CLUSTAL format seed alignment for MF_02006

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYY_AYWBP       ---------------------MSFYEELKWRNLIKDCNNEIQVKE--LLDN-NQVKFYCG
SYY_ONYPE       ---------------------MSFYEELKWRNLIKDCSNETQVKE--LLDN-NQVKFYCG
SYY_AGRFC       ---------------MSRF-KSDFLRTLDERGFIHQISDEAGLDE--LF-AKETVTAYIG
SYY_RHIME       ---------------MSEF-KSDFLHTLSERGFIHQTSDDAGLDQ--LF-RTETVTAYIG
SYY_BRUA2       ---------------MSGF-KSDFLRTLSERGFIHQISDESGLDE--LL-AKETVTAYIG
SYY_BRUAB       ---------------MSGF-KSDFLRTLSERGFIHQISDESGLDE--LL-AKETVTAYIG
SYY_BRUME       ---------------MSGF-KSDFLRTLSERGFIHQISDESGLDE--LL-AKETVTAYIG
SYY_BRUSU       ---------------MSGF-KSDFLRTLSERGFIHQISDESGLDE--LL-AKETVTAYIG
SYY_RHILO       ---------------MPAF-KSDFLRTMSERGFIHQISDETGLDQ--LF-AKETVTAYVG
SYY_BARHE       ---------------MLAF-KSDFLNIMSERGFIHQISDEKGLDA--LF-SKEVVSAYIG
SYY_BARQU       ---------------MLAF-KSDFLHIMSERGFIHQISDEKGLDA--LF-SKEVVSAYIG
SYY_NITWN       ---------------MVAF-KSDFLNTLQERGFIHQCSDFEGLDA--LA-SRNQVTAYTG
SYY_RHOPA       ---------------MTAF-KSDFMNVLQSRGFIHQISDPDSLDA--LA-AKGEVVAYVG
SYY_BRADU       ---------------MTAF-KSDFLNILQERGFIHQCSDFEGLDA--LA-AKGEATAYVG
SYY_MAGSA       ---------------MTSL-KSDFLRIVTERGYMHQCTDLEALDK--RL-TEGCQAAYIG
SYY_RHORT       ---------------MTAP-KSEFLAVVRDRGFIHQCTDLDGLDA--LL-AKGPVSAYIG
SYY_CAUVC       ------------MSAASSF-KSEFLRTLEARGYIHQITHADELDT--AA-QGGPIVAYIG
SYY_NOVAD       ---------------MTEY-ASSLLRLLSERGYIHQMTDADALDA--LA-AKQVIPGYIG
SYY_ZYMMO       ---------------MTQF-RSDFLRLLETRGYIHQITDAKSLDE--KA-SQSVIAAYIG
SYY_RHOS4       ---------------MTYHPKSDFLRVMQERGYLADCTDMQALDE--AL-SKGVVPAYIG
SYY_RUEPO       ---------------MTYHPKSDFIAVMMERGFLADCTDYQGLDE--AL-MKGCQPGYIG
SYY_GLUOX       ------------------MPKSPFLLEAQARGLIFQCTDLDALDE--AM-LAGPITAYVG
SYY1_PSEAE      --------------MSVPTHQQDLIALLEERGFVHQCTDRDGLAA--HL-AAGPATAYLG
SYY_EHRRG       -----------------MKLKSGFLGLLYSRGYFNQCTDLAELDQ--LM-SKECVIAYIG
SYY_EHRRW       -----------------MKLKSDFLGLLYSRGYFNQCTDLAELDQ--LM-SKECVIAYIG
SYY_EHRCJ       -----------------MKLESQFLSFLYSRGYFNQCTNVSALDQ--LM-SKQCVPTYIG
SYY_ANAMM       -----------------MEFKSGFLNTLQVRGYLHQCTDDVALDE--LM-ALQPITAYIG
SYY_WOLPM       -----------------MKHASEFLNFIQERGYLYQCTNIEGLDQ--LLLQSNYIVAYIG
SYY_WOLTR       -----------------MKHKSEFLNFIQERGYLCQCTNIEGLDQ--LLLQNNYVVAYIG
SYY_RICCN       ---------------------MRFIEEFINKGYFHQCTDLDRLTA--IT-KETKIAAYIG
SYY_RICFE       ---------------------MSFIEEFINKGYFHQCTDLDRLTT--IT-KETKIAAYIG
SYY_RICPR       ---------------------MTFIEEFIYKGYLNQCTDLARLSA--IT-QEAKIAAYIG
SYY_RICTY       ---------------------MTFIEEFIYKGYLHQCTDLDQLTA--IT-QEVKIAAYIG
SYY_PELUB       --------------------MNKFLKEFKDRGFFYQCTGEENLSQ--LL-DKEKIRAYIG
SYY_BORBU       --------------------MNLALSLLHKRGFLKQCTSLKVLSD--LMDR-EKIVFYAG
SYY_BORBP       --------------------MNLALNLLYKRGFLKQCTSLKVLSD--LMDR-EKIVFYAG
SYY_TREDE       --------------------MNKALKILQERGFIQQCTDLQALSD--RMDK-GQIAFYTG
SYY_TREPA       --------------------MNPALARLQARGFIRQCTDLSALSA--RMDA-GPLTFYVG
SYY1_CLOAB      --------------------MSNVLDELIERGYAKQFTHEEETRK--LLSE-EKVTFYIG
SYY_CLOPE       --------------------MANVLDTLMERGYIKQFTHEAETRE--LLEK-EKVTFYIG
SYY_FUSNN       ----------------MEGKMANVYDVLKERGYLKQLTHEEEIRE--ILGK-EKVTFYIG
SYY_CLOTE       -------------------MGNNVFDVLKERGYIKQTTHEEEIRD--LINK-DKITFYIG
SYY_CALS4       ---------------------MSVLEVLKERGYIAQMTHEEEIEK--LLEK-EKITFYIG
SYY_SYNAS       ------------------MILKNVYDVFMERGFIEQVTDENAVRK--ALE--APLACYIG
SYY_MYCGE       -------------------MLNNILQFLKERE-LYSQANFETELD--NHLKEKKNNFYVG
SYY_MYCPN       -------------------MTKDLLALLKERG-LFVQANFEKELK--QLLNQGSFAFYVG
SYY_MYCPE       ------------------MKNKNILEFLKKRGYIYQGSNFDLIEK--ELIKGTS--FYIG
SYY_CHLAB       --------------------MRDFIQHLQDRGILENFSSG-------LDNVSTPVSAYLG
SYY_CHLCV       --------------------MRDFIKHLKDRGILEDFSHG-------LDSVESPISAYLG
SYY_CHLPN       --------------------MQSWLQSLQERNILENFTAG-------LESVEGPIAAYLG
SYY_CHLTA       --------------------MQQLIDNLKKRGILDNSSAG-------LESLTVPVSAYLG
SYY_CHLTR       --------------------MQQLIDNLKKRGILDNSSAG-------LESLTVPVSAYLG
SYY_CHLMU       --------------------MQQLIDSLQKRGILDNSSAG-------LESLTAPVSAYLG
SYY_PARUW       --------------------MTNVMDVLRERGFIDAVTSEE---I--RQLTNQPIKVYCG
SYY_TROW8       --------------MPNAPEVNSVWDELLWRGLVCVSTDQGALKE--LLDG-PPIRFYCG
SYY_TROWT       --------------MPNAPEVNSVWDELLWRGLVCVSTDQGALKE--LLDG-PPIRFYCG
SYY_LEIXX       MSDSPSRQQQLLRAQSNDPSFDNVWDELIWRGLVYVSTDEAALKQ--LLAG-EPIAYYCG
SYY_BIFLO       ---------MAHVTDFKEAGFNTLLEELEWRGLISQSTDRDRLAE--ALNG-EPITYYCG
SYY_CORDI       ---------------------MNIIDELQWRGLINQSTDIDALRE--ACEK--PITLYCG
SYY_CORJK       -----------------MSDNMNIIDELQWRGLINQSTDLEALKE--ATQN--PITLYCG
SYY_COREF       -------------------MTTNIIDELSWRGLINQSTDLDALRE--ATQE--PITLYCG
SYY_CORGL       ---------------------MNIIDELSWRGLINQSTDLEALRE--EAST--PITLYCG
SYY_MYCBO       -------------------MSGMILDELSWRGLIAQSTDLDTLAA--EAQR-GPMTVYAG
SYY_MYCTU       -------------------MSGMILDELSWRGLIAQSTDLDTLAA--EAQR-GPMTVYAG
SYY_MYCPA       -------------------MSSGILDELGWRGLIAQSTDLDALAA--EAR---PMTVYAG
SYY_MYCLE       -------------------MSSSILNELGWRGLVAQSTDLDALAD--ELRR-GPMTVYAG
SYY_MYCFO       -------------------MSMGILDELDWRGLIAQSTDRETLAN--DLAN-GPMTVYSG
SYY_NOCFA       -------------------MSGDIIDELTWRGLIAQSTDLDALRA--ALAA-GPLTLYAG
SYY_STRAW       --------------------MTDIVDELKWRGLVALSTDEDALRK--AFAD-GPVTFYCG
SYY_STRCO       --------------------MTDIVDELKWRGLFAQSTDEDALRK--ALAD-GPVTFYCG
SYY_THEFY       --------------------MTDIIDDLQWRGLIAQTTDLDDLRK--ALAD-GPVTLYCG
SYY_CUTAK       --------------------MSDLLDDLEWRGLVADSTDREALEA--HLAQ-GPVTFYVG
SYY_BACFN       ---------------------MNFVEELRWRGMVHDMMP--GTEE--LLAK-EQVTAYVG
SYY_BACFR       ---------------------MNFVEELRWRGMVHDMMP--GTEE--LLAK-EQVTAYVG
SYY_BACTN       ---------------------MNFVEELRWRGMLQDIMP--GTEE--LLNK-EQVTAYLG
SYY_PORGI       ---------------------MNFVEELRWRGMIHDIMP--GTEE--HLNK-GMTSAYVG
SYY_ANADE       --------------------MQNLLEALVPRSLVHDQTP--GLQA--RLAQ-GPITGYVG
SYY_RHOBA       --------MPKRIRMTTSNATNSLIEDLRWRGLLNQTTDENGIAE--LLNS-GPQTIYIG
SYY1_BACAN      ---------------------MGILQDLEFRGLINQQTDAEGLEQ---LLEKESVKLYCG
SYY1_BACHK      ---------------------MGILQDLEFRGLINQQTDAEGLEQ---LLEKESVKLYCG
SYY1_BACCZ      ---------------------MGILQDLEFRGLINQQTDAEGLEQ---LLEKESVKLYCG
SYY1_BACC1      ---------------------MGILQDLEFRGLINQQTDAEGLEQ---LLEKESVKLYCG
SYY1_BACCR      ---------------------MGILQDLEFRGLINQQTDDEGFEQ---LLEKESVKLYCG
SYY1_BACLD      --------------------MTHILDDLSFRGLIQQQTDEAGLRE---LLDKEKISLYSG
SYY1_BACSU      --------------------MTNLLEDLSFRGLIQQMTDEEGLNK---QLNEEKIRLYSG
SYY_BACCA       ---------------------MDLLAELQWRGLVNQTTDEDGLRK---LLNEERVTLYCG
SYY_GEOKA       ---------------------MDLLAELQWRGLVNQTTDEDGLRK---LLNEERVTLYCG
SYY_GEOSE       ---------------------MDLLAELQWRGLVNQTTDEDGLRK---LLNEERVTLYCG
