKSIV-LEIKPKD--ETYKEI------------LE
SYV_LISMF       STAMATLVEVIRAVRNIRSEVNTPLSKPIV-LEIKPKD--TTYKEI------------LE
SYV_LISMO       STAMATLVEVIRAVRNIRSEVNTPLSKPIV-LEIKPKD--TTYKEI------------LE
SYV_OCEIH       VQEMQRLVSIIRSVRNSRAEVDTPMSKQIK-MLIKTEN--EQLTAE------------LE
SYV_BACC1       AAEMHLLVDIIRSVRNIRAEVNTPMSKKVQ-MQIKAKD--EAVLAQ------------LT
SYV_BACCZ       AAEMHLLVDIIRSVRNIRAEVNTPMSKKVQ-MQIKAKD--EAVLAQ------------LT
SYV_BACCR       AAEMHLLVDIIRSVRNIRAEVNTPMSKKVQ-MQIKAKD--EAVLAQ------------LT
SYV_BACAN       AAEMHLLVDIIRSVRNIRAEVNTPMSKKVQ-MQIKAKD--EAVLAQ------------LT
SYV_BACHK       AAEMHLLVDIIRSVRNIRAEVNTPMSKKVQ-MQIKAKD--EAVLAQ------------LT
SYV_BACSK       VEDMEALKSLIHAIRTTRSELNVPMSKQIE-LKIRPQD--EQMAAR------------LQ
SYV_BACHD       MGDMELLKDIIRSVRNTRAELNVPMSKEIE-LHIQAKN--EDVLTQ------------LE
SYV_GEOSE       AEEMRMLVDIIRAVRNVRAEVNTPPSKPIA-LYIKTKD--EHVRAA------------LL
SYV_GEOKA       AEEMRLLVDIIRAVRSVRAEVNTPPSKPIA-LYIKVKD--EQVRAA------------LM
SYV_BACLD       AADMKLLVEVIRAVRNIRSEVNTPLSKQIE-LYIKTST--PEIAER------------LE
SYV_BACSU       AADMKLLVELIRSVRNIRSEVNTPMSKQVE-LYIKTST--DEIASR------------LE
SYV_THEMA       EKEFTRLMNMVRGVRNVRAEMNLPQSQRVK-VYIKGYE--------------------VT
SYV_CARHZ       VKQMSSLMEVIREIRRLRAEVNVPPAKRGE-VILVTAD--EQLTRL------------LN
SYV_CALS4       AKKAEIIMEAIRAIRNIRAEANVSPSKKAK-VIIAVEK--EEHEKI------------FE
SYV_CLOPE       EKDMTFIMEAIRSLRNLRAEMNVPPSRKAK-VMAYASE---EAKDA------------FI
SYV_CLOAB       ENAMNQIIEAIKSIRNVRAEMNVPPSKKAK-VMIFTEA---ENKAA------------FE
SYV_CLOTE       EKKMSHVIEAIKAIRNVRIEMDVPPSRKAK-IMIYALD---GIDA-------------FK
                              *  .                                          

SYV_MYCGA       -SYIKDLTKYLKTENVNL------------------------------------------
SYV_MYCGE       -KNAVDVKQYFNFSWIEL------------------------------------------
SYV_MYCPN       ---APVVQNYFHFNWVDL------------------------------------------
SYV_MYCPE       -DEVINILNTAKINIVKQ------------------------------------------
SYV_MYCS5       -KNLNILLSLTN------------------------------------------------
SYV_MYCH2       NAEIDIINKLTFGKWLEN------------------------------------------
SYV_MYCH7       NAEIDIINKLTFGKWLEN------------------------------------------
SYV_MYCHJ       -NAEIDI-----INKLTF------------------------------------------
SYV_MYCMO       -LKKYLIKKMAN------------------------------------------------
SYV_MYCPU       -QEDIDAINFLTFSELSQ------------------------------------------
SYV_PARUW       -EHITMISALVKTRRILV------------------------------------------
SYV_CHLPN       -SCIPILQALGGLESIQL------------------------------------------
SYV_CHLMU       -ACIPIMCALGGIKTIEQ------------------------------------------
SYV_CHLTR       -VCIPIMCALGGVKTVEQ------------------------------------------
SYV_CHLAB       -TYVPMVCALGGISSIEN------------------------------------------
SYV_CHLCV       -TYVPMMCALGGIASLEY------------------------------------------
SYV_ONYPE       -NLQQALEKFFKTLQIKI------------------------------------------
SYV_UREPA       -KLVNLLLILVNAEINEI------------------------------------------
SYV_PORGI       -SFDAVIIKMGNLEAINR------------------------------------------
SYV_BACFN       -KMNPVIRKMCNLSAIEV------------------------------------------
SYV_BACFR       -KMNPVIRKMCNLSAIEV------------------------------------------
SYV_BACTN       -EFNAVIQKMCNLSSITV------------------------------------------
SYV_WIGBR       -EKIIILNNIEIIKNIAF------------------------------------------
SYV_DEIRA       -QNARVVEGIARVNLVPA------------------------------------------
SYV_THET8       -ENLEVFRFLSRADLLPE------------------------------------------
SYV_THETH       -ENLEVFRFLSRADLLPE------------------------------------------
SYV_THET2       -ENLEVFRFLARADLLP-------------------------------------------
SYV_HELPJ       ----NYAQKLAKLEKVSV------------------------------------------
SYV_HELPY       -RLQTYAQKLARLEKVSV------------------------------------------
SYV_CAMJE       -AYMNFIIMLAKCEQIEF------------------------------------------
SYV_CAMJR       -AYMNFIIMLAKCEQIEF------------------------------------------
SYV_HELHP       ----QFVCKLAKVKTLCI------------------------------------------
SYV_WOLSU       ----TFIPRLAKVDSIEL------------------------------------------
SYV_BORBU       -ANESIVKRMINFKNIFY------------------------------------------
SYV_BORBP       -ANESISKRMINFKNIFY------------------------------------------
SYV_MESFL       -EINNFLNEFVN-ANLSI------------------------------------------
SYV_MYCMS       -HFDQIYNFLFNFCNTKL------------------------------------------
SYV_PELUB       -ENEIILKKLGRIKNL--------------------------------------------
SYV_TREDE       -ENSEIIEMLSGLSGLDF------------------------------------------
SYV_TREPA       RTYEELICVLAGISSLVY------------------------------------------
SYV_GLOVI       -ATRQAIAHLGRVEQLPL------------------------------------------
SYV_PROMP       -TLIVDIKTFTKSSEVII------------------------------------------
SYV_PROMA       -KATQDIQALTRANKVEI------------------------------------------
SYV_PROMT       -TSINDIAVLTKAKEVQI------------------------------------------
SYV_PROMM       -QATADITALTRAESVVV------------------------------------------
SYV_SYNPX       -QGTADITALTRAESVAV------------------------------------------
SYV_THEEB       -AGAADIQHLARLESLTI------------------------------------------
SYV_SYNP6       -QSQAYIRDLTKTEMLTI------------------------------------------
SYV_NOSS1       -AGQSYIKDLAKVETLTIAAGQQPSTVTKKKPQKGLKTIGLVIAGLVFLRVALAVADTVD
SYV_SYNY3       -LGETYIRDIGKVENLQV------------------------------------------
SYV_LEPIC       -ENEVSLLQLARLESIRI------------------------------------------
SYV_LEPIN       -ENEVSLLQLARLESIRI------------------------------------------
SYV_STRAW       -PHEAAIRQLLRLQP---------------------------------------------
SYV_STRCO       -AHEAAVRQLLRLQP---------------------------------------------
SYV_CORJK       -NFEEAVRSLVRLETPE-------------------------------------------
SYV_CORDI       -AQEDLVRSLARLDQPA-------------------------------------------
SYV_COREF       -ELEGAVRALVRIEEPA-------------------------------------------
SYV_CORGL       -DLEDSVRSLVRIEQPE-------------------------------------------
SYV_NOCFA       -ALAPAIAALARLTEAG-------------------------------------------
SYV_MYCLE       -TQVGFVTSLALLTAAS-------------------------------------------
SYV_MYCBO       -DLSNQVAAVTSLAWLTE------------------------------------------
SYV_MYCTU       -DLSNQVAAVTSLAWLTE------------------------------------------
SYV_MYCPA       -TQVSAVTSLAWLTDAG-------------------------------------------
SYV_BUCBP       -EHKDYIKKIAYLDNVSI------------------------------------------
SYV_BLOFL       -ENYHILTKILQLQTINF------------------------------------------
SYV_BLOPB       -ENSKILCHIAQLKSIHF------------------------------------------
SYV_BUCAI       -ENISLIKNISFLDKITI------------------------------------------
SYV_BUCAP       -ENKFILKNIASLEKISI------------------------------------------
SYV_FRATT       -QTEGFIKALARINNIEF------------------------------------------
SYV_COXBU       -KMKSYIKTLGKVSQLRF------------------------------------------
SYV_XYLFA       -HFATALHFLLKLEHIDW------------------------------------------
SYV_XYLFT       -HFAIALHFLLKLEHIDW------------------------------------------
SYV_XANC8       -RFASQLAFLLKLEAIDW------------------------------------------
SYV_XANCP       -RFASQLAFLLKLEAIDW------------------------------------------
SYV_XANOR       -RFASQLSFLLKLERIDW------------------------------------------
SYV_XANC5       -RLASQLSFLLKLERIDW------------------------------------------
SYV_XANAC       -RFASQLSFLLKLESIDW------------------------------------------
SYV_LEGPA       -KYEKILKTLSKIDKINY------------------------------------------
SYV_LEGPH       -KYEKILKTLSKIDKINY------------------------------------------
SYV_LEGPL       -KYEKILKTLSKIDKINY------------------------------------------
SYV_METCA       -RSGPLLEKLARLESLNW------------------------------------------
SYV_NITOC       -SNQKFLAALAKLDSIQW------------------------------------------
SYV_ACIAD       -RIQPLFKALAKVESITF------------------------------------------
SYV_PSYA2       -RIANQFKALAKVESLTI------------------------------------------
SYV_PSEAE       -DNEPLLMKLAKLESIRV------------------------------------------
SYV_PSEPK       -ENEALLKKLAKVESFTV------------------------------------------
SYV_PSEF5       -ENEALLKKLARLESITV------------------------------------------
SYV_PSESM       -ENDYLLRKLAKLESMTV------------------------------------------
SYV_PSE14       -ENDYLLKKLAKLESMTV------------------------------------------
SYV_PSEU2       -ENDYLLKKLAKLESMTV------------------------------------------
SYV_IDILO       -NNESFLSSLAKLESIEF------------------------------------------
SYV_MANSM       -NNRTLMQIMAKLDSVKV------------------------------------------
SYV_PASMU       -NNRTLIQAMAKLDAIRV------------------------------------------
SYV_HAEDU       -ENQLLLTAMAKLTSISV------------------------------------------
SYV_HAEI8       -KQTALLKAMAKLDNVQV------------------------------------------
SYV_HAEIN       -KQTALLKAMAKLDNVQV------------------------------------------
SYV_COLP3       -ENEQFLSSLAKLESITV------------------------------------------
SYV_PHOPR       -ANEIVLTSLAKLDSIKV------------------------------------------
SYV_ALIF1       -ANKVVLSSLAKLDEIKV------------------------------------------
SYV_VIBCH       -ANKPVLVSLAKLESIRV------------------------------------------
SYV_VIBVU       -ANKQVLMSLAKLESVRV------------------------------------------
SYV_VIBVY       -ANKQVLMSLAKLESVRV------------------------------------------
SYV_VIBPA       -ANKQVLMSLAKLESVRV------------------------------------------
SYV_PHOLL       -ENLNFIQAMGRLSSVTL------------------------------------------
SYV_YERPE       -ENQSFIQSLARLSSLTL------------------------------------------
SYV_YERPS       -ENQSFIQSLARLSSLTL------------------------------------------
SYV_PECAS       -ENLSFIQTLARLESITL------------------------------------------
SYV_SHIDS       -ENRGFLQTLARLESITV------------------------------------------
SYV_ECOL6       -ENRGFLQTLARLESITV------------------------------------------
SYV_ECOLI       -ENRGFLQTLARLESITV------------------------------------------
SYV_ECO57       -ENRGFLQTLARLESITV------------------------------------------
SYV_SHIBS       -ENRGFLQTLARLESITV------------------------------------------
SYV_SHISS       -ENRGFLQTLARLESITV------------------------------------------
SYV_SHIFL       -ENRGFLQTLARLESITV------------------------------------------
SYV_SALPA       -DNRSFLLNLARLESITV------------------------------------------
SYV_SALTI       -DNRSFLLNLARLESITV------------------------------------------
SYV_SALCH       -DNRSFLQTLARLESITV------------------------------------------
SYV_SALTY       -DNRSFLQTLARLESITV------------------------------------------
SYV_PSEHT       -ENNSFLASLAKIEEFTM------------------------------------------
SYV_SHEON       -ANQAFFATLARLESMTI------------------------------------------
SYV_CHRVO       -DFVPYLKLLARLTEGTL------------------------------------------
SYV_NEIG1       -DYLKYLPMMTRLTEARQ------------------------------------------
SYV_NEIMA       -DYLKYLPMMTRLTEAQQ------------------------------------------
SYV_NEIMB       -DYLKYLPMMTRLTEAQQ------------------------------------------
SYV_NITEU       -DFSPYLLALAKLSEVTI------------------------------------------
SYV_THIDA       -TLAPYMVALGKLGEVSA------------------------------------------
SYV_BORPE       -RNTPYLAALAKLSEVEV------------------------------------------
SYV_BORBR       -RNAPYLAALAKLSEVEV------------------------------------------
SYV_BORPA       -RNAPYLAALAKLSEVEV------------------------------------------
SYV_BURMA       -AFAPYVQALARLSEVRV------------------------------------------
SYV_BURPS       -AFAPYVQALARLSEVRV------------------------------------------
SYV_CUPPJ       -EASAHIQALAKLSEVRV------------------------------------------
SYV_RALSO       -AAAPYVQALGKLSEVKV------------------------------------------
SYV_AROAE       -SYAPYLAGLARLSEVAV------------------------------------------
SYV_DECAR       -EFAAILQALGKLSEVQI------------------------------------------
SYV_FUSNN       -KNELFIKKLANLEELTC------------------------------------------
SYV_BDEBA       -NNRTALMTMGRLENMEI------------------------------------------
SYV_GLUOX       -TWAEAIGRMARVSDVGV------------------------------------------
SYV_RHOS4       -RNEALILRLARLEGFTE------------------------------------------
SYV_RUEPO       -RNEALIKRLARIDSLTK------------------------------------------
SYV_SPHEL       -GQEAALARLGRVDQA--------------------------------------------
SYV_ZYMMO       -RFDPFIKRLARIESIH-------------------------------------------
SYV_CAUVC       -RHRDLLLTLARLDAVRE------------------------------------------
SYV_NITWN       -RWSDVIKRMSRLADISF------------------------------------------
SYV_BRADU       -RWTDVIKRMARLSDISF------------------------------------------
SYV_RHOPA       -RWSDVIKRLARVGEISF------------------------------------------
SYV_BARHE       -LYESLLKKLARVETISF------------------------------------------
SYV_BARQU       -RYGALLKKLARIETIDF------------------------------------------
SYV_AGRFC       -RHAAAIRRLARADEIRG------------------------------------------
SYV_RHIME       -RHASAIKRLARVENIEH------------------------------------------
SYV_RHILO       -RQDSAIKRLARVGDISL------------------------------------------
SYV_BRUME       -RHDAAIKRLARVERISF------------------------------------------
SYV_BRUSU       -RHDAAIKRLARVERISF------------------------------------------
SYV_DESPS       -SYTSGISDMTRLEGFTV------------------------------------------
SYV_DESVH       -EGREMLMTLARLDGLTV------------------------------------------
SYV_GEOSL       -RNEVYVMSLARLSDLAI------------------------------------------
SYV_PELCD       -AGEGYIKSLARIDDLAF------------------------------------------
SYV_DEHM1       -NYLGAVETLSRSRPVNI------------------------------------------
SYV_DEHMC       -NYLGAVETLSRARPVNI------------------------------------------
SYV_SYMTH       -EGRAFIENLGKTGQLTI------------------------------------------
SYV_LACCA       -QNFDFIDRFVNSKAFTV------------------------------------------
SYV_LACAC       -ENVDYVENFLHPKKLEV------------------------------------------
SYV_LACJO       -NNAEYVENFLHPKALSV------------------------------------------
SYV_STAS1       -NNSNYIDRFCHPSELTI------------------------------------------
SYV_STAAR       -QNKDYLIKFCNPSTLNI------------------------------------------
SYV_STAAC       -QNKDYLIKFCNPSTLNI------------------------------------------
SYV_STAAN       -QNKDYLIKFCNPSTLNI------------------------------------------
SYV_STAAS       -QNKDYLIKFCNPSTLNI------------------------------------------
SYV_STAAW       -QNKDYLIKFCNPSTLNI------------------------------------------
SYV_STAAM       -QNKDYLIKFCNPSTLNI------------------------------------------
SYV_STAEQ       -DNISYLHKFCNPSQLTI------------------------------------------
SYV_STAES       -DNISYLHKFCNPSQLTI------------------------------------------
SYV_STAHJ       -ENEDYIHKFCNPSDLTI------------------------------------------
SYV_LACPL       -ANEDYIQRFAHPKTLSI------------------------------------------
SYV_LACSS       -QNQDFIERFVHPKSLEI------------------------------------------
SYV_ENTFA       -ANTSYLERFCNPEELVI------------------------------------------
SYV_LACLA       -AVSPYISRFTNPSELTI------------------------------------------
SYV_STRMU       -ANVNYIKRFTNPETLEI------------------------------------------
SYV_STRA5       -DNSNYIKRFTNPETLEI------------------------------------------
SYV_STRA1       -DNSNYIKRFTNPETLEI------------------------------------------
SYV_STRA3       -DNSNYIKRFTNPETLEI------------------------------------------
SYV_STRT1       -DNINYIKRFTNPEHLEI------------------------------------------
SYV_STRT2       -DNINYIKRFTNPEHLEI------------------------------------------
SYV_STRP1       -SNINYIKCFTNPEKLEI------------------------------------------
SYV_STRPM       -SNVNYIKRFTNPEKLEI------------------------------------------
SYV_STRP6       -SNINYIKRFTNPEKLEI------------------------------------------