SYY2_ENTFA      -------------------MNSAFFEELKARGLVYQVTDEEALQK---QLNEESVKLYIG
SYY_OCEIH       ---------------------MDILQDLESRGLIHQTTDRERLEK---HLQNNQVTLYCG
SYY2_BACAN      ---------------------MNIIDELEWRGAVNQQTDEEGLRK---LVEEKKISLYCG
SYY2_BACHK      ---------------------MNIIDELEWRGAVNQQTDEEGLRK---LVEEKKISLYCG
SYY2_BACCZ      ---------------------MNIIDELEWRGAVNQQTDEEGLRK---LVEEKKISLYCG
SYY2_BACC1      ---------------------MNIIDELEWRGAINQQTDEEGLRK---LVEEKKISLYCG
SYY2_BACCR      ---------------------MNIIDELEWRGAVNQQTDEEGLRK---LVEEKKISLYCG
SYY_LISMF       ---------------------MNIIDELEWRGAIYQQTDEEGLRK---WVEEKQISLYCG
SYY_LISMO       ---------------------MNIIDELEWRGAIYQQTDEEGLRK---WVEEKQISLYCG
SYY_LISIN       ---------------------MNIIDELEWRGAIYQQTDEEGLRK---WVEEKQISLYCG
SYY_LACBR       ---------------------MNIIDELTWRGAINQQTDAEGLKK---LTSEKKISLYCG
SYY_LACSS       -------------------MQKNIIDELTWRDAINQQTDADGLRE---LTEKKSISLYCG
SYY1_ENTFA      ---------------------MNIIDELAWRDAINQQTNEEGLRE---LTENTSISLYCG
SYY_LACPL       ---------------------MNIIDDLKWRGAINQQTDEAGLKE---LTENQSVSLYCG
SYY_LACAC       ------------------MAKFDILEDLKWRGAINQETDEEGLRK--YLAEHDDLALYCG
SYY_LACJO       ------------------MAKFDILEDLKWRGAINQETDEEGLRK--YLAEHDDLALYCG
SYY_STAA3       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAW       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAR       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAS       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAM       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAN       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAB       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAAC       -------------------MTNVLIEDLKWRGLIYQQTDEQGIED---LLNKEQVTLYCG
SYY_STAEQ       -------------------MANALIEDLKWRGLIYQQTDEEGIEE---LLNKEQVTLYCG
SYY_STAES       -------------------MANALIEDLKWRGLIYQQTDEEGIEE---LLNKEQVTLYCG
SYY_STAHJ       -------------------MSNALIEELQWRGLIYQQTDESSIEE---LLNKEQISLYCG
SYY_STAS1       -------------------MTNALLEDLKWRGLIYQQTDESGIEN---ILNKEQVTLYCG
SYY_STRA3       ---------------------MNIFDELKERGLVFQTTDEDALRK---ALEEGSVSYYTG
SYY_STRA5       ---------------------MNIFDELKERGLVFQTTDEDALRK---ALEEGSVSYYTG
SYY_STRA1       ---------------------MNIFDELKERGLVFQTTDEDALRK---ALEEGFVSYYTG
SYY_STRPN       ---------------------MHIFDELKERGLIFQTTDEEALRK---ALEEGQVSYYTG
SYY_STRR6       ---------------------MHIFDELKERGLIFQTTDEEALRK---ALEEGQVSYYTG
SYY_STRP3       ---------------------MNIFEELKARGLVFQTTDEQALVK---ALTEGQVSYYTG
SYY_STRP8       ---------------------MNIFEELKARGLVFQTTDEQALVK---ALTEGQVSYYTG
SYY_STRP6       ---------------------MNIFEELKARGLVFQTTDEQALVK---ALTEGQVSYYTG
SYY_STRPM       ---------------------MNIFEELKARGLVFQTTDEQALVK---ALTEGQVSYYTG
SYY_STRP1       ---------------------MNIFEELKARGLVFQTTDEQALVK---ALTEGQVSYYTG
SYY1_STRT1      ---------------------MTIFEELKARGLIFQTTDEEALVK---AFEEGPVSFYTG
SYY1_STRT2      ---------------------MTIFEELKARGLIFQTTDEEALVK---AFEEGPVSFYTG
SYY_STRMU       ---------------------MTIFEELKARGLVFQTTDEEALKK---SLDDGQVSFYTG
SYY_LACLA       ---------------------MNIFDELKARGLVFQTTDEAALSK---ALTEDMVSYYVG
SYY_BLOPB       ----------------MNNKNIDIIQLLYERDLIAQITNQEALIK---ILKSKSITLYCG
SYY_BLOFL       ----------------MID---NIIDYLYERGSIAQITDRKKLNA---VLNSQPITLYCG
SYY_BUCAI       ------------------MSEFNFISRLHNRGLISHITNEDNLSK---LIENKSISLYCG
SYY_BUCAP       ---------------------MDLINELHQRNLIFHITNENKLKE---LIKNKYISLYCG
SYY_BUCBP       ------------------MLTDTLIQEFQDRNLISQITNEIDLKN---ILLHNKISLYCG
SYY_WIGBR       --------------------MKDLIQELKNRKLISKLTDEINIKK---ILKEKKINLYCG
SYY_CHRVO       ------------------MTQTALLQDLEARGLIAQTTDMAALQE---LLNKESVTLYCG
SYY_DECAR       ------------------MYQSPLIQDLHDRGLIAQITDAAALDK---LLTEESVTLYCG
SYY_NEIMA       ---------------------MSVIQDLQSRGLIAQTTDIEALDA---LLNEQKIALYCG
SYY_NEIMB       ---------------------MSVIQDLQSRGLIAQTTDIEALDA---LLNEQKIALYCG
SYY_NEIG1       ---------------------MSVIQDLQSRGLIAQTTDIEALDA---LLNEQKIALYCG
SYY_ECOLI       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_SHISS       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_ECO57       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_SHIDS       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_ECOL6       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_SHIBS       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_SHIFL       ------------------MASSNLIKQLQERGLVAQVTDEEALAE---RLAQGPIALYCG
SYY_SALCH       ------------------MASSNLIKQLQERGLVAQVTDEDALAE---RLAQGPIALYCG
SYY_SALPA       ------------------MASSNLIKQLQERGLVAQVTDEDALAE---RLAQGPIALYCG
SYY_SALTI       ------------------MASSNLIKQLQERGLVAQVTDEDALAE---RLAQGPIALYCG
SYY_SALTY       ------------------MASSNLIKQLQERGLVAQVTDEDALAE---RLAQGPIALYCG
SYY_PECAS       ------------------MASSNLIKQLQERGLIAQVTDEEALAE---RLAQGPIALYCG
SYY1_PHOLL      ------------------MSSNNLIKQLQERGLIAQVTDENALAE---RLAQGPVSLYCG
SYY_YERPE       ------------------MTSSNLIKQLQERGLVAQVTDEDALAE---RLAQGPISLYCG
SYY_YERPS       ------------------MTSSNLIKQLQERGLVAQVTDEDALAE---RLAQGPISLYCG
SYY_SODGM       ------------------MASSNLIQQLQERGLIAQVTDEKALAE---RLAAGPIALYCG
SYY_VIBF1       -----------------MTATNELLQDLKARGLIAQCTADEELAE---HLSTDCRTLYCG
SYY1_PSEHT      -------------------MTTQLLEDITHRGLVSQVSDLAQLEQ---LLAT-SQVVYCG
SYY1_VIBPA      -------------------MTTPLLQDLQDRGLIAQASDLEEIQT---LLSQ-PQTVYCG
SYY1_VIBVU      ------------------MNSQLLFDDLAQRGLIAQTTDLEQLIA---LFRQ-PQTLYCG
SYY1_VIBVY      ------------------MNSQLLFDDLAQRGLIAQTTDLEQLIA---LFRQ-PQTLYCG
SYY1_VIBCH      ------------------MNSQQLFDDLQQRGLIAQSTPLEALVE---RFAT-PQVLYCG
SYY_MYCCT       -------------------MKNNILEELKWRGLIKQVTNEQKILDAQ----NSNDAVYCG
SYY_MYCMS       -------------------MKNSILEELKWRGLIKQITNESKILDAQ----NNNDAVYCG
SYY_MESFL       ---------------------MNIIKELEWRGLVKQITNEERLLKAQ----NDGAAVYCG
SYY_MYCGA       ---------------------MDFISELKKRNIIKQISNEEKLALAL----KNQKGVYVG
SYY_UREPA       --------------------MHSLIKDLKARNLINNITNEEKLIKAL----EKNKGIYVG
SYY_MYCMO       --------------------MNSFLKELQEKNLIQDISNIEKIENSL----KNKMGIYVG
SYY_MYCH2       ---------------MSYIEKQEFLTELKTRNILKDISSPEKFFNLK----PDQ-GIYIG
SYY_MYCHJ       ---------------MSYIEKQEFLTELKTRNILKDISSPEKFFNLK----PDQ-GIYIG
SYY_MYCH7       ---------------MSYIEKQEFLAELKTRNILKDISSPEKFFNLK----PDQ-GIYIG
SYY_MYCS5       --------------------MHKVLTELRDREILKDISNEEKFLSLP----KNS-GVYVG
SYY_MYCPU       ---------------MSQNKLKTLIEELKKRKVFNNITSEEKVDLIT----LDH-GIYVG
                                              :                          * *

SYY_AYWBP       FDPTSHSLTVGHLIQITMILLMQRQGHLPVILVGGATGLIGDPK-ETEERKLLSLENSLQ
SYY_ONYPE       FDPTSHSLTVGHLVQITMILLMQRQGHLPVILVGGATGLIGDPK-ETEERKLLSLENSLQ
SYY_AGRFC       YDPTASSLHVGHLTQIMMLHWMQKTGHQPISLMGGGTGMVGDPSFKEEARKLMTIDMIED
SYY_RHIME       FDPTAASLHAGGLIQIMMLHWLQATGHRPISLMGGGTGMVGDPSFKDEARQLMTPETIAA