SYV_STRP3       -SNVNYIKRFTNPEKLEI------------------------------------------
SYV_STRP8       -SNVNYIKRFTNPEKLEI------------------------------------------
SYV_STRPN       -SNVNYIKRFTNPEHLEI------------------------------------------
SYV_STRR6       -SNVNYIKRFTNPEHLEI------------------------------------------
SYV_LISIN       -QNISYIERFCNPEKVTI------------------------------------------
SYV_LISMF       -QNISYIERFCNPEQVTI------------------------------------------
SYV_LISMO       -QNISYIERFCNPEQVTI------------------------------------------
SYV_OCEIH       -KNRDYLERFCNPSELSI------------------------------------------
SYV_BACC1       -KNSSYIERFCNPSELTI------------------------------------------
SYV_BACCZ       -KNSSYIERFCNPSELTI------------------------------------------
SYV_BACCR       -KNSSYIERFCNPSELTI------------------------------------------
SYV_BACAN       -KNSSYIERFCNPSELTI------------------------------------------
SYV_BACHK       -KNSSYIERFCNPSELTI------------------------------------------
SYV_BACSK       -RGVAYIEKFANPSLLDI------------------------------------------
SYV_BACHD       -RGKHYIEKFCNPSTLVM------------------------------------------
SYV_GEOSE       -KNRAYLERFCNPSELLI------------------------------------------
SYV_GEOKA       -KNRAYLERFCNPSELLI------------------------------------------
SYV_BACLD       -ENRSYVERFTNPSLLQI------------------------------------------
SYV_BACSU       -ANRSYVERFTNPSVLKI------------------------------------------
SYV_THEMA       EEEELLLKTLGNIEEVSF------------------------------------------
SYV_CARHZ       -ENAWAIAALAQSEPRVV------------------------------------------
SYV_CALS4       -SGKNYIMKLAGASEVAI------------------------------------------
SYV_CLOPE       -NGGAYLEKLASASEVTF------------------------------------------
SYV_CLOAB       -MGEHYFEKLAYASSVSF------------------------------------------
SYV_CLOTE       -DGKIYFEKLASASEVEF------------------------------------------
                                                                            

SYV_MYCGA       ------------------------------------------------------IKISDQ
SYV_MYCGE       -----------------------------------------------------KIETNKK
SYV_MYCPN       -----------------------------------------------------RIEVNKT
SYV_MYCPE       -----------------------------------------------------DIKSLKP
SYV_MYCS5       -----------------------------------------------------SEYKENK
SYV_MYCH2       -----------------------------------------------------------K
SYV_MYCH7       -----------------------------------------------------------K
SYV_MYCHJ       -----------------------------------------------------GKWLENK
SYV_MYCMO       -----------------------------------------------------ANFSENG
SYV_MYCPU       -----------------------------------------------------NSENMT-
SYV_PARUW       -----------------------------------------------------ETEEPKI
SYV_CHLPN       -----------------------------------------------------LDKEPEK
SYV_CHLMU       -----------------------------------------------------LSEAPKD
SYV_CHLTR       -----------------------------------------------------LAEAPKD
SYV_CHLAB       -----------------------------------------------------LTEEPKD
SYV_CHLCV       -----------------------------------------------------LSEEPKD
SYV_ONYPE       -----------------------------------------------------TNKVTNS
SYV_UREPA       ------------------------------------------------------KKTSSN
SYV_PORGI       -----------------------------------------------------VEEKTSG
SYV_BACFN       -----------------------------------------------------VDAKADG
SYV_BACFR       -----------------------------------------------------VDAKADG
SYV_BACTN       -----------------------------------------------------VESKAEG
SYV_WIGBR       ------------------------------------------------------------
SYV_DEIRA       --------------------------------------------------------LEGR
SYV_THET8       --------------------------------------------------------RPAK
SYV_THETH       --------------------------------------------------------RPAK
SYV_THET2       -------------------------------------------------------ERPAK
SYV_HELPJ       -----------------------------------------------------ITYKPLK
SYV_HELPY       -----------------------------------------------------ISSKPLK
SYV_CAMJE       -----------------------------------------------------SEEKLPK
SYV_CAMJR       -----------------------------------------------------SEEKLPK
SYV_HELHP       -----------------------------------------------------TQQKPKD
SYV_WOLSU       -----------------------------------------------------LSEKPAA
SYV_BORBU       ------------------------------------------------------NENYDG
SYV_BORBP       ------------------------------------------------------NENCDG
SYV_MESFL       -----------------------------------------------------NESLVSE
SYV_MYCMS       -----------------------------------------------------VDEAIKN
SYV_PELUB       ----------------------------------------------YNK----DLDKPTA
SYV_TREDE       -------------------------------------------------IDS-LKEKPAS
SYV_TREPA       ----------------------------------------------------LESDAPKP
SYV_GLOVI       --------------------------------------------------EEVADEHLKQ
SYV_PROMP       -------------------------------------------CKSKDI----DKNNFAQ
SYV_PROMA       -----------------------------------------------LHPREIFEESSGR
SYV_PROMT       ------------------------------------------------LSPEQAKSLPSM
SYV_PROMM       ---------------------------------------------------ATSADLTQR
SYV_SYNPX       -------------------------------------------MAPAEA----DAAPVAK
SYV_THEEB       ---------------------------------------------------GSGLQIPQR
SYV_SYNP6       --------------------------------------------------VESLTEEP-Q
SYV_NOSS1       NVPFLGTFFEIVGLGYSAWFVTRNLLSTPARKRFLAKFFAPPTEKNLSGTVQQAPEAAEK
SYV_SYNY3       ----------------------------------------------------VSQLPPEQ
SYV_LEPIC       ----------------------------------------------DTL----YEIQKTD
SYV_LEPIN       ----------------------------------------------DTL----YEIQKTD
SYV_STRAW       -----------------------------------------------------EGEDFAA
SYV_STRCO       -----------------------------------------------------EGDAFTA
SYV_CORJK       -----------------------------------------------------EDFAETA
SYV_CORDI       -----------------------------------------------------EDFAASA
SYV_COREF       -----------------------------------------------------EDFEESA
SYV_CORGL       -----------------------------------------------------DDFAASA
SYV_NOCFA       -----------------------------------------------------PDFAATA
SYV_MYCLE       -----------------------------------------------------NDFRPSA
SYV_MYCBO       ---------------------------------------------------PGPDFEPSV
SYV_MYCTU       ---------------------------------------------------PGPDFEPSV
SYV_MYCPA       -----------------------------------------------------PDFRPSA
SYV_BUCBP       ----------------------------------------------ILS----NVDSMLF
SYV_BLOFL       --------------------------------------------------LEKNDISNNR
SYV_BLOPB       ---------------------------------------------------ISKGTIYPK
SYV_BUCAI       -----------------------------------------------------LSEKYDK
SYV_BUCAP       ----------------------------------------------LSK----QDDEPCL
SYV_FRATT       ------------------------------------------------------NDNPPT
SYV_COXBU       -----------------------------------------------------AKHDDCF
SYV_XYLFA       ----------------------------------------------LGA----DSAAP-P
SYV_XYLFT       ----------------------------------------------LSA----TTAAP-P
SYV_XANC8       ----------------------------------------------LAA----GQEAP-P
SYV_XANCP       ----------------------------------------------LAA----GQEAP-P
SYV_XANOR       ----------------------------------------------LDA----GQDTP-P
SYV_XANC5       ----------------------------------------------LDA----GQDTP-P
SYV_XANAC       ----------------------------------------------LDA----GQDTP-P
SYV_LEGPA       ----------------------------------------------LAP----DEKVP-V