SYY_BRUA2       FDPTAPSLHAGGLIQIMMLYWLQQTGHKPVALMGGGTGMVGDPSFKDEARKLMTEDTIAE
SYY_BRUAB       FDPTAPSLHAGGLIQIMMLYWLQQTGHKPVALMGGGTGMVGDPSFKDEARKLMTEDTIAE
SYY_BRUME       FDPTAPSLHAGGLIQIMMLYWLQQTGHKPVALMGGGTGMVGDPSFKDEARKLMTEDTIAE
SYY_BRUSU       FDPTAPSLHAGGLIQIMMLYWLQQTGHKPVALMGGGTGMVGDPSFKDEARKLMTEDTIAE
SYY_RHILO       YDATATSLHIGNLISATMLYWLQETGHRPIALMGGGTSMIGDPSFRDDQRSLLTPEAIAT
SYY_BARHE       FDPTASSLHAGSLLQIMMLYWLQKTGHRPIVLMGGGTGLIGDPSFKDEARRLLTQDDIAA
SYY_BARQU       FDPTASSLHAGSLLQIMMLHWLQKTGHRPIALMGGGTGLIGDPSFKDEARPLLTQDDIAT
SYY_NITWN       YDCTAPSLHVGHLLSIMMMHWLQQTGNKPIALMGGGTTRVGDPSGRDETRKILSYDQIDA
SYY_RHOPA       YDCTAASLHVGHLLSIMMLHWLQATGNKPIALMGGGTTRVGDPSGRDETRKILTYEQIDA
SYY_BRADU       YDCTARSLHIGNYLTMMMLHWLQQSGNKPITLMGGGTTMVGDPSGKDETRAMRTVAEIEA
SYY_MAGSA       FDCTATSLHVGGLMQIMLLRWWQKTGHKPIVLMGGGTTRIGDPTGKDESRKMLTDEVIAT
SYY_RHORT       FDCTADSLHVGSLIQIMLLHWLQRTGHRPVVLMGGGTTRIGDPSFRDEARPLLTDEKIGQ
SYY_CAUVC       FDATAPSLHVGSLIQIMLLRRLQQAGHKPIVLMGGGTTKVGDPTGKDESRKLLSDADIQA
SYY_NOVAD       FDPTAPSLHVGSMVQIMLLRRLQQAGHKPIVLMGGGTGKIGDPSFKDEARKLMTNDVIAA
SYY_ZYMMO       FDPTAASLHVGSLLQIMMLRRLQQAGHKPIVLMGGGTGKIGDPSFKDEARKLLDEDTIKA
SYY_RHOS4       YDATAASLHVGHLLNIMMLRWLQKTGHKPITLMGGGTTKVGDPSFRSEERPLLTPDRIDE
SYY_RUEPO       FDATAKSLHVGSLIQIMMLRWLQKTGHKPITLMGGGTTKVGDPSFRADERPLLTPAQIDD
SYY_GLUOX       FDPTADSLHVGNALTIMALRLLQKHGHRPIALMGGGTAKIGDPSFRDEARSLITNETIAH
SYY1_PSEAE      FDATADSLHVGHLQGLMLMRWLQKAGHRPLLLIGGATTRIGDPSFRDSSRPILTEAQIQA
SYY_EHRRG       FDCTARSLHIGSLMQIMILRYLQKCGHKPIVLLGNGTTKIGDPSGKDKSRTLLSSSDIQE
SYY_EHRRW       FDCTARSLHIGSLMQIMILRYLQKCGHKPIVLLGNGTTKIGDPSGKDKSRTLLSSSDIQE
SYY_EHRCJ       FDCTAKSLHVGSLVQIMILRYLQKFGHKPIVLLGNGTTKIGDPSGKDKSRTMLCSDEIEE
SYY_ANAMM       FDCTARSLHIGSLMQIMVMRYLQKFGHKIVVLLGGGTTKIGDPSGKDKARAMLSEAEIAA
SYY_WOLPM       FDCTAPSLHAGHLIQIMMLCHLQKFGYKPIVLLGGGTTKIGDPSFKDKARSILPVENINQ
SYY_WOLTR       FDCTASSLHVGSLIQIMMLRHLQKFGYKPIVLLGGSTTKIGDPSGKDKARSVLPIEDINQ
SYY_RICCN       FDCTATSLHIGSLMQIMILRLLQQHGHKPIVIIGGGTSKIGDPTWKDEVRKILSKEDIAK
SYY_RICFE       FDCTATSLHIGSLMQIMILRLLQQHGHKPIVIIGGGTSKIGDPTWKDEARKILSKEDIAK
SYY_RICPR       FDCTATSLHIGSLMQIMILRLLQKHGHTPIVIIGGGTSKIGDPAGKDVTRKALTQEDIKR
SYY_RICTY       FDCTATSLHIGSLMQIMILRLLQKHGHTPIVIIGGGTSKIGDPSGKEVTRKALTQEDIKR
SYY_PELUB       FDCTAESLHVGSLLQIMCLRLLQKHGHQPIVLLGGGTTRIGDPSGKDKTRTILSEDEIEK
SYY_BORBU       VDATSSSLHIGHLIPFLAMMHLRQHGHMPIVLIGDSTAKIGDPSGKSEMRKILSSEEIGN
SYY_BORBP       VDTTSSSLHIGHLIPFLAMMHLRQHGHMPIVLIGDSTTKIGDPSGKSEMRKILSSEVINN
SYY_TREDE       TDPTGPSLHIGHMVPIFALKHLCREGHKGVVLVGGGTSRIGDPSGKTEMRKMLSYDELDK
SYY_TREPA       VDPTGSSLHVGHMLPMFALKHLCDAGHRGCVLIGGGTARIGDPSGKTSMRKMLDYATLDA
SYY1_CLOAB      FDPTGDSLHVGHFIALMLMARMQKAGHRPIVLIGGGTAMVGDPTGKTDMRKMLTREEINH
SYY_CLOPE       FDPTADSLHVGHFIAMMFMAHMQKAGHRPIALIGGGTATIGDPSGKTDMRKMMTNETIAH
SYY_FUSNN       FDPTADSLHVGHFIAMMFMAHMQQHGHRPIALAGGGTGMIGDPSGRSDMRTMMTVEMIDH
SYY_CLOTE       FDPTADSLHIGHFLPLMMMAHMQKAGHRPIALVGGGTVRIGDPSGKSEMRKMLSKEAIDK
SYY_CALS4       FDPTADSLHVGHLIQIMTMAHMQRAGHRPIVLLGGGTALIGDPSGRTDMRKMLTKEEIDR
SYY_SYNAS       FDPTARSLHIGSLVPIMALIHLQRHGHTSIALVGGGTALIGDPSGKTEMRQILTREKIEL
SYY_MYCGE       FDPTANSLHIGNYVLIHIAKLLKDMGHTPHIVLGSATALIGDPTGRIELRKILEEKEIVK
SYY_MYCPN       FDPTAPSLHIGNYVLLHVAQIFQAMGHIPHVLLGSGTALIGDPTGRMELRQMMSRETIAE
SYY_MYCPE       FDPTADSLHVGHFLTMMAVKHLQKAGNNPVIVVGGGTGSVGDPSGRSEIRKILDRKTIDY
SYY_CHLAB       FDPTAPSLHIGHWIGICFLRRMAHFGLTPVALVGSATGMIGDPSGKSIERTLLEESQVAY
SYY_CHLCV       FDPTAASLHIGHWIGICFLRRMASFGITPVALVGSATGMIGDPSGKSIERTLLESNEVAH
SYY_CHLPN       FDPTAPALHIGHWIGICFLKRLAALGITPIALVGGATGMVGDPSGKQSERSLLQTSEVFD
SYY_CHLTA       FDPTAPSLHIGHWIGICFLRRLAAYGITPVALVGGATGMIGDPSGKSVERSLLDQAQVLD
SYY_CHLTR       FDPTAPSLHIGHWIGICFLRRLAAYGITPVALVGGATGMIGDPSGKSVERSLLDQAQVLD
SYY_CHLMU       FDPTAPSLHIGHWIGICFLRRLSAYGITPIALVGGATGMIGDPSGKSVERSLLDQEQVLD
SYY_PARUW       FDPTADSLHLGNLVAIMGLAWFQRFGHTPVAIVGGATGMIGDPSGKNAERQLLDEKKIQL
SYY_TROW8       FDPTAPSLHVGNLAQILIMRRLQLAGHRPIALVGGSTGLIGDPR-PGGERQLHSHEQVQE
SYY_TROWT       FDPTAPSLHVGNLAQILIMRRLQLAGHRPIALVGGSTGLIGDPR-PGGERQLHSHEQVQE
SYY_LEIXX       FDPTAPSLHLGNLVQLLTMRRLQLAGHRPFGLVGGSTGLIGDPK-PSAERTLNAKETVAE
SYY_BIFLO       FDPTAASLHIGNLVQLINMRHLQLAGHHPIALVGGATGLIGDPR-QSGERTLNPKDVVAG
SYY_CORDI       FDPTGDSLHAGHLVPMIMLRRFQEAGHRPITLAGGATGFIGDPR-DVGERSMLSQDTIEH
SYY_CORJK       FDPTGSSLHAGHLVPLIMLKRFQQFGHRPITLAGGATGMIGDPR-DVGERSMLTEEQIGE
SYY_COREF       FDPTGPSLHAGHLVPLLMLRRFQQAGHNPIVLAGGATGMIGDPR-DVGERTMNSADTVAE
SYY_CORGL       FDPTGPSLHAGHLVPLLMLRRFQQAGHNPIVLAGGATGMIGDPR-DVGERTMNSADTVSD
SYY_MYCBO       FDPTAPSLHAGHLVPLLTLRRFQRAGHRPIVLAGGATGMIGDPR-DVGERSLNEADTVAE
SYY_MYCTU       FDPTAPSLHAGHLVPLLTLRRFQRAGHRPIVLAGGATGMIGDPR-DVGERSLNEADTVAE
SYY_MYCPA       FDPTAPSLHAGHLVPLLALRRFQRAGHRPIVLAGGATGMIGDPR-DVGERTLNEADTVAE
SYY_MYCLE       FDPTAPSLHVGHLVPLLVLRRFQRAGHRPIVLAGGATGMIGDPR-DIGERTLNEAYTVAE
SYY_MYCFO       FDPTAPSLHAGHLVPLLTLRRFQRAGHRPIVLAGGATGMIGDPR-DTGERTLNTADTVAD
SYY_NOCFA       FDPTAASLHAGHLVPLLALKRFQRAGHRPIVLAGGATGLIGDPR-DVGERTMNSSDTVAE
SYY_STRAW       FDPTAPSLHLGNLVQILTMRRIQQAGNRPLGLVGGATGLIGDPK-PNSERTLNSREVVAE
SYY_STRCO       FDPTAPSLHVGHLVQVLTVRRLQQAGHRPLALVGGATGQIGDPR-PTAERTLNSPETVAG
SYY_THEFY       FDPTAGSLHVGHLTQALTLARFQRAGHRPIALVGGATGMIGDPK-PNAERTLNSPETIRQ
SYY_CUTAK       FDPTAKSLHIGHLVQLMLVRALQERGHKPLLLVGGATGLIGDPK-MTGERHMNDREVVAE
SYY_BACFN       IDPTADSLHIGHLCGVMILRHFQRCGHKPLALIGGATGMIGDPSGKSAERNLLDEETLRH
SYY_BACFR       IDPTADSLHIGHLCGVMILRHFQRCGHKPLALIGGATGMIGDPSGKSAERNLLDEETLRH
SYY_BACTN       IDPTADSLHIGHLCGVMILRHLQRCGHKPLALIGGATGMIGDPSGKSAERNLLNEETLRH
SYY_PORGI       IDPTADSLHIGHLVGVMMLRHFQRAGHRPIALIGGATGMIGDPSMKSAERVLLDEATLRH
SYY_ANADE       FDPTADSLHVGHLLAVMSLAWLQRCGGTPIIVVGGGTGMVGDPSGKRSERPVLSVEEIDR
SYY_RHOBA       FDPTATSLHVGGMMQLMMLRRFQRAGHNPIALVGGATGMIGDPSGKSEERNLLSADQLQK
SYY1_BACAN      FDPTADSLHIGHMLPVLMLRRFQLAGHQPIALVGGGTGMIGDPSGKKAERTLNTKDTVAY
SYY1_BACHK      FDPTADSLHIGHMLPVLMLRRFQLAGHQPIALVGGGTGMIGDPSGKKAERTLNTKDTVAY
SYY1_BACCZ      FDPTADSLHIGHMLPVLMLRRFQLAGHQPIALVGGGTGMIGDPSGKKAERTLNTKDTVAY
SYY1_BACC1      FDPTADSLHIGHMLPVLMLRRFQLAGHQPIALVGGGTGMIGDPSGKKAERTLNTKDTVAY
SYY1_BACCR      FDPTADSLHIGHMYPVLMLRRFQLAGHQPIALVGGGTGMIGDPSGKKAERTLNTKDTVAY
SYY1_BACLD      FDPTADSLHIGHLLPILMLRRFQLAGHRPIALVGGATGLIGDPSGKKAERTLNNEEIVRE
SYY1_BACSU      FDPTADSLHIGHLLPILTLRRFQLAGHHPIALVGGATGLIGDPSGKKAERTLNTADIVSE
SYY_BACCA       FDPTADSLHIGNLAAILTLRRFQQAGHRPIALVGGATGLIGDPSGKKSERTLNAKETVEA
SYY_GEOKA       FDPTADSLHIGNLAAILTLRRFQQAGHRPIALVGGATGLIGDPSGKKSERTLNAKETVEA
SYY_GEOSE       FDPTADSLHIGHLATILTMRRFQQAGHRPIALVGGATGLIGDPSGKKSERTLNAKETVEA
SYY2_ENTFA      FDPTADSLHIGHLLPILMLRRFQQNGHVPIALVGGGTGMIGDPSFKDAERSLNTLDTVKA
SYY_OCEIH       FDPTADSLHIGHLVPLTMLKRFQQAGHKPIALVGGGTGMIGDPSGRSSERSLNAPEVVHG
SYY2_BACAN      VDPTGDSMHIGHLIPFMMMKRFQLAGHHPVILIGGATGTIGDPSGRQSERQLQTLEVVQH
SYY2_BACHK      VDPTGDSMHIGHLIPFMMMKRFQLAGHQPVILIGGATGTIGDPSGRQSERQLQTLEVVQH
SYY2_BACCZ      VDPTGDSMHIGHLIPFMMMKRFQLAGHHPVILIGGATGTIGDPSGRQSERQLQTLEVVQH