SYV_LEGPH       ----------------------------------------------LAP----DEKVP-V
SYV_LEGPL       ----------------------------------------------LAP----DEKVP-V
SYV_METCA       ----------------------------------------------LAP----GQAEP-E
SYV_NITOC       ----------------------------------------------------LKDETPPP
SYV_ACIAD       ----------------------------------------------LAQ----GEEPP-L
SYV_PSYA2       ----------------------------------------------LKE----GDEVP-L
SYV_PSEAE       ----------------------------------------------LEA----GEEAP-M
SYV_PSEPK       ----------------------------------------------LGD----ADEAP-L
SYV_PSEF5       ----------------------------------------------LAA----GDEAP-L
SYV_PSESM       ----------------------------------------------LTD----GAEAP-L
SYV_PSE14       ----------------------------------------------LTE----GAEAP-L
SYV_PSEU2       ----------------------------------------------LTE----GAEAP-L
SYV_IDILO       ----------------------------------------------IES----DDDAP-A
SYV_MANSM       ----------------------------------------------LAQ----DEEAP-L
SYV_PASMU       ----------------------------------------------LEA----GEDAP-L
SYV_HAEDU       ----------------------------------------------LTA----GEQAP-L
SYV_HAEI8       ----------------------------------------------LAA----NEAAP-L
SYV_HAEIN       ----------------------------------------------LAT----NETAP-L
SYV_COLP3       ----------------------------------------------LAD----DEQGP-A
SYV_PHOPR       ----------------------------------------------LAK----NEETQ-A
SYV_ALIF1       ----------------------------------------------LAN----GEETP-A
SYV_VIBCH       ----------------------------------------------LAD----GEATP-A
SYV_VIBVU       ----------------------------------------------LAA----GEETP-A
SYV_VIBVY       ----------------------------------------------LAA----GEETP-A
SYV_VIBPA       ----------------------------------------------LAA----DEETP-A
SYV_PHOLL       ----------------------------------------------LST----DEEAP-I
SYV_YERPE       ----------------------------------------------LAE----GDKGP-V
SYV_YERPS       ----------------------------------------------LAE----GDKGP-V
SYV_PECAS       ----------------------------------------------LPA----GDKGP-V
SYV_SHIDS       ----------------------------------------------LPA----DDKGP-V
SYV_ECOL6       ----------------------------------------------LPA----DDKGP-V
SYV_ECOLI       ----------------------------------------------LPA----DDKGP-V
SYV_ECO57       ----------------------------------------------LPA----DDKGP-V
SYV_SHIBS       ----------------------------------------------LPA----DDKGP-V
SYV_SHISS       ----------------------------------------------LPA----DDKGP-V
SYV_SHIFL       ----------------------------------------------LPA----DDKGP-V
SYV_SALPA       ----------------------------------------------LPA----DDKGP-V
SYV_SALTI       ----------------------------------------------LPA----DDKGP-V
SYV_SALCH       ----------------------------------------------LPA----DDKGP-V
SYV_SALTY       ----------------------------------------------LPA----DDKGP-V
SYV_PSEHT       ----------------------------------------------LEN----KDDAP-A
SYV_SHEON       ----------------------------------------------LGE----GETAP-M
SYV_CHRVO       -----------------------------------------------------VAKLPED
SYV_NEIG1       -----------------------------------------------------VAALPES
SYV_NEIMA       -----------------------------------------------------VATLPES
SYV_NEIMB       -----------------------------------------------------VAALPES
SYV_NITEU       ----------------------------------------------------LPDRLPDT
SYV_THIDA       -----------------------------------------------------VTALPEA
SYV_BORPE       -----------------------------------------------------VAALPDA
SYV_BORBR       -----------------------------------------------------VAALPDA
SYV_BORPA       -----------------------------------------------------VAALPDA
SYV_BURMA       -----------------------------------------------LPDEAALDADAHG
SYV_BURPS       -----------------------------------------------LPDEAALDADAHG
SYV_CUPPJ       -------------------------------------------------FEDDATLQAEG
SYV_RALSO       -----------------------------------------------YTDAAAMEQDGAG
SYV_AROAE       -----------------------------------------------------VDEIGTD
SYV_DECAR       -----------------------------------------------------VDDMPAD
SYV_FUSNN       ---------------------------------------------------GTDLEAPSQ
SYV_BDEBA       ----------------------------------------------GPE----GDMMKCA
SYV_GLUOX       ----------------------------------------------------VGEDAPRN
SYV_RHOS4       -----------------------------------------------------AASAPKG
SYV_RUEPO       -----------------------------------------------------ADAMPKG
SYV_SPHEL       -----------------------------------------------------QGDAP--
SYV_ZYMMO       -----------------------------------------------------KEAAPKG
SYV_CAUVC       -----------------------------------------------------ADAAPAG
SYV_NITWN       -----------------------------------------------------ADQAPAG
SYV_BRADU       -----------------------------------------------------ADRAPDG
SYV_RHOPA       -----------------------------------------------------ADAAPQG
SYV_BARHE       -----------------------------------------------------SDKAPAL
SYV_BARQU       -----------------------------------------------------SDRVLAV
SYV_AGRFC       -----------------------------------------------------GDVAPKG
SYV_RHIME       -----------------------------------------------------ASVAPRG
SYV_RHILO       -----------------------------------------------------ADAAPKG
SYV_BRUME       -----------------------------------------------------EQQAPKG
SYV_BRUSU       -----------------------------------------------------EQQAPKG
SYV_DESPS       ---------------------------------------------------VAEAEKPAD
SYV_DESVH       ---------------------------------------------------AVDVEAPKA
SYV_GEOSL       ----------------------------------------------G-Q----QLERPAD
SYV_PELCD       ---------------------------------------------------GVAVERPAQ
SYV_DEHM1       ----------------------------------------------LPG----HYSGAST
SYV_DEHMC       ----------------------------------------------LPG----HYSGAST
SYV_SYMTH       --------------------------------------------------QPVAEAKPKN
SYV_LACCA       ----------------------------------------------G-T----DVAEPKM
SYV_LACAC       ---------------------------------------------------SADIEAPKL
SYV_LACJO       ---------------------------------------------------AADIEAPKL
SYV_STAS1       ---------------------------------------------------DTTIEIPEK
SYV_STAAR       ---------------------------------------------------STDVEIPEK
SYV_STAAC       ---------------------------------------------------STDVEIPEK
SYV_STAAN       ---------------------------------------------------STDVEIPEK
SYV_STAAS       ---------------------------------------------------STDVEIPEK
SYV_STAAW       ---------------------------------------------------STDVEIPEK
SYV_STAAM       ---------------------------------------------------STDVEIPEK
SYV_STAEQ       ---------------------------------------------------DTEIEIPEK
SYV_STAES       ---------------------------------------------------DTEIEIPEK
SYV_STAHJ       ---------------------------------------------------DTHIDIPEK
SYV_LACPL       ---------------------------------------------------GADVVAPKL
SYV_LACSS       ----------------------------------------------A-E----GLTAPAL
SYV_ENTFA       ---------------------------------------------------SREIEAPEL
SYV_LACLA       ---------------------------------------------------AKDLAVPEQ
SYV_STRMU       ---------------------------------------------------SSAIATPEL
SYV_STRA5       ---------------------------------------------------SSAIATPEL
SYV_STRA1       ---------------------------------------------------SSAITAPEL
SYV_STRA3       ---------------------------------------------------SSAITAPEL
SYV_STRT1       ---------------------------------------------------AADVEVPDL
SYV_STRT2       ---------------------------------------------------AADVEVPDL
SYV_STRP1       ---------------------------------------------------SSAIAAPEL
SYV_STRPM       ---------------------------------------------------SSAIAAPEL
SYV_STRP6       ---------------------------------------------------SSAIAAPEL
SYV_STRP3       ---------------------------------------------------SSAIAAPEL
SYV_STRP8       ---------------------------------------------------SSAIAAPEL
SYV_STRPN       ----------------------------------------------A-S----TIPAPEL
SYV_STRR6       ----------------------------------------------A-S----TIPAPEL
SYV_LISIN       ---------------------------------------------------AFDIEPSKT
SYV_LISMF       ---------------------------------------------------SFDVEASKT
SYV_LISMO       ---------------------------------------------------SFDVEASKT
SYV_OCEIH       ---------------------------------------------------STVIEAPDK
SYV_BACC1       ---------------------------------------------------QTDLQAPEK
SYV_BACCZ       ---------------------------------------------------QTDLQAPEK
SYV_BACCR       ---------------------------------------------------QTDLQAPEK
SYV_BACAN       ---------------------------------------------------QTDLQAPEK
SYV_BACHK       ---------------------------------------------------QTDLQAPEK
SYV_BACSK       ---------------------------------------------------AVDLATPEK
SYV_BACHD       ---------------------------------------------------GTAIEKPEK
SYV_GEOSE       ----------------------------------------------D-T----NVPAPDK
SYV_GEOKA       ----------------------------------------------D-T----NVPAPDK
SYV_BACLD       ---------------------------------------------------GTDIQAVDK
SYV_BACSU       ---------------------------------------------------GTDIEAVDK
SYV_THEMA       -----------------------------------------------------VNEKPPK
SYV_CARHZ       ----------------------------------------------------PKMEVPQG
SYV_CALS4       --------------------------------------------------ERNRDNIPQK
SYV_CLOPE       --------------------------------------------------LDNKDNLDNN
SYV_CLOAB       --------------------------------------------------LKSKDEAPEN
SYV_CLOTE       --------------------------------------------------LNSKEEAPEN
                                                                            

SYV_MYCGA       KLNDLFLIATEDNEFYV------VYTQDKTKIVDKLVVEIAKLEKEVERSSNIVNNKNFK
SYV_MYCGE       VSFKYQIVDDT--TQRL----------------KSLQKQQAFFESEVKRSQAIVKNKSFL
SYV_MYCPN       PGFQIKIVDNA--ANNL----------------AHLEKQRSFYLAEVQRSQAITTNPAFL
SYV_MYCPE       DYVE----NNY--LIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFI
SYV_MYCS5       DFLI--VLDNN--SIFI----EISQE-QKQKQKQELEKKIAFCQSEITRAQNILSNQSFI
SYV_MYCH2       ELVI--KTKNF--EIAI----KVPEELKKE-QKGRELKEIQFLKSEILRAEKILTNKGFL
SYV_MYCH7       ELVI--KTKNF--EIAI----KVPEELKKE-QKGRELKEIQFLKSEILRAEKILTNKGFL
SYV_MYCHJ       ELVI--KTKNF--EIAI----KVPEELKKEQK-GRELKEIQFLKSEILRAEKILTNKGFL
SYV_MYCMO       QIFF--KLNNY--ELRL----QIPEEVKKEEETIRIKR-ILFLESEIKRSQSILSNEKFI
SYV_MYCPU       ------IVENI--KIFM----ILPKNIEENLSKEKAQK-IEFLKFEIKRAQSLLLNEKFI
SYV_PARUW       GFACTGVYHAL--KIQL----PLPEEL-LKQEKTRLNKEQEKLEISLEKLKNQLSNTDFV
SYV_CHLPN       GLYSFGVVDTIRLGIFV----PEEHLL---KEKGRLEKERVRLERAVENLERLLGDESFC
SYV_CHLMU       CIFSLGVVEGIQVGVIL----PAE---HLAKEHARLEKEKIRLENSIESLSKLLASEDFR
SYV_CHLTR       SIFSLGVVEGIQVGVIL----PPE---HLAKERVRLEKEKTRLEKSIDSVSKLLASEDFR
SYV_CHLAB       RIYSLGVVEGIRLGVFV----PVE---HIAKEKTRLEKEKTRLENAIESASRLLSSESFR
SYV_CHLCV       RVYSLGVVEGIRLGVFV----PME---HITKERNRLEKEKMRLENSIESVSRLLSSESFR
SYV_ONYPE       KKTIWLIEKNL--SLYI--DRKTLNELNETKFESNFLQQKNTLLKEIKRSETILNNPSFL
SYV_UREPA       NYTYELVIDDF--ILKT----SYEKPIDYVFQMKKASEQLNYLENEIQRATNLLNNSGFI
SYV_PORGI       STSF--LIGTL--EYAI----PMGALIDVGEEIKKLSDELAYQEKFLASVMKKLGNESFV
SYV_BACFN       ASSF--MIGTT--EFAV----PLGNMIDVDAEIARMEAELKHKEGFLQGVLKKLSNEKFV
SYV_BACFR       ASSF--MIGTT--EFAV----PLGNMIDVDAEIARMEAELKHKEGFLQGVLKKLSNEKFV
SYV_BACTN       ASSF--MVGTT--EYAV----PLGNMIDVEAEIARMEAELKHKEGFLQGVLKKLSNEKFI
SYV_WIGBR       -----------------------------------------------------VKNVDFS
SYV_DEIRA       TLSQ--VAPGV--TILA----PLEGTVDIADWVKKQQKRLAELDKQIKQAQGKLNNEGFV
SYV_THET8       ALVK--AMPRV--TARM----PLEGLLDVEEWRRRQEKRLKELLALAERSQRKLASPGFR
SYV_THETH       ALVK--AMPRV--TARM----PLEGLLDVEEWRRRQEKRLKELLALAERSQRKLASPGFR
SYV_THET2       ALVK--AMPRV--TARM----PLEGLLDVEEWRRRQEKRLKELLALAERSQRKLASPGFR
SYV_HELPJ       SVSD--VGEFC--QTYA----DLEN-LDLSPLIARLKKQLEKLEKEKLKLN--LHNENFV
SYV_HELPY       SVSD--VGEFC--QTYA----NLEN-LDLSPLVARLKKQLEKLEKEKLKLN--LHNENFV
SYV_CAMJE       AICD--VSENL--EIFI----TLEN-VDLSGILTRLENQKNKLEKESFKLNSMLSNEKFI
SYV_CAMJR       AICD--VSENL--EIFI----TLEN-VDLSGILTRLENQKNKLEKESFKLNSMLSNEKFI
SYV_HELHP       CVGD--VSKYC--ECYI----QLGE-IDLQAIGTRLHNQRQKLEKEITKLQAMLGNENFI
SYV_WOLSU       CVVD--VGEKC--EIYL-----STAQLDLSPIISRLEKQQEKLQKEVDKLLGMLNNEKFV
SYV_BORBU       MLGV--AAVGF--EIYA----DVKSLIDKTKELIRLEKQLEKYKMLNISVSKKLENENFL
SYV_BORBP       MLGL--AVVGF--EIYA----DVKLLIDKTKELIRLEKQLEKYKMLKISVSKKLENENFL
SYV_MESFL       TTSL--SVLDF--FIEI----PNDDFIDKEKMLEELATKKKELENEISRSERMLSNENFI
SYV_MYCMS       KTSL--SIDEY--FIEI----ANDSFINKNELIKELEQKQNYLNNEITRSQKILNNQEFI
SYV_PELUB       TLMV----SGD--LFKV----YFDEDVDLELIKKNLTTRQNKYQEEMNKISQRLANKGFV
SYV_TREDE       SIGV--VGAGF--EAFL----ITGDSIDIDQLKKRFEKELEKNEQNASKIDSKLKNENFV
SYV_TREPA       QVAVATAGTGF--ELFL----VTTEGIDRTMLCARLQKAWQKARQKVQQVERKLADAQFC
SYV_GLOVI       VAVG--VAGTV--QVML----PLGGLVDVAALAGKLRRSLEKLDKESGVLAARLDNASYL
SYV_PROMP       SFSG--IIGDL--EVYL----PFNDFVNLEALKDRLTKDLKKVNSDIETLNKRISNKNFI
SYV_PROMA       SLAG--VSGEL--EVLL----PIEGLVDLQALRNRLQKDLSKAENELSILSKRLDNPSFV
SYV_PROMT       KALA-GVSGEL--EVVL----PIEGLIDIASLRSRLEKDLNKAQKEIESLSGRLANKNFV
SYV_PROMM       CLAG--VSGEL--QVLL----PIDGLVDLDALRGRLEKDLAKAEKEIAGLAGRLANPNFA
SYV_SYNPX       ALAG--VSGEL--QVLL----PIEGLVDLDALKGRLEKDIAKAEKEIKGLAGRLGNPNFA
SYV_THEEB       VFSG--VVGKS--EVLI----PLAGVVDLEALVSKLQKEGDRLRKEIQSLTARLNNPNFV
SYV_SYNP6       ALVG--VTATV--QVLL----PLAGLVDLAALQTKLSRNLEKVEKEIKSLSGRLNSSNFV
SYV_NOSS1       SIAG--VVGTV--QVVI----PLAGVVDIETLRAKLERSISKAETEAQSLKGRLSNPKFV
SYV_SYNY3       TQAIAGVVDTI--QVLI----PLSGLVDLDILRNKIQKTLDKVTKEYESIEKRLSNPGFV
SYV_LEPIC       SVSH--FTKG---EIVL----PLEGLIDVAKEKARLEKELQKSELEKEKLEIKLSNPGFL
SYV_LEPIN       SVSH--FTKG---EIVL----PLEGLIDVAKEKTRLEKELQKSELEKEKLEIKLSNPGFL
SYV_STRAW       TATL--PVAGA--TVAL----DLSGTIDIVAERKRLAKDLAAAEKEKAQAGAKLGNEAFL
SYV_STRCO       TATL--PVAGV--EVAL----DLSGVIDFAAERKRLAKDLAAAEKEKAQANAKLGNEAFL
SYV_CORJK       SIEV--RLSQATIAVQL----DTSGTVDVAAERKRLEKDLAAAQKELDNAAKKLGNENFL
SYV_CORDI       SIEV--RLSQATIEISV----DTSGTVDKEAERKRLDKDLAAATKELETTAKKLGNESFL
SYV_COREF       SLEIRLSTATI--TVEL----DTSGTVDVAAERKRLEKDLATANKELETTGKKLGNEAFL
SYV_CORGL       SLEI--RLSQATITVEL----DTSGTVDVAAERKRLEKDLANAQKELETTAKKLGNEAFL
SYV_NOCFA       SVEV--RLSGATVTVEL----DTSGSVDLEAERKRLEKDLAAAQKELATTEGKLGNEAFL
SYV_MYCLE       LLEV--RLGPNKDRAVV-VELDTSGTIDVAAERRRMEKDLAAAQKELASTAAKLANADFL
SYV_MYCBO       SLEV-RLGPEMNRTVVV--ELDTSGTIDVAAERRRLEKELAGAQKELASTAAKLANADFL
SYV_MYCTU       SLEV-RLGPEMNRTVVV--ELDTSGTIDVAAERRRLEKELAGAQKELASTAAKLANADFL
SYV_MYCPA       SVEVRLRGGTV--VVEL----DTSGSIDVAAERRRLEKDLAAAHKELASTTAKLANEDFL
SYV_BUCBP       FKSY--IVLGA--ELLI----PYSKIFPKEKELKNLNKEISKIQLAINKLQQRLSNEEFI
SYV_BLOFL       YFKI--PIKES--ELII----FIPNIFDKKTAIHKFNKEIKLINYKIHLLEQKMNNTNYS
SYV_BLOPB       SMTM--PLDSS--ELLI----RIPDTFNKENEINRLKKESELINRKIETIQKLLDDNNFI
SYV_BUCAI       DLCIKEIIDGA--EIII----PILKLVDTKVELKRLVKEQKKTELNIFKIKTKILNKDFL
SYV_BUCAP       SLKE--IIDGV--DILV----PVLKAIDKEIELKRLNKEIEKIKSKMLISEKKMSNQDFL
SYV_FRATT       SLSQ--IVEGL--ELNI----PLAGLVDIEAEKARLDKELDKLKDEVDRVQKKLSNERFV
SYV_COXBU       SATATGIVERL--EIHI----PLAGVIDKQTEIARLKKEISKLQKEEEKSLKKLDNPNYL
SYV_XYLFA       SATA--IVGTL--KLLV----PLEGLIDVDAERVRLDKEIKRVESEIDKSNGKLSNAVFV
SYV_XYLFT       SATA--IVGSL--KLLV----PLEGLIDVDAERARLDKEIKRVESEIDKSNGKLSNAVFV
SYV_XANC8       AAAA--IVGEL--TLLV----PLEGLVDMDAERTRLDKEIKRVENEIGKCNGKLGNATFV