SYY2_BACC1      VDPTGDSMHIGHLIPFMMMKRFQLAGHHPVILIGGATGTIGDPSGRQSERQLQTLEVVQH
SYY2_BACCR      VDPTGDSMHIGHLIPFMMMKRFQLAGHHPVILIGGATGTIGDPSGRQSERQLQTLEVVQH
SYY_LISMF       IDPSGDSMHIGHLIPFMILRRFQNAGHRPIILVGGATGTIGDPSGKKEERKLQSMEQISK
SYY_LISMO       IDPSGDSMHIGHLIPFMILRRFQNAGHRPIILVGGATGTIGDPSGKKEERKLQSMEQISK
SYY_LISIN       IDPSGDSMHIGHLIPFMILRRFQNAGHRPIILVGGATGTIGDPSGKKEERKLQSMEQISK
SYY_LACBR       VDPTGDSMHIGHLIPFMMMKRFELAGHHPYILIGGATGSIGDPSGRKTERQLQTMDKVQH
SYY_LACSS       VDPTGDSMHIGHLIPFMMMKRFQLAGHHPYIVIGGGTGSIGDPSGRKSERQLQTMEMVQH
SYY1_ENTFA      VDPTGDSMHIGHLIPFMMMKRFQLAGHHPYILIGGGTGTIGDPSGRTTERVLQTMEAVQH
SYY_LACPL       IDPTGDSMHIGHLIPFMILKRFQLAGHHPYVVVGGGTGAIGDPSGKNSERKLQTMDQVKH
SYY_LACAC       TDPTGDSLHIGHLIPFMILKRFQMAGYHPVILIGGGTGAIGDPSGRTTERVLQTAEQVKH
SYY_LACJO       TDPTGDSLHIGHLIPFMILKRFQMAGYHPVILIGGGTGAIGDPSGRKTERTLQTAEQVKH
SYY_STAA3       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAW       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAR       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAS       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAM       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAN       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAB       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAAC       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDK
SYY_STAEQ       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTESQVEA
SYY_STAES       ADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTESQVEA
SYY_STAHJ       ADPTADSLHIGHLLPFMTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERILQTEDQVEA
SYY_STAS1       ADPTADSLHIGHLLPFLTLRRFQEHGHRPLVLIGGGTGMIGDPSGKSEERTLQTEAQVET
SYY_STRA3       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDVERSLQTKETVVS
SYY_STRA5       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDVERSLQTKKTVVS
SYY_STRA1       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDVERSLQTKETVVS
SYY_STRPN       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKDTVDG
SYY_STRR6       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKDTVDG
SYY_STRP3       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLE
SYY_STRP8       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLE
SYY_STRP6       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLE
SYY_STRPM       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLE
SYY_STRP1       YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLE
SYY1_STRT1      YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVEG
SYY1_STRT2      YDPTADSLHLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVEG
SYY_STRMU       YDPTADSLHLGHLVPILVMRHLQLAGHKPYALVGGATGLIGDPSFKDDERSLQTKETVKN
SYY_LACLA       YDPTADSLHLGNLVLILTMKRLQMAGHKPYALVGGATGLIGDPSFKDSERSLQTKDTVTK
SYY_BLOPB       FDPTSDSLHIGHLVPLLCLRQFQIFGHRPIILLGGGTGLIGDPSFKDSERKLNLIETVQK
SYY_BLOFL       FDPTADSLHIGHLAPLLCLKRFQKAGHRPLILLGGATGLIGDPSFKDSERKLQSFNTTQK
SYY_BUCAI       FDPTEESLHIGHLLPLIMLKRFQIAGHRPIILIGGATSLIGDPSFKEKERVFNSNYNVNI
SYY_BUCAP       FDPTEDSLHVGHLLPLITLKRFQVLGHKPIVLIGGATSLIGDPSFKTKERLLKSDSFVEK
SYY_BUCBP       FDITADSLHVGHILPLLCLRRFQNLGHRPVILMGGGTSLIGDPSFKLLERQLNSIELVHT
SYY_WIGBR       FDPTADSLHIGHLIPLLFLKRFSNFGHIPIIVIGGATALLGDFNIKKNKSFLEKYKNVKN
SYY_CHRVO       FDPTADSLHIGSLVPILMLKRFQQAGHRPVALVGGATGMIGDPSFKAAERKLNTPDVIEG
SYY_DECAR       FDPTADSLHLGHLVPVLILKRFQEAGHKPIALVGGATGMIGDPSFKATERKLNTPDVIAS
SYY_NEIMA       FDPTADSLHIGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAG
SYY_NEIMB       FDPTADSLHIGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAG
SYY_NEIG1       FDPTADSLHIGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAG
SYY_ECOLI       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SHISS       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_ECO57       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SHIDS       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_ECOL6       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SHIBS       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SHIFL       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SALCH       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SALPA       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SALTI       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_SALTY       FDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQE
SYY_PECAS       FDPTADSLHLGHLVPLLCLKRFQLSGHKPVALVGGATGLIGDPSFKATERKLNTSETVGE
SYY1_PHOLL      FDPTADSLHLGHLVPLLCLKRFQLAGHKPVALVGGATGLIGDPSFKATERKLNTEATVKE
SYY_YERPE       FDPTADSLHLGHLVPLLCLKRFQLAGHRPVALVGGATGMIGDPSFKASERKLNTEDTVNE
SYY_YERPS       FDPTADSLHLGHLVPLLCLKRFQLAGHRPVALVGGATGMIGDPSFKASERKLNTEDTVNE
SYY_SODGM       FDPTADSLHLGHLVPLLCLKRFQLAGHRPVALVGGATGLIGDPSFKATERKLNTAETVQE
SYY_VIBF1       FDPTADSLHIGSLVPLLVLKRFQQAGHKPLALVGGATGLIGDPSFKAAERQLNTNEVVGD
SYY1_PSEHT      FDPTAGSLHIGHLVPLLMLKRFNDAGHKAVALIGGATGLIGDPSFKATERSLNSKETVQG
SYY1_VIBPA      FDPTAGSLHIGHLVPLIMLKRFQDAGHQAVALIGGATGMIGDPSFKATERSLNSAEIVSG
SYY1_VIBVU      FDPTAGSLHIGHLVPLIMLKRFQDAGHQGIALIGGATGMIGDPSFKASERSLNSAETVAA
SYY1_VIBVY      FDPTAGSLHIGHLVPLIMLKRFQDAGHQGIALIGGATGMIGDPSFKASERSLNSAETVAA
SYY1_VIBCH      FDPTAGSLHIGHLVPLLMLKRFQNAGHQAIALIGGATGMIGDPSFKANERVLNSAQTVQQ
SYY_MYCCT       FDPTADSLHVGHLMMIITLKRFALQGFKPIALIGGATGMIGDPSFKASERVLQTKQQVDH
SYY_MYCMS       FDPTADSLHVGHLMMIITLKRFADYNFKPIALIGGATGMIGDPSFKANERVLQTKDQVEH
SYY_MESFL       FDPTADSLHVGHLMMIVTLKRFDKAGFQAIGLIGGGTGMIGDPSFKADERKLQTDEQVKF
SYY_MYCGA       FDPSGESLHLGNLIPIIVLRYLKKVGFKTYAILGGATGLIGDPSGKTSERKVQDYEKITA
SYY_UREPA       FDPSADSLHLGNYIMIMLLKRFRLYNIKTLALVGGATGMIGDPSGKSAERNLLDKTILEK
SYY_MYCMO       FDPSAKSIHLGNFVVINVLLIAKKHRIPTVALIGGATGGIGDPSGKKSERILIDEDTLKK
SYY_MYCH2       FDPTATSLHLGNYISISLLKRLQKIGIKVLAVIGGATGMIGDPSFSSKERKLLDFKTLNA
SYY_MYCHJ       FDPTATSLHLGNYISISLLKRLQKIGIKVLAVIGGATGMIGDPSFSSKERKLLDFKTLNA
SYY_MYCH7       FDPTATSLHLGNYISISLLKRLQKIGIKVLAVIGGATGMIGDPSFSSKERKLLDFKTLNA
SYY_MYCS5       FDPTADSLHLGNYVQIVNLIRFKKHNWNALAVLGGATGMIGDPSFRSTERVLLSTEELLK
SYY_MYCPU       FDPTAISLHLGNYIQMVNLKRFQNVGFKTIAILGGATSMIGDPSFKDSERKLLSNETILE
                 * :  ::  *                    : *..*  :**                  

SYY_AYWBP       NAKSIESQLKTILLNKQ---------VEFVNNYQWLSQIDIISFLRNYGKFFNINYMLSK
SYY_ONYPE       NAKSIECQLKNILLNKQ---------VEFVNNYQWLSQIDIISFLRNYGKLFNINYMLSK
SYY_AGRFC       NITSLKHVFANYLDYDR-AE---NPA-LMINNADWLRGLNYLEFLRDVGRHFSVNRMLSF
SYY_RHIME       NIASIKTVFSNYLRYGD-GP---KDA-LMINNADWLLGINYLEFLRDVGRHFSVNRMLSF
SYY_BRUA2       NMASIKRVFANYLTFGD-GA---NDA-LMVNNGEWLRNINYLEFLRDVGRHFSVNRMLSF
SYY_BRUAB       NMASIKRVFANYLTFGD-GA---NDA-LMVNNGEWLRNINYLEFLRDVGRHFSVNRMLSF
SYY_BRUME       NMASIKRVFANYLTFGD-GA---NDA-LMVNNGEWLRNINYLEFLRDVGRHFSVNRMLSF
SYY_BRUSU       NMASIKRVFANYLTFGD-GA---NDA-LMVNNGEWLRNINYLEFLRDVGRHFSVNRMLSF
SYY_RHILO       NIEGIKRIFGRILRFGD-GP---NDA-IMVNNADWLMKLNYVEFLRDVGRHFSVNRMLTF
SYY_BARHE       NIADIKKVFARYLTFGE-RE---TDS-CIVNNAEWLCTLNYLEFLRDIGKHFSVNRMLSF