SYV_XANCP       AAAA--IVGEL--TLLV----PLEGLVDMDAERTRLDKEIKRVENEIGKCNGKLGNATFV
SYV_XANOR       SAAA--IVGEL--TLLV----PLEGLVDMDAERMRLDKEIKRVKGEIGKCNGKLGNATFV
SYV_XANC5       SAAA--IVGEL--TLLV----PLEGLVDMDAERTRLDKEIKRVEGEIAKCNGKLGSATFV
SYV_XANAC       SAAA--IVGEL--TLLV----PLEGLVDMDAERTRLDKEIRRVEGEIGKCNGKLGSATFV
SYV_LEGPA       SATA--VLGEI--ELLI----PMADLIDKEAELSRLNKELAKLNKDIELAQGKLNNPKFT
SYV_LEGPH       SATA--VLGEI--ELLI----PMADLIDKEAELSRLNKELAKLNKDIELAQGKLNNPKFT
SYV_LEGPL       SATA--VLGEI--ELLI----PMADLIDKEAELSRLNKELAKLNKDIELAQGKLNNPKFT
SYV_METCA       AAIA--LVGEL--RVLI----PMRGLIDKEAELTRLDKEIQRLDKELPRLEGKLGDASFL
SYV_NITOC       AATA--LVDEL--KLLI----PLAGLIDKEAELKRLDREMQRMRKDLARVQGKLANSNYV
SYV_ACIAD       SSSS--VVGHA--SVFV----PMKGLIDPKAELGRLQKDLDKVQKQHDQIASKLANEGFV
SYV_PSYA2       SSSS--MVGQL--RVLV----PMKGLIDPTAELARLGKSYDKLKGQSEGIARKLGNEGFV
SYV_PSEAE       SATA--LVGDM--EVLV----PMAGLIDKSAELGRLDKEIQRLEGEVKRVGGKLSNEGFV
SYV_PSEPK       SATA--LVGDL--QVLV----PMAGLIDKDAELARLNKEIQRLQGEVQRVGGKLSNTAFV
SYV_PSEF5       SATA--LVGEM--EVLV----PMAGLIDKGAELARLDKEIQRLQGEVQRVGGKLSNPSFV
SYV_PSESM       SATA--LVGDM--EVLV----PMAGLIDKGAELARLDKEIQRLQGEVQRVGGKLSNAAFV
SYV_PSE14       SATA--LVGDM--EVLV----PMAGLIDKGAELARLDKEIQRLQGEVQRVGGKLSNAAFV
SYV_PSEU2       SATA--LVGDM--EVLV----PMAGLIDKGAELARLDKEIQRLQGEVQRVGGKLSNAAFV
SYV_IDILO       SMTA--LVDTL--KLHI----PMAGLIDKEAELQRLQKSIEKANKEWQRLNGKLSNDNFV
SYV_MANSM       SVAK--LVGSA--ELLV----PMAGFINKDTELARLNKEIEKLIGEVKRIEGKLGNEAFV
SYV_PASMU       SVAK--LVNNA--ELLV----PMAGFINKEAELARLNKEIEKYQGEIQRIENKLANEAFV
SYV_HAEDU       SVAK--LVGQV--EVLV----PMAGFINKDTELARLSKEIDKLHNEVMRIESKLSNEAFV
SYV_HAEI8       AVAK--LVGNA--ELLV----PMAGFINKEAELARLTKEIEKYQNEVKRIENKLSNESFV
SYV_HAEIN       AVAK--LVGNA--ELLV----PMAGFINKEAELARLTKEIEKYQNEVKRIENKLSNEAFV
SYV_COLP3       SASA--VVGDL--SVLI----PMAGLIDKEAELARLDKAIEKLEKEAGRVRGKLGNENFV
SYV_PHOPR       CATS--LVGKS--ELMI----PMAGLIDKDAELARLDKEVAKTQGEIKRIEGKLNNQGFV
SYV_ALIF1       CATS--LVGKS--ELMI----PMAGLIDKDAELARLAGEVKKTQGEIKRIEGKLGNEGFV
SYV_VIBCH       CATA--LVGKS--ELMI----PMAGLIDKDAELDRLAKEIAKTQGEIARIEGKLGNEGFV
SYV_VIBVU       CATA--LVAKS--ELMI----PMAGLIDKDAELARLDKEVAKTQGEIKRIEGKLGNEGFV
SYV_VIBVY       CATA--LVAKS--ELMI----PMAGLIDKDAELARLDKEVAKTQGEIKRIEGKLGNEGFV
SYV_VIBPA       CATA--LVAKS--ELMI----PMAGLIDKDAELARLDGEIKKTHGEIKRIEGKLGNEGFV
SYV_PHOLL       SVTK--LINGA--EVLI----PMAGLVDKEAELSRLNKEIEKLDKEIGAIEGKLSNEGFV
SYV_YERPE       SVTK--LVEGA--EVLI----PMAGLIDKATELDRLAKEVAKLDAEIERIEGKLGNEGFV
SYV_YERPS       SVTK--LVEGA--EVLI----PMAGLIDKATELDRLAKEVAKLDAEIERIEGKLGNEGFV
SYV_PECAS       SVTK--LIEGA--ELLI----PMAGLIDKAAELDRLAKEVAKLEAEIGRIESKLSNEGFV
SYV_SHIDS       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_ECOL6       SVTK--IVDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_ECOLI       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_ECO57       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_SHIBS       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_SHISS       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_SHIFL       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFV
SYV_SALPA       SVTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEIARIEGKLSNEGFV
SYV_SALTI       SMTK--IIDGA--ELLI----PMAGLINKEDELARLAKEVAKIEGEIARIEGKLSNEGFV
SYV_SALCH       SVTK--IIDGA--ELLI----PMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFV
SYV_SALTY       SVTK--IIDGA--ELLI----PMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFV
SYV_PSEHT       CAAS--YVGNL--EIMI----PMAGLIDVEAELSRINKQLEKAEKGLAQVQNKLANEKFV
SYV_SHEON       STTG--LIGEM--ELLI----PMAGLVDVAAEMARIDKQLEKLTQEIARIEGKLSNEGFV
SYV_CHRVO       DAPV-AMSGEA--RLML----KVE--VDKAAETARLRKEQGKVEAELAKLTAKLEKPGYV
SYV_NEIG1       GDAPVAVCNGA--RLML----KVE--IDKAAETARLSKEAEKLQKALDKLNAKLSKPGYT
SYV_NEIMA       EDAPVAVCNGA--RLML----KVE--IDKATETARLSKEAEKLQKALDKLNAKLSKPGYT
SYV_NEIMB       EDAPVAVCNGA--RLML----KVE--IDKAAETARLSKEAEKLQKALDKLNAKLSKPGYT
SYV_NITEU       DAPV-AITGEF--RLML----KIE--VDVAAERERLNKEMQRLTLEIGKARTKLDNPDFL
SYV_THIDA       DAPV-ALVGDM--RMML----VVE--IDKDAERARLAKEIARIQGEIRKAETKLANPSFV
SYV_BORPE       GAPV-QVVGDA--RLML----HVE--IDVAAECARLDKEIARLEGEIAKANGKLGNASFV
SYV_BORBR       GAPV-QVVGDA--RLML----HVE--IDVAAECARLDKEIARLEGEIAKANGKLGNASFV
SYV_BORPA       GAPV-QVVGDA--RLML----HVE--IDVAAECARLDKEIARLEGEIAKANGKLGNASFV
SYV_BURMA       APIA--IVGGN--KLVL----KVE--IDVAAERERLSKEIARLEGEIVKCNAKLGNEAFV
SYV_BURPS       APIA--IVGGN--KLVL----KVE--IDVAAERERLSKEIARLEGEIVKCNAKLGNEAFV
SYV_CUPPJ       AGAPVAIVGGN--HLLL----KIE--IDVAAERVRLSKEIERIGGEIGKCRGKLSNESFV
SYV_RALSO       APVA--IVGEN--KLLL----KIE--IDVAAEHARLSKEIDRLRGEIVKCEGKLGNESFV
SYV_AROAE       ELAPVAVAGRF--KLML----RVE--IDIAAERERIAKEIARLEGEMTKAESKLANESFV
SYV_DECAR       AMAPVAVVGET--RLML----KVE--IDVAAERIRLAKEIEKLEKQISIAQGKLANEGFV
SYV_FUSNN       SSLR--VAGNS--SVYM----ILTGLLNNEAEIKKINEQLAKLEKELEPVNRKLSDEKFT
SYV_BDEBA       VAPV--VVKDASVKVII----PLEGLVDFDEEVKRINKSIEKLTRDIGMLSGKLSNEKFV
SYV_GLUOX       AAQL--VLDEA--TVFI----PLEGLIDLDAERARLAKEITRIEGEILKVTRKLDNADFV
SYV_RHOS4       ALTI--AVEGG--SFAI----PLEGVIDIGAEKARLAKTLEKLEKDMAGLRGRLGNPNFV
SYV_RUEPO       CISI--AAPGA--AFGL----PLAEIIDIGAEKDRLEKAKGKLAKELGGLRGRLNNPKFV
SYV_SPHEL       ------AGGGA-------------------------------------------------
SYV_ZYMMO       AAAQ-IVVDEA--TFVL----PLEGVIDLDAERGRLKKAIEAVEKEKTATEKRLGNPNFV
SYV_CAUVC       SAPV--VMGEA--TGAL----GVAEFIDVAAEKARLTKDIAGHAGEIEKVNKKLGNPDFL
SYV_NITWN       AVQL--LIRGE--VAAL----PLKGIVDVAAQRTRLGKEIAKADADIARVDLKLADQNFI
SYV_BRADU       AVQL--LVRGE--VAAL----PLKGVIDVAAERTRLDKEIGKADADIKRAESKLANEKFV
SYV_RHOPA       AVQL--LVRGE--VAAL----PLKGVVDFAAEQARLEKELGKAEADIKRAEAKLANEKFV
SYV_BARHE       SAQM--ILGEA--IFCL----PLGQLIDLEAERARLMKDVSKIEQDIEKLSAKLSNPKFI
SYV_BARQU       SAQM--VLGEA--IFCL----PLGQLIDLEAERARLVKNVSKIEQDIEKISVKLNNPKFV
SYV_AGRFC       SAQI--IVGEA--TVCL----PLGNLVDLAAEQARLEKAIGKVDAEMERIDKKLSNEKFV
SYV_RHIME       SAQI--VVGEA--TACL----PLGSLIDLGAEKLRLEKAIAKVDVERERILGKLANEKFV
SYV_RHILO       SAQI--VLNEA--TICL----PLGSLIDLAAEAARLQKELAKVTEEIARLHKKLSNERFV
SYV_BRUME       AAQM--LLGEA--TICI----PLGSLIDLQAEAARLAKEAGKIAAEMDRIEKKLANEKFV
SYV_BRUSU       AAQM--LLGEA--TICI----PLGSLIDLQAEAARLAKEAGKIAAEMDRIEKKLANEKFV
SYV_DESPS       AATY--IYNDI--EIFV----PLAGLVDIEAELEKLSRERKKVEAKLKQINGKLGNAKFL
SYV_DESVH       SASS--VVAGN--EVIV----PLTGAVDFEAELARLDKELGKIEKDFVQVNKKLANESFV
SYV_GEOSL       AAIQ--VAGDV--EIAV----PLKGLVNVEEEEKRLLKEIGKLDKEIEMFGRKLENPSFV
SYV_PELCD       AATQ--VAGDI--EILL----PLAGLIDLDEEQKRLNKEIAKVEKDVLMFSKKLSNESFL
SYV_DEHM1       ATEVVLVLNGI--EVVV----PMSTMVDLEAEAKRVEAEIAELETQIERLSARLSDTQFL
SYV_DEHMC       ATEVVLVLTGI--EVVV----PMSTMVDLEVEAKRVKAEISELEIQIERLSTRLSDEQFL
SYV_SYMTH       AAAA--VVTGA--EIYV----PLGGLIDLPKEIERLTKELTTTGDELAKLEKKLSNEGFL
SYV_LACCA       AGSA--VITGA--TIFV----PLNELIDLDEEKAKLTKDAKKLEQEIARIDKKLNNQGFL
SYV_LACAC       AKTA--VIPGA--QIFV----PLTELVNVDEELAKMEKEAKRLEDEVARCEKKLSNKGFV
SYV_LACJO       AKTA--VIPGA--QIFV----PLTELVNVDEELAKMEKEEKRLEAEVERAEKKLSNQGFV
SYV_STAS1       AMTS--VTTAG--EVVL----PLEGLIDMDKEIARLENELLKWEKELDRVNKKLANENFV
SYV_STAAR       AMTS--VVIAG--KVVL----PLEGLIDMDKEISRLEKELAKLQSELDRVDKKLSNENFV
SYV_STAAC       AMTS--VVIAG--KVVL----PLEGLIDMDKEISRLEKELAKLQSELDRVDKKLSNENFV
SYV_STAAN       AMTS--VVIAG--KVVL----PLEGLIDMDKEISRLEKELAKLQSELDRVDKKLSNENFV
SYV_STAAS       AMTS--VVIAG--KVVL----PLEGLIDMDKEISRLEKELAKLQSELDRVDKKLSNENFV
SYV_STAAW       AMTS--VVIAG--KVVL----PLEGLIDMDKEISRLEKELAKLQSELDRVDKKLSNENFV
SYV_STAAM       AMTS--VVIAG--KVVL----PLEGLIDMDKEISRLEKELAKLQSELDRVDKKLSNENFV
SYV_STAEQ       AMTT--VVVAG--KVVL----PLEGLIDMDKEIARLEKELDKLQSELDRVDKKLSNENFV
SYV_STAES       AMTT--VVVAG--KVVL----PLEGLIDMDKEIARLEKELDKLQSELDRVDKKLSNENFV
SYV_STAHJ       AMTA--VVIAG--KVVL----PLEGLIDMDKEIARLEKELDKLQKELDRVDKKLSNENFV
SYV_LACPL       AMTQ--VISDA--EVYI----PLAELVDLDEEVKKLEKEQAKFESEVARATKKLGNERFV
SYV_LACSS       AKTA--IISGA--EVYV----PLAELLDLDEEITRLEGELKRLNGEIKRAQGKLANKGFT
SYV_ENTFA       AMSA--VLTGA--ELFL----PLAGLINIEEEIARLEKELDKWTKEVKRVQGKLSNERFV
SYV_LACLA       AMSA--VITGA--ELYL----PLAGLINIEEEIARLEKELAKWQKELDLVNKKLGNERFV
SYV_STRMU       AMSA--VITGA--EIFL----PLADLLNVEEELARLNKELAKWQKELDIVAKKLSNDRFV
SYV_STRA5       AMSS--VITGA--EIFL----PLADLLNVEEELARLEKELAKWQKELDMVGKKLSNERFV
SYV_STRA1       AMTS--IITGA--EIFL----PLADLLNVEEELARLEKELAKWQKELNMVGKKLSNERFV
SYV_STRA3       AMTS--IITGA--EIFL----PLADLLNVEEELARLEKELAKWQKELNMVGKKLSNERFV
SYV_STRT1       VMSS--IITGA--EIYL----PLADLLNVEEELARLEKELAKWQKELDMVGKKLSNERFV
SYV_STRT2       VMSS--IITGA--EIYL----PLADLLNVEEELARLEKELAKWQKELDMVGKKLSNERFV
SYV_STRP1       AMTS--IITGA--EIYL----PLADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFV
SYV_STRPM       AMTS--IITGA--EIYL----PLADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFV
SYV_STRP6       AMTS--IITGA--EIYL----PLADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFV
SYV_STRP3       AMTS--IITGA--EIYL----PLADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFV
SYV_STRP8       AMTS--IITGA--EIYL----PLADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFV
SYV_STRPN       AMSS--VITGA--EIYL----PLADLLNVEEELARLDKELAKWQKELDMVGKKLSNERFV
SYV_STRR6       AMSS--VITGA--EIFL----PLVDLLNVEEELARLEKELAKWQKELDMVGKKLSNERFV
SYV_LISIN       AMTA--VVSGA--EIFI----PLEALIDLDLEIARLEKELEKWNKEVARVQGKLNNERFI
SYV_LISMF       AMTA--VVSGA--EIFI----PLEALIDLNVEIARLEKELEKWNKEVARVQGKLNNERFI
SYV_LISMO       AMTA--VVSGA--EIFI----PLEALIDLNVEIARLEKELEKWNKEVARVQGKLNNERFI
SYV_OCEIH       AMTS--VVTGA--EIFL----PLEGLIDFDKEIKRLENELAKWTKEVERVQKKLSNQGFV
SYV_BACC1       AMTA--IVTGA--ELFL----PLADLINLDEERARLEKELEKFDKEVERVQKKLSNQGFV
SYV_BACCZ       AMTA--IVTGA--ELFL----PLADLINLDEERARLEKELEKFDKEVERVQKKLSNQGFV
SYV_BACCR       AMTA--IVSGA--ELFL----PLADLINLDEERARLEKELEKFDKEVERVQKKLSNQGFV
SYV_BACAN       AMTA--IVTGA--ELFL----PLADLINLDEERARLEKELEKFDKEVERVQKKLSNQGFV
SYV_BACHK       AMTA--IVTGA--ELFL----PLADLINLDEERARLEKELEKFDKEVERVQKKLSNQGFV
SYV_BACSK       AMSH--ALSGM--ELFL----PLAGMLDLDKEVARLEKELDKLNKEVERIEKKLNNQGFL
SYV_BACHD       SMSN--VLSGV--ELYL----PLAGLLDLEEEIARLEKEENKLEKEVERVQKKLSNQGFL
SYV_GEOSE       AMTA--VVTGA--ELIM----PLEGLINIEEEIKRLEKELDKWNKEVERVEKKLANEGFL
SYV_GEOKA       AMTA--VVTGA--ELIM----PLEGLINIEEEIKRLEKELDKWNKEVERVEKKLANEGFL
SYV_BACLD       AMTA--VVSGA--ELIL----PLEGLINIDEEISRLQKELDKLTKEVERVQKKLSNEGFM
SYV_BACSU       AMTA--VVSGA--EVIL----PLEGLINIDEEIARLQKEFDKLTKEVERVQKKLGNEGFM
SYV_THEMA       TATA-YVEEEI--EAYV----DLGGLIDFEKEKERLKQIMEKIQKEIDRLEKKLANKDFV
SYV_CARHZ       ALTG--VAAGV--TIYL----PLKDLIDLEKEKERLNKELKKVLAEIERLNQKLNNPGFL
SYV_CALS4       AMSA--AISAG--LIAV----PLEELIDLEEEIKRLEEEREKVLKEIERAQSLLNNENFV
SYV_CLOPE       LVSV--VVKGG--ELFL----PLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFV
SYV_CLOAB       AVSS--VTKGA--ELFM----PLLDLIDVTKEIERLSKEKDKLKAEIQRVDKKLSNKGFV
SYV_CLOTE       AVSA--VTKGA--EIYI----PLFDLVDLEKEMERLNKEREKLEKEIERVDKKLSNENFV
                                                                            

SYV_MYCGA       KKAPKEKYEAELKKLSNYQEELKLKQDKLNSLK-----------
SYV_MYCGE       EKAPKEKVKSEFLKLEEYQKKLTETNQLIAKLTKAH--------
SYV_MYCPN       KKAPPHKVKAELLKLEEYQKKLAEVNHLIAKLTKAE--------
SYV_MYCPE       EKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK-----------
SYV_MYCS5       AKAPKEKIKLEEDKLQRYKQELQIYLEEL-KWKY----------
SYV_MYCH2       EKAPREKIDLERTKLEKLKEKLAFYEKK----------------
SYV_MYCH7       EKAPREKIDLERTKLEKLKEKLAFYEKK----------------
SYV_MYCHJ       EKAPREKIDLERTKLEKLKEKLVFYEKK----------------
SYV_MYCMO       NNASEIKVKEEKEKLEKYIKEFEEIK------------------
SYV_MYCPU       SKAPTLKVEEEKAKLEKYQLQLKELLDE-KIIE-----------
SYV_PARUW       RRAPAHLTEKQNQQLSQTEQELREIKEKLMTLP-----------
SYV_CHLPN       QKANPNLVVAKQEALKNNRIELQGILDKLASFA-----------
SYV_CHLMU       TRANPNLVQAKEDALRNSRQELQSILDKIASL------------
SYV_CHLTR       TRANPSLVQAKKDSLRNSQRELQSILDKLASL------------
SYV_CHLAB       AKANPDLVCAKEEALKNNRIELQSILDKLASFS-----------
SYV_CHLCV       AKANPDLVRSKEETLKNNRMELQSILDKLASFS-----------
SYV_ONYPE       QKAASAKIEIEKKKYESYCKQYKKLLESKNNSNPLNPNKK----
SYV_UREPA       NKAPAQLIIKEKNKLINLKKEHANLLKTLTDLKQKVK-------
SYV_PORGI       AKAPQAVIELEQKKKSDAEARIATLRDSLNQLQSTK--------
SYV_BACFN       NNAPAAVIEMERKKQADAESIIQSLKESIASLKNV---------
SYV_BACFR       NNAPAAVIEMERKKQADAESIIQSLKESIASLKNV---------
SYV_BACTN       NNAPAAVLEMERKKQADAESIISSLKESIAALKKA---------
SYV_WIGBR       RSIPKNVLKKDIKIINNIKIYIYN--------------------
SYV_DEIRA       ARAPAEVIEEEKRRVADFGAQKERLEGVLAQLG-----------
SYV_THET8       EKAPKEVVEAEEARLKENLEQAERIREALSQIG-----------
SYV_THETH       EKAPKEVVEAEEARLKENLEQAERIREALSQIG-----------
SYV_THET2       EKAPKEVVEAEEARLRENLEQAERIREALSQIG-----------
SYV_HELPJ       KNAPKSVLEKARESLKTLLEKEGKIQQELDLLEQP---------
SYV_HELPY       KNAPKSVLEKAKESLKTLLEKESKIKQELDLLEQP---------
SYV_CAMJE       ANAPKEVVEQNKEALENLKIQLEKISVELQNLRG----------
SYV_CAMJR       ANAPKEVVEQNKEALENLKIQLEKISVELQNLRG----------
SYV_HELHP       KNAPKAVMEQNQSALHNAQEKLDKINAELIALGLQS--------
SYV_WOLSU       ANAPQNVLEQNRVALKEAQTKLDKVKVELQGIKG----------
SYV_BORBU       MNAPKEIVESEKLKFVEFSSLINKINNYIINLKNL---------
SYV_BORBP       MNAPKEIIESEKLKFVEFSSLINKINSYIINLKNL---------
SYV_MESFL       SKAAPSKIEEEKEKYELYKQQLELIQDKLNKM------------
SYV_MYCMS       KKAKPEKIQSEKIKYQNYLDQLQAIKDKLKELTND---------
SYV_PELUB       DRAPKDIVDQEKTNYNNLKNDVERISITIKGL------------
SYV_TREDE       KNAPPEVIEGEKEKHAEFLRRIEKLKGYLEGMR-----------
SYV_TREPA       THAPEEVVTAERKKLAEARATCHTLAGYLADMNGKPGPLSDSD-
SYV_GLOVI       ANAPAELVTESRAKLAEQRAQAAILAEQLARLEN----------
SYV_PROMP       DKAPKEIVDECFAKLKEGNLQSEIINKKLKLLK-----------
SYV_PROMA       QKAPEKVIEECRLKLSDAEAQAELVRQRLLGLK-----------
SYV_PROMT       DKAPKDVVEECRANLTESEAQVRLVKERLMGLD-----------
SYV_PROMM       IKAPPNVVEECQSNLAEAEAQAELARQRLSDLG-----------
SYV_SYNPX       DKAPPEVVAECQANLDEKQAQADLARKRLADLS-----------
SYV_THEEB       NKAQPEVVAAAQAQLAAAQQQLAIIEHRLQSLGVDDKTQP----
SYV_SYNP6       DKAPAEVVAETRENLLEAEKQAELLRDRLTRLQA----------
SYV_NOSS1       DKAPADVVQAARDALAEAEKQVEILRLRLQTLV-----------
SYV_SYNY3       NKAPEEVIAGAKESLNAAAVQRQMLQERLKMLG-----------
SYV_LEPIC       SKAAPEVVEKERDKLKTLIDKVEVLKKGIQNLAG----------
SYV_LEPIN       SKAAPEVVEKERDKLKTLIDKVEVLKKGIQNLAG----------
SYV_STRAW       AKAPDHVVDKIRGRLAKADEDIARIQAQLDRMPEA---------
SYV_STRCO       AKAPDQVVDKIRGRLAKADEDITRITAQLEKLPEA---------
SYV_CORJK       AKAPEKVVEGIRERQRVAQEEFERITARLEGLPKA---------
SYV_CORDI       AKAPEAVVAKIRERQQIAQEEVARISARLEELK-----------
SYV_COREF       AKAPDAVVEKIRGRQQVAREEVERITKRLEELG-----------
SYV_CORGL       SKAPDAVVDKIRGRAQIAQEEVERINKRLEELA-----------
SYV_NOCFA       AKAPEQVVDKIRTRRDVAAAEVARIGARLAELGAR---------
SYV_MYCLE       AKAPEAVVVKIRDRQRMAKEETDRIIARLAGLQ-----------
SYV_MYCBO       AKAPDAVIAKIRDRQRVAQQETERITTRLAALQ-----------
SYV_MYCTU       AKAPDAVIAKIRDRQRVAQQETERITTRLAALQ-----------
SYV_MYCPA       AKAPPHVVDKIRDRQRLAQEESERINARLAVLQ-----------
SYV_BUCBP       GKAPIHVVKKYKNQLQIYIEHKTQLCHKKLTMLRD---------
SYV_BLOFL       LNL-QHSFKKSQEKLNHYNKTKNKLLNQYFIVKNL---------
SYV_BLOPB       NQAPKSVIKDKQALLNYYELIQNKLIDQCAIMKKL---------
SYV_BUCAI       SYAPTKIVTQEKNKLLKLNEINLKLSEQIKIFRNMSYKK-----
SYV_BUCAP       SYAPKNIIDKEIKKLKSLNEIYLTLSQQLESLHDAFCKKNKIFN
SYV_FRATT       SNAPEAVVAAEQEKLAKYQELYAKTLEKKEALG-----------
SYV_COXBU       QRAPQEVVEKERLSLEKTQNALKKLQSQYASIESL---------
SYV_XYLFA       QNAPAAVVEQERSRLTEWTTQLNGLRERRATL------------
SYV_XYLFT       QNAPTAVVEQERSRLREWTTQLNGLRERRTTL------------
SYV_XANC8       QNAPAAVVEQERARLNDWTTQLTGLREQRAKL------------
SYV_XANCP       QNAPAAVVEQERARLNDWTTQLTGLREQRAKL------------
SYV_XANOR       QNAPAVVVDQERARLADWTTQLAGLREQRGKL------------
SYV_XANC5       QNAPAAVVEQERARLNDWTTQLTGLREQRAKI------------
SYV_XANAC       QNAPAAVVEQERARLNDWTTQLTGLREQRAKI------------
SYV_LEGPA       DKAPEEIIAKEKDKLAQAQVAKDKLLQHKNRIESL---------
SYV_LEGPH       DKAPEEIIAKEKDKLAQAQVAKDKLLQHKNRIESL---------
SYV_LEGPL       DKAPEEIIAKEKDKLAQAQLAKDKLLQHKNRIESL---------
SYV_METCA       SKAPPAVVEKEKARLADLQAGLASLVAQKERIQAL---------
SYV_NITOC       ERAPAEIVAKERQRAQEVTAALSTLEQQHAEITDLNP-------
SYV_ACIAD       AKAPAAVVEGEKVKLAEFADQLVKIKQSMEQIAAL---------
SYV_PSYA2       SKAPVEVVDAEKAKLAELEGQLTAMTAQMEELKNL---------