SYY_BARQU       NIVSIKKVFANYLTFGE-KE---TDA-CIINNAEWLCKLNYLEFLRDVGKHFSINRMLSF
SYY_NITWN       NKESIKGTFLKFLVFGD-GK---NDA-IMTDNAEWLTRLNYIEMLRDVGRHFSINRMLTM
SYY_RHOPA       NKESIKGTFSKFIKFGD-GH---SDA-LMADNAEWLTKLNYIEMLREIGRHFSINRMLTM
SYY_BRADU       NKESIRGVFAKVLRYGD-GK---SDA-VMLDNAEWLTKLNWIEMLRDVGRHFSVNRMLTM
SYY_MAGSA       NMAGIKTVFTKYLTFGE-GK---TDA-LMVNNADWLDKLNYIDFLRDYGHHFTINRMLTF
SYY_RHORT       NMAGIRQVFSRFLSFGE-GA---TDA-VMVNNADWLDGLAYIPFLRDFGRHFSVNRMLTF
SYY_CAUVC       NIAGIKTVFSKFLTFGD-GP---TDA-IMVDNDVWLSKFGYVQFLREYGVHFTVNRMLAF
SYY_NOVAD       NVASIKTVFERFLTFGD-GP---TDA-VMVDNADWLDRLEYIPFLREVGQHFSVNRMLSF
SYY_ZYMMO       NIASIKRVFEHFLHFGD-GE---NDA-VMVDNAEWLDRLEYIPFLRDVGQHFSVNRMLSF
SYY_RHOS4       NIEGMRKVFARYLSYGE-GA---TDA-LMLNNAEWLDQLNYLDFLRDIGRHFSVNRMLSF
SYY_RUEPO       NIAGIRKVFAAYIDYDS-GA---ENAALMLNNEEWLDDLNYLDFLRDIGRHFSVNRMLSF
SYY_GLUOX       NIAGIEKSLRQFITFSDEDP---SSGAILANNADWLDKLSYINLLQDVGVHFSVSRMLGF
SYY1_PSEAE      NIDGIARVFSRYVELHD-------DS--LVNNAEWLDGVGYLEFLDRVGRHFSINRLLTF
SYY_EHRRG       NTLGIRKVLEKFIVCGD--G---VSDALLVYNAEWLDKLNYIDFLRNIGRHFSVNNMLTF
SYY_EHRRW       NTLGIRKVLEKFIVCGG--G---VSDALLVYNAEWLDKLNYIDFLRNIGRHFSVNNMLTF
SYY_EHRCJ       NALGIYDVLKKFIKFGS--G---STDGLLVCNAEWLDDLNYIEFLRNIGRHFSVNNMLTF
SYY_ANAMM       NKAGILATINKFLNQGD--G------VVIADNAEWLGEVRYLEFLREIGSKFSVNAMLGL
SYY_WOLPM       NTSSIRRILEKMVSFND--S---KTGAMIVNNADWLDNIKYIDFLRDIGAYFSVNRMLSF
SYY_WOLTR       NISGIKKALKKMVYFND--G---KAGAIIVNNADWLDSIKYIDFLRDIGAHFSVNRMLSF
SYY_RICCN       NAEGIKKSLSKFIKFGD--G---KSDAIMLDNAEWLDSFNYLDFLRDFGSYFSVNRMLTM
SYY_RICFE       NAEGIKKSLSKFIKFGE--G---ESDAIMLDNAEWLDSLNYLDFLRDFGSYFSVNRMLTM
SYY_RICPR       NAEGIKKSLSKFIKFGK--D---QGDAIILDNAEWLDSLNYLDFLRDFGSYFSVNRMLTM
SYY_RICTY       NTAGIKKSLSKFIKFGK--D---QGDAIILDNAEWLDSLNYLDFLRDFGRHFSVNRMLTM
SYY_PELUB       NINNIEKILKNFLDDKD--P---ETKPIFVNNYTWLKNLNYISFLRDVGKHFTINKMLSF
SYY_BORBU       NALLIKNQLQRITKFT---------SECFIHNSNWLDNLNYIEFLRDVGMHFSVNRMLSF
SYY_BORBP       NALSIKNQLQKITRFS---------SSCFIHNSNWLDNLNYIEFLRDIGIHFSVNRMLSF
SYY_TREDE       NAASIQKQIEKFLAKDI-------KNVRFVNNKDWLADLNYIDFLRDIGSHFSVNKMLSF
SYY_TREPA       YAGAIVAQLDHFLSFDH-------RHVFYVNNRDWLAHLNYIDFLREVGAHFSVNKMLTY
SYY1_CLOAB      NVECLKKQMSRFIDFSD-------DKAIIVNNAEWLMGQNYIEFLREVGVHFSVNKMLTA
SYY_CLOPE       NVACIKKQMEKFIDFSD-------DKAILVNNADWLLNQNYVEFLREVGVHFSVNRMLSA
SYY_FUSNN       NVECIKKQMQKFIDFSE-------DKAILANNADWLRNLNYIEFLRDVGEHFSVNRMLAA
SYY_CLOTE       NVSSIKSQISRFIDFSD-------DKAILVDNADWLLNLNYLEFIREIGVHFSVNKMLTA
SYY_CALS4       NAEAFKKQMERFIDFSE-------GKAIMENNAKWLLGLNYIEFLRDIGVHFTVNRMLEA
SYY_SYNAS       NATCMRRQFARYLSFED-------KKAMMINNADWLTKLNYISFLRDIGRHFSVNKMLAA
SYY_MYCGE       NTKTIKKQIKQFLG-----------DVIIHENKVWLEKLNYIEVIRELGAFFSVNKMLST
SYY_MYCPN       NTRNIKKQIRRFLGS----------NVVFCQNETWLKKLNYIEVIRELGPCFSVNKMLAT
SYY_MYCPE       NCECLKKQMSKFISFEG------KNKAVMVNNADWLLKINWIEFLREFGVCFSVNKMLAA
SYY_CHLAB       NSQKLSECLAYYL-----------PGVQIVNNIDWLKETTVIDFLRDVGKHFRLGVMLGK
SYY_CHLCV       NSKKLSECLSHYL-----------PGVQIVNNMEWFQGTTVIDFLRDVGKHFRLGTMLGK
SYY_CHLPN       NSQKITACLQRYL-----------PGVTLVNNADWLQEISLIDFLRDIGKHFRLGQMLVK
SYY_CHLTA       NSKKIAAALASYL-----------PGIRIVNNADWLGSLSMVDFLRDVGKHFRLGSMLAK
SYY_CHLTR       NSKKIAAALASYL-----------PGIRIVNNADWLGSLSMVDFLRDVGKHFRLGSMLAK
SYY_CHLMU       NSKKIEVALANYL-----------PDIRIVNNADWLGSLSMVDFLRDIGKYFRLGSMLAK
SYY_PARUW       NLKGISKNLEAILDFNH--P---TAPAIILNNLDWFKNFTFISFLRDVGKLFRLSPMLAK
SYY_TROW8       WVRALQQQLSRFLDFKGAA------AAVLVNNLDWTKSLTALDFLRELGKHFRVNAMLKK
SYY_TROWT       WVRALQQQLSRFLDFKGAA------AAVLVNNLDWTKSLTALDFLRELGKHFRVNAMLKK
SYY_LEIXX       WVGSLREQVTRFLSAEGDN------AVRLVNNLDWTAPLSAIDFLREIGKHFRVGAMLKK
SYY_BIFLO       WADRLKNQIGGILDTEGAN------AVRFVSNYDWTASMTVIDFLRDVGKNFRLGTMLAK
SYY_CORDI       NLESIKKQLRSFVRFDGDS------PAIMVNNADWTMSMSVVDFLRDVGKNFSLNTMLDR
SYY_CORJK       NMVAIKKQLEAFVDFTEDSD--VDSPAVMVNNADWISQMNVIEYLRDVGKNFSLNTMLDR
SYY_COREF       WAERISDQLSRFVDFEGEH------AARLVNNAEWTNNMSVVTFLRDVGKHFPLNTMLAR
SYY_CORGL       WAERISGQLSRFVDFDGEH------AARLVNNAEWTNEMSVVTFLRDVGKHFSLNTMLAR
SYY_MYCBO       WTERIRGQLERFVDFDD-----SPMGAIVENNLEWTGSLSAIEFLRDIGKHFSVNVMLAR
SYY_MYCTU       WTERIRGQLERFVDFDD-----SPMGAIVENNLEWTGSLSAIEFLRDIGKHFSVNVMLAR
SYY_MYCPA       WTERIRGQLERFVDFDE-----SDTGAVVVNNLDWTRQLSAIEFLRDLGKHFSVNVMLDR
SYY_MYCLE       WAERIRGQLERFVEFDDVAK--SRNGAIVVNNLEWTSPMSAIEFLRDVGKHFSINLMLDR
SYY_MYCFO       WAGRIRGQLERFVEFDD-----TPTGAIVENNLNWTGRLSAIEFLRDLGKYFSVNVMLDR
SYY_NOCFA       WARRIRSQLERFVDLDD-----SPTGAVIVNNMDWTGPLSAVDFLRDIGKHFSVNVMLAR
SYY_STRAW       WVERLRAQIAPLLDFEGPNA------AIMVNNLDWTQGLSAIEFLRDVGKYFRVNKMIAK
SYY_STRCO       WVERLRGQIEPFLSFEGENA------AVMVNNLDWTEGLSAIEFLRDIGKHFRVNKMLTK
SYY_THEFY       WVGNLKRQLSSFLEFTPEGAEPKPTDALLLDNAEWLGKLTAIGLLRDIGKHFSINQMLAR
SYY_CUTAK       WVESIKDQVSKYVDTDGRNA------AQIVNNYDWTVKYTALDLLRDVGKHFSVNRMLAR
SYY_BACFN       NQACIKKQLAKFLDFESDAP----NRAELVNNYDWMKEFTFLDFAREVGKHITVNYMMAK
SYY_BACFR       NQACIKKQLAKFLDFESDAP----NRAELVNNYDWMKEFTFLDFAREVGKHITVNYMMAK
SYY_BACTN       NQACIKKQLAKFLDFESDVP----NRAELVNNYDWMKEFSFLDFVREVGKHITVNYMMAK
SYY_PORGI       NQDCIKQQLAKFLDFDSDAP----NAAKLVNNYDWMKDYSFLGFIRDIGKHITVNYMMAK
SYY_ANADE       NVAAIRAQLERFVSFEGQ------NAARVRNNADWLRSIGLMEFLRDVGKHFTVNYMLAK
SYY_RHOBA       NVDGVAAQMRHFLDFEGD------NAAKLLNNFDWMKDYSYLEFLRDVGKNFPVGAMMGK
SYY1_BACAN      YTESIKNQLSNFLEFE-----NVENPATMANNYDWLGNLDVISFLRDIGKNFGLNYMLAK
SYY1_BACHK      YTESIKNQLSNFLEFE-----NVENPATMANNYDWLGNLDVISFLRDIGKNFGLNYMLAK
SYY1_BACCZ      YTESIKNQLSNFLEFE-----NVENPATMANNYDWLGNLDVISFLRDIGKNFGLNYMLAK
SYY1_BACC1      YTESIKNQLSNFLEFE-----NVDNPATMANNYDWLGNLDVISFLRDIGKNFGLNYMLAK
SYY1_BACCR      YTESIKNQLSNFLEFE-----NVDNPATMANNYDWLGNLDVISFLRDIGKNFGLNYMLAK
SYY1_BACLD      WSQKIKNQLSRFLDFE-----AEENPAIMANNYDWIGKMNVIDFLRDVGKNFGINYMLAK
SYY1_BACSU      WSQKIKNQLSRFLDFE-----AAENPAVIANNFDWIGKMNVIDFLRDVGKNFGINYMLAK
SYY_BACCA       WSARIKEQLGRFLDFE-----ADGNPAKIKNNYDWIGPLDVITFLRDVGKHFSVNYMMAK
SYY_GEOKA       WSARIKEQLGRFLDFE-----ADGNPAKIKNNYDWIGPLDVITFLRDVGKHFSVNYMMAK
SYY_GEOSE       WSARIKEQLGRFLDFE-----ADGNPAKIKNNYDWIGPLDVITFLRDVGKHFSVNYMMAK
SYY2_ENTFA      WSESIKGQLSRFIDFE-----DEKNPAILANNYDWLGELSLIDFLRDVGKNFTINYMMSK
SYY_OCEIH       FTSKLQQQIAKLVDMESN---ASENTVVARNNHDWLGNMTIIDFLRDAGKHFGINYMLAK
SYY2_BACAN      NVDALTAQMKKLFDFGG------NSEVKMVNNYDWTHEINIIEFLRDYGKNFSINSMLAK
SYY2_BACHK      NVDALTAQMKKLFDFGG------NSEVKMVNNYDWTHEINIIEFLRDYGKNFSINSMLAK
SYY2_BACCZ      NVDALTAQMKKLFDFGG------NSEVKMVNNYDWTHEINIIEFLRDYGKNFSINSMLAK
SYY2_BACC1      NVDALTAQMKKLFDFGG------NSEVKMVNNYDWTHEINIIEFLRDYGKNFSINSMLAK
SYY2_BACCR      NVDALTAQMKKLFDFGG------NSEVKMVNNYDWTHEINIIEFLRDYGKNFSINSMLAK
SYY_LISMF       NVESLRVQLGKIFDFEG------NSAASMVNNYDWTKDVSILDFLRDYGKEFNVNTMLSK
SYY_LISMO       NVESLRVQLGKIFDFEG------NSAASMVNNYDWTKDVSILDFLRDYGKEFNVNTMLSK
SYY_LISIN       NVESLRVQLGKIFDFEG------DSAASMVNNYDWTKDVSILDFLRDYGKEFNVNTMLSK
SYY_LACBR       NVKALSRQMQRLFGGDS--------NVTMVNNYDWLSKISLLDFLRDYGKLVNINTMLAK
SYY_LACSS       NVEALSGQMKRLFGEDA--------NVSMVNNYDWLSKISLLDFLRDYGKLFNINTMLAK
SYY1_ENTFA      NVDSLSNQMKKLFGKDA--------EVTMVNNYDWLSELSLLDFLRDYGKNFNVNTMLAK
SYY_LACPL       NQDGLSAQMYKLFGHDE--------NFSIVNNYDWLSKISLLDFLRDYGKLFSVNTMLNK
SYY_LACAC       NEESLTNQMKKLFGTE---------NFEIRNNAEWLGKINLIDFLRDYGKYFQVNNMINK
SYY_LACJO       NEEKLTAQMKKLFGTE---------NFEIRNNAEWLGKMNLLDFLRDYGKFFQVNNMINK
SYY_STAA3       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAW       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAR       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAS       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAM       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAN       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAB       NIEGISKQMHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAAC       NIEGISKQIHNIFEFGT------DHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAEQ       NVKGLSNQMHRLFEFGS------DKGAKLVNNKDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAES       NVKGLSNQMHRLFEFGS------DKGAKLVNNKDWLGQISLISFLRDYGKHVGVNYMLGK
SYY_STAHJ       NVEGISAQMHKLFEFGT------DKGAILVNNKDWLSQISLISFLRDYGKHVGVNYMLGK
SYY_STAS1       NVQGINKQMHKIFEFDT------EKGAKLVNNKDWLGQISLIDFLRDYGKHVGVNYMLGK
SYY_STRA3       WGNKIRGQLSNFLEFET-----GDNKAVLVNNYDWFSNISFIDFLRDVGKYFTVNYMMSK
SYY_STRA5       WGNKIRGQLSNFLEFET-----GDNKAVLVNNYDWFSNISFIDFLRDVGKYFTVNYMMSK
SYY_STRA1       WGNKIRGQLSNFLEFET-----GDNKAVLVNNYDWFSNISFIDFLRDVGKYFTVNYMMSK
SYY_STRPN       WVKSIQGQLSRFLDFEN-----GENKAVMVNNYDWFGSISFIDFLRDIGKYFTVNYMMSK
SYY_STRR6       WVKSIQGQLSRFLDFEN-----GENKAVMVNNYDWFGSISFIDFLRDIGKYFTVNYMMSK
SYY_STRP3       WSDKIKGQLSTFLDFEN-----GDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSK
SYY_STRP8       WSDKIKGQLSTFLDFEN-----GDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSK
SYY_STRP6       WSDKIKGQLSAFLDFEN-----GDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSK
SYY_STRPM       WSDKIKGQLSTFLDFEN-----GDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSK
SYY_STRP1       WSDKIKGQLSTFLDFEN-----GDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSK
SYY1_STRT1      WVEKIQGQLSRFLDFEN-----GDNKAVMVNNYDWFGSVSFIDFLRDVGKYFTVNYMMSK
SYY1_STRT2      WVEKIQGQLSRFLDFEN-----GDNKAVMVNNYDWFGSVSFIDFLRDVGKYFTVNYMMSK
SYY_STRMU       WVQSIRSQLERFIDFKH-----GDNKAQMVNNYDWMGKITFIDFLRDVGKYFTVNYMMSK
SYY_LACLA       WSGKIRSQLERFLDFEN-----GENKAEMTNNYNWFENLTFIDFLRDVGKHFTVNYMISK
SYY_BLOPB       WIEKIKYQVSLFVDFSHS----QYSQACIVNNYDWLSSISLLTFLRDIGKFFSVNKMINK
SYY_BLOFL       WIKKIKLQIALFIDCNSN----NASQAHIIDNYSWFSSMNILTFLRDIGKFFSINKMINK
SYY_BUCAI       WTEKITKQISCFLDFNCG-----KNSAVLLNNNTWFKQINILSFLRDVGKYFSVNTMINR
SYY_BUCAP       CTLKISQQISFFLDFNSN-----FNSAIILNNNLWFKKINILQFLRDVGKYFSVNALINR
SYY_BUCBP       WKQKITKQLSLFLKFNVG-----KNNALIVDNYEWFKNINVLTFLRDIGKHFSINQMIVR
SYY_WIGBR       WSKTIENQILNIIKYENN-----NCNLIILNNYLWIKELKIINFLRDIGRFISINKILRK
SYY_CHRVO       WVEKIRKQVEPFLSFE------GENAAVMANNYDWFGKMNALEFLRDIGKHFSVNAMIKK
SYY_DECAR       WVGKIRGQVEPFLKFD------GANAAIMANNYDWFGGMNCLEFMRDIGKHFSVNAMIKK
SYY_NEIMA       WVESIRNQLTPFLSFE------GGNAAIMANNADWFGKMNCLDFLRDIGKHFSVNAMLNK
SYY_NEIMB       WVESIRNQLTPFLSFE------GGNAAIMANNADWFGSMNCLDFLRDIGKHFSVNAMLNK
SYY_NEIG1       WVGSIRSQLTPFLSFE------GGNAAIMANNADWFGSMNCLDFLRDIGKHFSVNAMLNK
SYY_ECOLI       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_SHISS       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_ECO57       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_SHIDS       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_ECOL6       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_SHIBS       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_SHIFL       WVDKIRKQVAPFLDFDC-----GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINK
SYY_SALCH       WVAKIRKQVAPFLDFDC-----GENSAIAANNYDWFGSMNVLTFLRDIGKHFSVNQMINK
SYY_SALPA       WVAKIRKQVAPFLDFDC-----GENSAIAANNYDWFGSMNVLTFLRDIGKHFSVNQMINK
SYY_SALTI       WVAKIRKQVAPFLDFDC-----GENSAIAANNYDWFGSMNVLTFLRDIGKHFSVNQMINK
SYY_SALTY       WVAKIRKQVAPFLDFDC-----GENSAIAANNYDWFGSMNVLTFLRDIGKHFSVNQMINK
SYY_PECAS       WVEKIRRQVSPFLDFDC-----GKNSAIAANNYDWFGNMNVLDFLRDIGKHFSVNQMISK
SYY1_PHOLL      WVEKIRRQVSPFLDFDC-----GENSAKTANNYDWFGNMDVLAFLRDIGKHFSVNQMINK
SYY_YERPE       WVEKIRHQVSPFLDFDC-----GENSAIAANNYDWFGGMNVLTFLRDIGKHFSVNQMINK
SYY_YERPS       WVEKIRHQVSPFLDFDC-----GENSAIAANNYDWFGGMNVLTFLRDIGKHFSVNQMINK
SYY_SODGM       WVEKIKRQVSPFLDFDC-----GDNSAVAANNYDWFGSMNVLTFLLDIGKHFSVNQMINK
SYY_VIBF1       WVNKIKAQVSAFVDFTE-----EKNGAEVVNNLDWIGQINVIEFMRDVGKHFSVNAMIQK
SYY1_PSEHT      WVADLSSQVESVMNPH------LSEPIQLKNNADWFSGIEVLDFFRDVGKHFSINNMINR
SYY1_VIBPA      WVNDLSNQIQQLMNHQ------LSKPMIMVNNADWMRAINVIDFFRDVGKHFSINTMINR
SYY1_VIBVU      WVNALATQIQQLMTPH------LTQPLVMVNNADWMQSIGVIAFFRDIGKHFSVNAMIQR
SYY1_VIBVY      WVNALATQIQQLMTPH------LTQPLVMVNNADWMQSIGVIAFFRDIGKHFSVNAMIQR
SYY1_VIBCH      WVSDLSQQITQLMTSQGE----NCASLMAVNNADWIGKINLIDFFRDVGKHFSVNAMINR
SYY_MYCCT       NINKISTQLKEII-----------PTVSFVNNRDWLEDISLIDFLRDIGKHFNLSYLLAK
SYY_MYCMS       NINKISAQLKQII-----------PNVNFVNNNTWLSNISLIDFLRDIGKHFNLSYLLAK
SYY_MESFL       HATAIQNQLLRII-----------PDVTFANNVDWLGNMSLIDFLRDVGKDFNISYLLNK
SYY_MYCGA       NANKIKVQLERY------------TQAKIINNIDFYQNMNLLNFLRDTGKLINIGYLLDK
SYY_UREPA       NIAKIKFQLEKF------------TNSQVINNYVFYENMTFLDFLRDVGKLININYLLEK
SYY_MYCMO       NTEAIKKQIKHFL-----------PDAKIVNNSDFYKNQSFIDFLRDVGKFIQVSYMLSK
SYY_MYCH2       NKEKIKKQLESF-------------GLPVFDNFEIYKNMNILDFLRDVGKNINISYLLAK
SYY_MYCHJ       NKEKIKKQLESF-------------GLPVFDNFEIYKNMNILDFLRDVGKNINISYLLAK
SYY_MYCH7       NKEKIKKQLESF-------------GLPVFDNFEIYKNMNILDFLRDVGKNINISYLLAK
SYY_MYCS5       NKNKIKSQLESF-------------GLKVFDNYEIYKDISFLDFLKNIGKLINVSYMLAK
SYY_MYCPU       NKKHIRKQLENF-------------GFKVIDNLDFYKDMNILDYLRSVGKFFNVSTMMSR
                    .   .                      *         :      *  . :. ::  

SYY_AYWBP       HVVAKRLAS----GISFTEFSYMILQSLDFHHLYKNHKVRLQLGGSDQWGNITSGLEIIR
SYY_ONYPE       HAVAKRLAS----GISFTEFSYMILQSLDFHHLYKNHKVRLQLGGSDQWGNITSGLELIR
SYY_AGRFC       DSVKTRLDRE--QSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGIDLGH
SYY_RHIME       DSVKMRLERE--QSLSFLEFNYMILQAYDFVELYERTGCRLQMGGSDQWGNIVNGIDLGH
SYY_BRUA2       DSVKLRLDRE--QSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGIDLGH
SYY_BRUAB       DSVKLRLDRE--QSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGIDLGH
SYY_BRUME       DSVKLRLDRE--QSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGIDLGH
SYY_BRUSU       DSVKLRLDRE--QSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGIDLGH
SYY_RHILO       DSVKLRLDRE--QSLSFLEFNYMILQGYDFVELARRQNCRLQMGGSDQWGNIINGVDLGH
SYY_BARHE       DSVRLRLERE--HSLSFLEFNYMILQAYDFVELYKRYGLRMQMGGSDQWGNIINGIELGH
SYY_BARQU       DSVRLRLERE--HSLSFLEFNYMILQAYDFVELYKRYGLRMQMGGSDQWGNIINGIELGH
SYY_NITWN       DSVKMRLERE--QELSFIEFNYMILQSYDYVELARRHGCNLQMGGSDQWGNIVNGVDLGR
SYY_RHOPA       DSVKLRLDRE--QELSFIEFNYMILQSYDFVELARRYKCNLQMGGSDQWGNIVTGVDLGR