SYV_PSEAE       AKAPADVIEKERAKLAEAEQALAKLAEQRQKIAAL---------
SYV_PSEPK       DKAPPAVIEKERAKLAESEQALANFTEQHARIAAL---------
SYV_PSEF5       DKAPAEVIEKERAKLAEAEQALGKLAEQHARISSL---------
SYV_PSESM       DKAPPDVIAKERAKLTEAEQALGKLAEQHARIASL---------
SYV_PSE14       DKAPPEVIAKERAKLTEAEQALGKLAEQHARIASL---------
SYV_PSEU2       DKAPPEVIAKERAKLTEAEQALGKLAEQHARIASL---------
SYV_IDILO       SKAPEAVIAKEREKLSEAETTLKQLQEQQDKIKAL---------
SYV_MANSM       AKAPEAVIAKEREKMQDYQEGLEKLRAQYLSIENL---------
SYV_PASMU       AKAPPAVIEKERAKMAEYAEGLNKLKQQYLAIEAL---------
SYV_HAEDU       AKAPEAVISKERAKMAEYQSGIEKLQAQFKAIEAL---------
SYV_HAEI8       AKAPEAVIAKEREKQAEYQSGLEKIQEQYKAIEAL---------
SYV_HAEIN       AKAPEAVIAKEREKQAEYQSGLEKIQEQYKAIEAL---------
SYV_COLP3       SKAPAAVIEKEQAKLADAESTLAKILEQKIQIAAL---------
SYV_PHOPR       AKAPEVVITKEREKLEGYQETLVKLEAQKETIAAL---------
SYV_ALIF1       AKAPEAVIAKEREKLEGYQETLVKLEAQQETIAAL---------
SYV_VIBCH       AKAPEAVITKEREKLAGYQEALVKLEQQKATIAAL---------
SYV_VIBVU       AKAPEAVIAKEREKLEGYQETLAKLEEQKATIAAL---------
SYV_VIBVY       AKAPEAVIAKEREKLEGYQETLAKLEEQKATIAAL---------
SYV_VIBPA       AKAPEAVVAKEREKLEGYKETLAKLEEQKKTIAAL---------
SYV_PHOLL       SRAPEAVVTKERERLANCNTSKEKLLAQKETIAAL---------
SYV_YERPE       ARAPEAVVAKERERLAACAEAKQKLIEQQATIAAL---------
SYV_YERPS       ARAPEAVVAKERERLAACAEAKQKLIEQQATIAAL---------
SYV_PECAS       ARAPEAVVAKEREKMDGYAVAKTKLLEQQAVIAAL---------
SYV_SHIDS       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_ECOL6       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_ECOLI       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_ECO57       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_SHIBS       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_SHISS       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_SHIFL       ARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL---------
SYV_SALPA       ARAPEAVIAKEREKLDGYAEAKAKLIEQQAVISAL---------
SYV_SALTI       ARAPEAVIAKEREKLDGYAEAKAKLIEQQAVISAL---------
SYV_SALCH       ARAPEAVIAKEREKLDSYAEAKAKLIEQQAVISAL---------
SYV_SALTY       ARAPEAVIAKEREKLDGYAEAKAKLIEQQAVISAL---------
SYV_PSEHT       NNAPEAVLAKENAKLAEFSDAKTKLLEQKAKIESL---------
SYV_SHEON       AKAPPAVIDKERAKMADLSRDIDKLTEQKAEFAKLEA-------
SYV_CHRVO       DKAPAHLVERDKAQLAELNDKLEKIRVQLVKLA-----------
SYV_NEIG1       EKAPAHLVEKDKADLAELEDKMAKVQNQLAKLKD----------
SYV_NEIMA       EKAPAHLVEKDKADLAELEDKMAKVQTQLSKLKD----------
SYV_NEIMB       EKAPAHLVEKDKADLAELEDKMAKVQNQLAKLKD----------
SYV_NITEU       QRAPEKVVLQEKERLATFSATLEKLDQQLHKLG-----------
SYV_THIDA       DKAPAAVVQQEQARLADFAAMLQKLEAQHARLG-----------
SYV_BORPE       ERAPAAVVEQEKARLAQFSETLEKVRGQRVKLGV----------
SYV_BORBR       ERAPAAVVEQEKARLAQFSETLEKVRGQRVKLGA----------
SYV_BORPA       ERAPAAVVEQEKARLAQFSETLKKVRGQRVKLGA----------
SYV_BURMA       AKAPPAVVAQEQKRLAEFQSTLTKLGAQLARLPA----------
SYV_BURPS       AKAPPAVVAQEQKRLAEFQSTLTKLGAQLARLPA----------
SYV_CUPPJ       AKAPPAVVAQETQRLSDFEQTLAKLQDQLQRLPA----------
SYV_RALSO       ARAPAAVVEQEQKRLADFKATLGKLEAQIARLPVQTA-------
SYV_AROAE       ARAPATVVQQERERLASFVATLEKLRPQLEKLGAR---------
SYV_DECAR       ARAPAAVIDQEKQRVADFTATLEQLKPQLAKLGQA---------
SYV_FUSNN       SKAPQHIIDRELRIQKEYQDKIKKLKESLKSFEE----------
SYV_BDEBA       ANADEEVVAADRALLAQSKVQLDSLRDALTRFQ-----------
SYV_GLUOX       ARAKPEVVEENHDRLATFQSDLERLKAALGRLA-----------
SYV_RHOS4       ASAPEEVVDEARTRLEQGEEEGAKLSAALARLSEIA--------
SYV_RUEPO       ESAPDEVVEEARENLAAREEEEARLNEALARLAELG--------
SYV_SPHEL       --------------------------------------------
SYV_ZYMMO       ARAKAEVVAENRERLNNFTGEITKLKAALERLM-----------
SYV_CAUVC       ARAKEEVVEENRERLAEAEAAKAKLEAALSRLASVG--------
SYV_NITWN       ANAPGEIVEDEKEKREAAAARKAKFVEALERLKAAE--------
SYV_BRADU       ANAAEEVVEEEREKREAALARKAKLLEALERLKQAS--------
SYV_RHOPA       ANAAEEVVEEEREKREAAVARKVKILEALLRLKNAS--------
SYV_BARHE       ENAKPEIVEVERNRIVELRTAQKKISLALERLV-----------
SYV_BARQU       ENAKPEIVEAERNKILELRVAQKKISIALERLV-----------
SYV_AGRFC       ANADPEVVAAERERKAELDVQLASLRTALTRVSEAG--------
SYV_RHIME       ANAKPELVEAERERLVELDLQRDSLGVALSRVSEAG--------
SYV_RHILO       ASAPAEIVEAEREKLAEYRDAQDKLAVALTRVRDAG--------
SYV_BRUME       ANAREEVVEAERERLLELKEAAQRVATAESRIRDAS--------
SYV_BRUSU       ANAREEVVEAERERLVELKEAAQRVATAESRIRDAS--------
SYV_DESPS       AGAPEAVVAKVTGEKEELDAKLAKIDEASDRLKKLS--------
SYV_DESVH       SKAPADVVAKERARAEELSDAKAKLEALQQRFRDAIGK------
SYV_GEOSL       ERAPADVVAKEREKLAEVTQKKDVLLASLEKIRKLA--------
SYV_PELCD       AKAPAAVLEKDRQKLADAEEKLSILKQGLEKLAALQ--------
SYV_DEHM1       AKAPQAVVDKERTKLEGYIEKVSRLKAV----------------
SYV_DEHMC       AKAPQAVVDKERIKLEGYIEKVSRLKSA----------------
SYV_SYMTH       TKAKPEVVEKTREEAAALAEKRQALENRLAMLRSMQG-------
SYV_LACCA       SKAPEAVVAEQRTKRSDFEDQLTSTKQRLEQLQRA---------
SYV_LACAC       DHAPEAVVNKEKEKMADYESQLSGVRERIQDLKESK--------
SYV_LACJO       AHAPEAVINKEKEKKADYESQLAGVRERMKELKESK--------
SYV_STAS1       NKAPEKVINEEREKKQTYQEKYDGVKLRINQLKA----------
SYV_STAAR       SKAPEKVINEEKRKKQDYQEKYDGVKARIEQLKA----------
SYV_STAAC       SKAPEKVINEEKRKKQDYQEKYDGVKARIEQLKA----------
SYV_STAAN       SKAPEKVINEEKRKKQDYQEKYDGVKARIEQLKA----------
SYV_STAAS       SKAPEKVINEEKRKKQDYQEKYDGVKARIEQLKA----------
SYV_STAAW       SKAPEKVINEEKRKKQDYQEKYDGVKARIEQLKA----------
SYV_STAAM       SKAPEKVINEEKRKKQDYQEKYDGVKARIEQLKA----------
SYV_STAEQ       NKAPEKIINEEKEKQQHYQEKYNGVKSRIEQLKA----------
SYV_STAES       NKAPEKIINEEKEKQQHYQEKYNGVKSRIEQLKA----------
SYV_STAHJ       NKAPEKVINEEKEKQQRYQEKYDGVKNRIEQLKA----------
SYV_LACPL       ANAPEDVVNSEKEKLADNQTKLAALKQRLVDIKAEA--------
SYV_LACSS       DRAPEKVVQEERDKQADYEQQYQSVEKRLAELKAAR--------
SYV_ENTFA       SNAPDEVVEAERAKEKDYLEKQEAVKERIAQLRSI---------
SYV_LACLA       ANAKAEVVQKEKDKLADYQEKFDTVKARIAELKEN---------
SYV_STRMU       QNAKPEIVQKERDKQIDYQTKYDATVERIKEMEKLIK-------
SYV_STRA5       ANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKLVR-------
SYV_STRA1       ANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKINND------
SYV_STRA3       ANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKLNND------
SYV_STRT1       ANAKPEVVQKERDKQKDYQAKYDAIVVRIDEMKKLVK-------
SYV_STRT2       ANAKPEVVQKERDKQKDYQAKYDAIVVRIDEMKKLVK-------
SYV_STRP1       ANAKPEVVQKEKDKQADYQAKYDATQERIAEMKKIKS-------
SYV_STRPM       ANAKPEVIQKEKDKQADYQAKYDATQERIAEMKKIKS-------
SYV_STRP6       ANAKPEVVQKEKDKQADYQAKYDATQERIVEMHKLVK-------
SYV_STRP3       ANAKPEVVQKEKDKQADYQAKYDATQERIAEMQKLVK-------
SYV_STRP8       ANAKPEVVQKEKDKQADYQAKYDATQERIAEMHKLVK-------
SYV_STRPN       ANAKPEVVQKECDKQADYQAKYDATVARIDEMKKLVK-------
SYV_STRR6       ANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLVK-------
SYV_LISIN       SKAPENVVAEERLKEKDYLEKKASVLERIETLKEV---------
SYV_LISMF       SKAPESVVAEERLKEKDYLDKKASVLERIETLKEV---------
SYV_LISMO       SKAPESVVAEERLKEKDYLDKKASVLERIETLKEV---------
SYV_OCEIH       SKAPESVVEEEKRKEKDYLDKQAKVKTRLSELK-----------
SYV_BACC1       AKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK----------
SYV_BACCZ       AKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK----------
SYV_BACCR       AKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK----------
SYV_BACAN       AKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK----------
SYV_BACHK       AKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK----------
SYV_BACSK       AKAPSHVVEEEKAKQQDYAAKRQTVIERIAELKA----------
SYV_BACHD       AKAPEKVIEEERKKEADYLEKRAAVRARIKELKG----------
SYV_GEOSE       AKAPAHVVEEERRKRQDYIEKREAVKARLAELKR----------
SYV_GEOKA       AKAPAHVVEEERRKRQDYIEKREAVKARLAELKR----------
SYV_BACLD       KKAPAHVIEEERAKEADYTAKREAVEKRIAELKN----------
SYV_BACSU       KKAPAHVIDEEREKEKDYVAKRDAVQKRMAELKG----------
SYV_THEMA       EKAPEEVVEETKEKLNTNRERLARLESILRDLE-----------
SYV_CARHZ       AKAPAEVVNKEREKLTAFYREKEVLEQRIGMLSHEL--------
SYV_CALS4       KKAPEKVVNAEREKLEKYTAMLKNIEERLSLLNS----------
SYV_CLOPE       SKAPEAVVNEERAKGVKYKEMLEAVLERIEALQ-----------
SYV_CLOAB       DKAPESVVEAERVKGEKYKKMLEAVEERIAALK-----------
SYV_CLOTE       KKAPEAVVNEEKAKGEKYKEMLEAVLERIKSLK-----------