SYY_BRADU       DSVRLRLERE--QEMSFIEFNYMVCQAYDFVELAKRTGCKLQMGGSDQWGNIIMGVDLGR
SYY_MAGSA       DSVKLRLERE--QPLTFLEFNYMLLQGYDFVELFRRNRCILQMGGSDQWGNIINGVELGR
SYY_RHORT       DSVRLRLDRE--QPLSFLEFNYMILQAYDFLELGRRTGVRLQMGGSDQWGNIVNGVELGR
SYY_CAUVC       DSVKLRLERE--QPMTFLEFNYMLMQAVDFLELNRAHGCVLQMGGSDQWGNILNGVELTR
SYY_NOVAD       DSVKQRLDRE--QSLSFLEFNYMILQAYDFRELSQRHACRLQMGGSDQWGNIVNGIELTR
SYY_ZYMMO       DSVKLRLDRE--QSLSFLEFNYMILQAYDFLELSRRFGVCLQLGGSDQWGNIVNGIELAR
SYY_RHOS4       ESVKSRLDRE--QSLSFLEFNYMILQAYDFLELFRRTGCRLQMGGSDQWGNIVNGIDLTR
SYY_RUEPO       ESVKSRLDRE--QSLSFLEFNYMILQAYDFMELNRRYGCILQMGGSDQWGNIVNGIDLTR
SYY_GLUOX       DSVRQRLERE--QGLTFLEFNYSILQSYDFRELNRRHGAVLQMGGSDQWGNIVSGIDLTR
SYY1_PSEAE      DAIRQRLDRE--HSLSFLEFGYTLLQAYDFVELSRRRGCTLQLGGADQWANIINGVELSR
SYY_EHRRG       DSVKLRLERE--QNLSFLEFNYMLLQAYDFIELNQRYNCLLQIGGSDQWGNIVNGVELGR
SYY_EHRRW       DSVKLRLERE--QNLSFLEFNYMLLQAYDFIELNQRYNCLLQIGGSDQWGNIVNGVELGR
SYY_EHRCJ       DSVRLRLERE--QNLSFLEFNYMLLQSYDFVELNRRYNCLLQIGGSDQWGNIVSGVELGR
SYY_ANAMM       DSVRSRLDRD--QNLSFLEFSYVLLQSYDFVELHRRHKCVLQIGGADQWGNIVNGIDLGR
SYY_WOLPM       DSVKTRLDRE--QTLSFLEFNYMLLQAYDFIELNKKYDCRLQIGGSDQWGNIVNGIELGK
SYY_WOLTR       DSAKTRLDRE--QNLSFLEFNYMLLQAYDFAELNKKYGCRLQIGGSDQWGNIVNGIELGK
SYY_RICCN       DSVKLRLERE--QHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGADLIR
SYY_RICFE       DSVRLRLERE--QHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGADLTR
SYY_RICPR       DSVKLRLDRS--HHLSFLELNYMLLQSYDFYYLSKNYNCILQLGGSDQWGNIVIGADLIR
SYY_RICTY       DSVKLRLERS--HHLSFLELNYMLLQAYDFYYLSKHYNCILQLGGSDQWGNIVIGADLIR
SYY_PELUB       DSVKIRLERE--QSLSYMEFNYMILQAYDFLELNKKEKCMLQIGGSDQWGNIVNGVDLIK
SYY_BORBU       ETYKRRM--D--FGLSFIEFNYQLLQSYDYYMLNKIKNCRLQIGGDDQWGNIISGVDLIR
SYY_BORBP       ETYKRRL--D--FGLSFIEFNYQLLQSYDYYMLNKIKNCKLQIGGDDQWGNIVSGVDLIR
SYY_TREDE       EAYKKRM--E--TGLSFLEFNYQLLQSYDFLMLNQNYNIELQIGGDDQWGNMVAGSDLIR
SYY_TREPA       EAYKKRL--E--TGLSFLEFNYQLLQSYDFLTLSDRYAVELQIGGDDQWGNIVAGADLVR
SYY1_CLOAB      ECFKQRM--E--KGLSFLEFNYMLMQGFDFYKLNEKYDCKMELGGDDQWSNMIAGVELIR
SYY_CLOPE       ECFKQRL--E--RGLSFLEFNYMLMQGYDFYVLNKKYNCKMELGGDDQWSNMIAGVELVR
SYY_FUSNN       ECYKSRM--E--NGLSFLEFNYMIMQAYDFYILNHKYNCTMQLGGDDQWSNMIAGVELLR
SYY_CLOTE       ECFKQRL--E--KGLSFLEFNYMLMQAYDFLCLNRKYGCVMELGGDDQWSNMLAGTDLIR
SYY_CALS4       EAFKTRM--E--RGLTFLEFNYMLMQAYDFLELYRRYGCVMQMGGNDQWSNIIAGVELIR
SYY_SYNAS       ESYKMRL--E--KGLNFIEFNYMLLQAYDFLYLFQNHNCVMQMGGNDQWGNMLAGVDLIR
SYY_MYCGE       DAFSARWEK----GLTLMELNYMILQAYDFYYLHKNHNVTLQIGGSDQWANILAGANLIK
SYY_MYCPN       DAFSARWER----GLTLMELNYMVLQAYDFYYLNQKYGVQLQIGGSDQWANILAGADLIR
SYY_MYCPE       EAFKVRFEQE--SGLSFLEFNYMLMQAYDFYYLNQNYNVNIQLGGSDQWSNILAGVDLIR
SYY_CHLAB       DTVKQRVQSE--EGISYTEFSYMLLQSYDFAYLFENYGVCLQCGGSDQWGNITSGIDYIR
SYY_CHLCV       DTIKQRIQSE--EGISYTEFSYILLQSYDFAHLFEKHGIALQCGGSDQWGNITSGIDYIR
SYY_CHLPN       DTIKQRVHSD--EGISYTEFSYLILQSYDFYHLFKNYGTILQCGGSDQWGNITSGIDFIR
SYY_CHLTA       DVVKQRVYSE--EGISYTEFSYLLLQSYDFAHLFKEHNVVLQCGGSDQWGNITSGIDYIR
SYY_CHLTR       DVVKQRVYSE--EGISYTEFSYLLLQSYDFAHLFKEHNVVLQCGGSDQWGNITSGIDYIR
SYY_CHLMU       DVVKQRVYSE--EGISYTEFSYLLLQSYDFAHLFKHHGVVLQCGGSDQWGNITSGIDYIR
SYY_PARUW       DSVKTRLNSE--EGMSFTEFCYQILQGYDFLHLFENYGVTVELGGSDQWGNITAGTDLIR
SYY_TROW8       DAVAARLSST--EGISYTEFSYQILQSLDFRQLYLDYKCVLQIGGSDQWGNITSGVDLIR
SYY_TROWT       DAVAARLSST--EGISYTEFSYQILQSLDFRQLYLDYKCVLQIGGSDQWGNITSGVDLIR
SYY_LEIXX       DAVAARLNSD--EGISYTEFSYQILQGLDYLELYRQHGCVLQTGGSDQWGNLTSGTELIR
SYY_BIFLO       DTVARRLNSE--EGISFTEFSYQVLQGNDFLHLFDEYHCTLELGGSDQWGNLTSGLDLIH
SYY_CORDI       ETVKRRLET---DGISYTEFSYMLLQANDFVQLNREYDCVLQIGGGDQWGNIVSGVDLNR
SYY_CORJK       DTVKRRLES---DGISYTEFSYMLLQANDYVHLHNEFDCVLQIGGGDQWGNIVSGVDLNR
SYY_COREF       DTVKRRLET---DGISYTEFSYMLLQANDFVELNRRFNCILQVGGGDQWGNIVSGVDLNR
SYY_CORGL       DTVKRRLES---DGISYTEFSYMLLQANDYVELNKRFGCTLQVGGGDQWGNIVSGVDLNR
SYY_MYCBO       DTIRRRLAG---EGISYTEFSYLLLQANDYVELHRRHGCTLQIGGADQWGNIIAGVRLVR
SYY_MYCTU       DTIRRRLAG---EGISYTEFSYLLLQANDYVELHRRHGCTLQIGGADQWGNIIAGVRLVR
SYY_MYCPA       DTVRRRLEG---DGISYTEFSYMLLQANDYVELHRRYGCVLQIGGSDQWGNIIAGVRLVR
SYY_MYCLE       DTIRRRLNG---QGISYTEFSYMLLQANDYAELHQRHGCALQIGGSDQWGNIIAGVRLVR
SYY_MYCFO       ETVRRRLEG---DGISYTEFSYMLLQANDFVELHQRYGCALQIGGSDQWGNIVAGARLVR
SYY_NOCFA       DTVKRRLEG---DGMSYTEFSYMLLQANDYVQLRRSFGCRLQVGGSDQWGNIIAGVELNR
SYY_STRAW       EAVSRRLNSD--AGISYTEFSYQILQGMDFLELYRRYGCTLQTGGSDQWGNLTSGTDLIH
SYY_STRCO       DSVARRLESS--EGISYTEFSYQLLQAMDFLQLYRRYGCTMQQGGSDQWGNLTAGLDLLH
SYY_THEFY       ETVKTRLEG---AGMSYTEFSYVLLQSYDYVELYRRHGCTLQIGGSDQWGNITAGLDLIR
SYY_CUTAK       DVVARRLES----GISYTEFSYVLLQSLDFYELHKRYGCTLQTGAQDQWGNITAGAEFIR
SYY_BACFN       ESVKKRLNGEARDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGTELIR
SYY_BACFR       ESVKKRLNGEARDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGTELIR
SYY_BACTN       DSVKRRLNGEARDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGAELIR
SYY_PORGI       DSVKKRLSAESSTGLSFTEFSYQLLQGYDYLYLYRNEGCRLQMGGSDQWGNITTGTELIR
SYY_ANADE       DSVKGRME----SGISFTEFSYQLIQAYDFWHLFHAERCELQMGGSDQWGNITAGAELVS
SYY_RHOBA       ESVRSRLESE--AGLSYTEFSYMLLQAYDFVNLAQTHDCRIQAGGSDQWGNITAGIDLGR
SYY1_BACAN      DTVASRLET----GISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGLELIR
SYY1_BACHK      DTVASRLET----GISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGLELIR
SYY1_BACCZ      DTVASRLET----GISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGLELIR
SYY1_BACC1      DTVASRLET----GISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGLELIR
SYY1_BACCR      DTVASRLET----GISFTEFSYMILQSYDFLNLYQHHKCRLQIGGSDQWGNITAGLELIR
SYY1_BACLD      DTVSSRIET----GISYTEFSYMILQSLDFLNLYRNQECKLQIGGSDQWGNITSGLELIR
SYY1_BACSU      DTVSSRIES----GISYTEFSYMILQSYDFLNLYRDKNCKLQIGGSDQWGNITAGLELIR
SYY_BACCA       ESVQSRIET----GISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGLELIR
SYY_GEOKA       ESVQSRIET----GISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGLELIR
SYY_GEOSE       ESVQSRIET----GISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGLELIR
SYY2_ENTFA      ESVKRRIET----GISYTEFAYQLLQAYDFLKLYETEGCLLQLGGSDQWGNITSGIELLR
SYY_OCEIH       ESVSARIEQ----GITFTEFSYMILQSLDYLKLYEEENCTLQIGGSDQWGNITAGMELIR
SYY2_BACAN      DIVASRLDT----GISFTEFTYQILQAMDFHHLYTKEDVQLQIGGSDQWGNITSGLDLIR
SYY2_BACHK      DIVASRLDT----GISFTEFTYQILQAMDFHHLYTKEDVQLQIGGSDQWGNITSGLDLIR
SYY2_BACCZ      DIVASRLDT----GISFTEFTYQILQAMDFHHLYKKEDVQLQIGGSDQWGNITSGLDLIR
SYY2_BACC1      DIVASRLDT----GISFTEFTYQILQAMDFHHLYTKEDVQLQIGGSDQWGNITSGLDLIR
SYY2_BACCR      DIVASRLDT----GISFTEFTYQILQAMDFHHLYTKEDVQLQIGGSDQWGNITSGLDLIR
SYY_LISMF       DIVASRLEV----GISFTEFAYQILQAMDFNHLYEFNDCRLQIGGSDQWGNITAGLDLIR
SYY_LISMO       DIVASRLEV----GISFTEFAYQILQAMDFNHLYEFNDCRLQIGGSDQWGNITAGLDLIR
SYY_LISIN       DIVASRLEV----GISFTEFAYQILQAMDFNHLYEFNDCRLQIGGSDQWGNITAGLDLIR
SYY_LACBR       DIVASRLDT----GISFTEFTYQILQSVDFLTLHNDHNIQLQIGGADQWGNITAGIDLIH
SYY_LACSS       DVVASRLDV----GISFTEFTYQILQSVDFMHLYKAHDVQLQIGGADQWGNITSGIDMIH
SYY1_ENTFA      DIVASRLES----GISFTEFTYQILQSIDFYTLHKKHNIQLQIGGADQWGNITAGLDLIR
SYY_LACPL       EVVASRLEV----GISYTEFTYQILQSVDFLHLYRAEHVQLQIGGADQWGNITAGTDLIH
SYY_LACAC       DVVASRLEN----GISFTEFTYQILQAIDFYHLNKDDGVQLQIGGGDQWGNITAGIDLIH
SYY_LACJO       DVVASRLEN----GISFTEFSYQILQAIDFYHLNKDNGVQMQIGGSDQWGNITAGIDLIH
SYY_STAA3       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAW       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAR       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAS       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAM       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAN       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAB       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAAC       DSIQSRLEH----GISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAEQ       DSIQTRLEH----GISYTEFTYTILQAIDFGYLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAES       DSIQTRLEH----GISYTEFTYTILQAIDFGYLNRELNCKIQVGGSDQWGNITSGIELMR
SYY_STAHJ       DSIQSRLEN----GISYTEFTYTILQAIDFGHLNRELNCKLQVGGSDQWGNITSGIELMR
SYY_STAS1       DSIQTRLEH----GISYTEFTYTILQAIDFGHLNRTYNCKVQVGGSDQWGNITSGIELMR
SYY_STRA3       ESVKKRIET----GISYTEFAYQIMQGYDFYELNKNYNVTLQIGGSDQWGNMTAGTELIR
SYY_STRA5       ESVKKRIET----GISYTEFAYQIMQGYDFYELNKNYNVTLQIGGSDQWGNMTAGTELIR
SYY_STRA1       ESVKKRIET----GISYTEFAYQIMQGYDFYELNKNYNVTLQIGGSDQWGNMTAGTELIR
SYY_STRPN       ESVKKRIET----GISYTEFAYQIMQGYDFFVLNQDHNVTLQIGGSDQWGNMTAGTELLR
SYY_STRR6       ESVKKRIET----GISYTEFAYQIMQGYDFFVLNQDHNVTLQIGGSDQWGNMTAGTELLR
SYY_STRP3       DSVKKRIET----GISYTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLR
SYY_STRP8       DSVKKRIET----GISYTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLR
SYY_STRP6       DSVKKRIET----GISYTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLR
SYY_STRPM       DSVKKRIET----GISYTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLR
SYY_STRP1       DSVKKRIET----GISYTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLR
SYY1_STRT1      ESVKKRIET----GISYTEFAYQIMQGYDFYELNAKYGVTLQIGGSDQWGNMTAGTELLR
SYY1_STRT2      ESVKKRIET----GISYTEFAYQIMQGYDFYELNAKYGVTLQIGGSDQWGNMTAGTELLR
SYY_STRMU       ESVKKRIET----GISYTEFAYQIMQGYDFYVLNQEHAVTLQVGGSDQWGNMTAGTELIR
SYY_LACLA       DSVKSRMES----GISYTEFAYQIMQGYDFYELNQLHNVTLQLGGSDQWGNMTAGTELLR
SYY_BLOPB       DAIKKRLQKN-NYGISYTEFSYNLLQSYDFTYLHKNYNAILQIGGSDQWGNIISGIDLIH
SYY_BLOFL       DIIKKRLKND-NYGISYTEFSYNLMQSYDFAHIYKHYDAILQIGGSDQWGNIISGIDLIK
SYY_BUCAI       AAVKQRITRP-DQGISFTEFSYNLLQAYDFFILNQQYQADLQIGGADQWGNISSGMHLIH
SYY_BUCAP       EAVKKRIKRS-DQGISFTEFSYNLLQAYDFFILNQKNQVSLQIGGSDQWGNISSGMHLIH
SYY_BUCBP       DAIQRRIKRL-DQGISFTEFSYNLLQAYDFYFLNKQLDVILQIGGSDQWGNIISGIDLIR
SYY_WIGBR       EIVKKKLKE--NQHISFMEFSYSLLQGYDYYFLNLNYDVYIQIGGSDQWSNIISGIDLVN
SYY_CHRVO       ESVQQRINRD-DQGISYTEFSYSLLQGYDFAELNQRLGCKLQIGGSDQWGNITAGTDLTR
SYY_DECAR       ESVQQRLTRE-DQGISYTEFSYSLLQGYDFAELNKRYGCVLQIGGSDQWGNIVAGTDLTR
SYY_NEIMA       ESVKQRIDRD-GAGISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTR
SYY_NEIMB       ESVKQRIDRD-GAGISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTR
SYY_NEIG1       ESVKQRIDRD-GAGISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTR
SYY_ECOLI       EAVKQRLNRE-DQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTR
SYY_SHISS       EAVKQRLNRE-DQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTR
SYY_ECO57       EAVKQRLNRE-DQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTR
SYY_SHIDS       EAVKQRLNRE-DQGISFIEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTR
SYY_ECOL6       EAVKQRLNRE-DQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTR
SYY_SHIBS       EAVKQRLNRE-DEGMSITEFSYNLQQGYDWTCLNTHYYVELQIGGSDQRWNITSEIDLTR
SYY_SHIFL       EAVKQRLNRE-DEGMSITEFSYNLQQGYDWTCLNTHYYVELQIGGSDQRWNITSEIDLTR
SYY_SALCH       EAVKQRLNRD-DQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGIDLTR
SYY_SALPA       EAVKQRLNRD-DQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGIDLTR
SYY_SALTI       EAVKQRLNRD-DQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGIDLTR
SYY_SALTY       EAVKQRLNRD-DQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGIDLTR
SYY_PECAS       EAVKQRLNRD-DVGISFTEFSYNLLQGYDFASLNKQHDVELQIGGSDQWGNITSGIDLTR
SYY1_PHOLL      EAVKQRLNRD-DVGISFTEFSYNLLQSYDFARLNEVHGVELQIGGSDQWGNITSGIDLTR
SYY_YERPE       EAVKQRLNRD-DSGISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGIDLTR
SYY_YERPS       EAVKQRLNRD-DSGISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGIDLTR
SYY_SODGM       EAVKQRLNRD-DSGISFTEFSYNLLQGYDFACLNKQYGVALQIGGSDQWGNITSGIDLTR
SYY_VIBF1       ESVKQRIDRE-GSGISFTEFSYMLLQSYDFAALNKAKECTLQIGGSDQWGNITGGIDLTR
SYY1_PSEHT      ESVKQRLQRP-DQGLSFTEFSYTLLQSYDFAKLNSELGCSVQIGGNDQWGNIVSGIDLTR
SYY1_VIBPA      ESVKQRLQRP-DQGISFTEFSYALLQSYDFAELNRQYGCRLQIGGNDQWGNIVSGIDLTR
SYY1_VIBVU      ESVKQRLARP-DQGISFTEFSYSLLQSYDFAQLNQTHQCALQIGGNDQWGNIVSGIDLTR
SYY1_VIBVY      ESVKQRLARP-DQGISFTEFSYSLLQSYDFAQLNQTHQCALQIGGNDQWGNIVSGIDLTR
SYY1_VIBCH      ESVKQRLARP-DQGISFTEFSYSLLQSYDFAHLNREFGCALQIGGNDQWGNIVSGIDLTR
SYY_MYCCT       ESIATRIQT----GLSVTEFCYTMLQAFDFYYLYKNNDCSVQIGGSDQWGNITSGIDFIS
SYY_MYCMS       ESIATRIQT----GLSVTEFCYTMLQAYDFYYLYKNNNCSIQIGGSDQWGNITSGIDFIS
SYY_MESFL       DSIATRIST----GLSVTEFSYTMLQAYDFYNLYINHNCKVQIGGSDQWGNITSGTDYIS
SYY_MYCGA       EFIRSRIEN----GISYAEFSYNIIQGHDFLHLYEQYDVQVQCGGSDQWGNITTGIDMIK
SYY_UREPA       EIINSRLSV----GISYTEFSYNLLQGYDFLQLYKNDNIAIQAGGSDQWGNITTGIEMIR
SYY_MYCMO       EIVKNRLES----GISFTEFAYSLIQANDFHYLFKNHNVGIQFGGSDQWGNITTGLELIR
SYY_MYCH2       ESVASRIEV----GLSFTEFSYQLIQGWDFKFLAENYQIIGQAGGSDQWGNMVTGLDFIK
SYY_MYCHJ       ESVASRIEV----GLSFTEFSYQLIQGWDFKFLAENYQIIGQAGGSDQWGNMVTGLDFIK
SYY_MYCH7       ESVASRIEV----GLSFTEFSYQLIQGWDFKFLAENYRIIGQAGGSDQWGNMVTGLDFIK
SYY_MYCS5       DSVKDRLAQ----GLSFTEFSYQIIQGYDFLHLYQNQDIFVQYGGSDQWGNITTGIEMIS
SYY_MYCPU       DSVANRIQS----GLSFTEFSYQTLQAYDFKVLCEKENVMMQLGGSDQWGNLVSGLDFIN
                     :        :.  *: *   *. *:  :        : *. **  *:        

SYY_AYWBP       KLEKK----SDALGVSTPLLLNSDGTKFGKSE--KRVLWLNPLMTSPYEIYQYFLNVSDK
SYY_ONYPE       KLEKK----SDALGISTPLLLNSDGTKFGKSE--KGVLWVNPSMTSPYEIYQYFLNVSDK
SYY_AGRFC       RMG-----TPQLYALTSPLLTTSSGAKMGKSA-SG-AVWLNKDLLPVYDFWQYWRNTEDA
SYY_RHIME       RMG-----TPQLYALTSPLLTTASGAKMGKSL-SG-AVWLNPDMLGPYEFWQYWRNTEDA
SYY_BRUA2       RMG-----TPQLYALTSPLLTTASGQKMGKSL-GG-AIWLNADMLSAYDFWQYWRNTEDA
SYY_BRUAB       RMG-----TPQLYALTSPLLTTASGQKMGKSL-GG-AIWLNADMLSAYDFWQYWRNTEDA
SYY_BRUME       RMG-----TPQLYALTSPLLTTASGQKMGKSL-GG-AIWLNADMLSAYDFWQYWRNTEDA
SYY_BRUSU       RMG-----TPQLYALTSPLLTTASGQKMGKSL-GG-AIWLNADMLSAYDFWQYWRNTEDA
SYY_RHILO       RMG-----TPQLYALTTPLLTTSSGAKMGKSA-KG-AVWLNGDLFSPYDFWQYWRNTEDA
SYY_BARHE       RLG-----TPQLYALTSPLLTTSSGAKMGKSL-NG-AVWLNADMLSPYQFWQYWRNTEDA
SYY_BARQU       RLG-----TPQLYAFTSPLLTTSSGAKMGKSL-NG-AVWLNADMLSPYQFWQYWRNTEDA
SYY_NITWN       RMG-----THQLYALTCPLLTTSSGAKMGKTA-AG-AVWLNATMLPVYDYWQYWRNVEDA
SYY_RHOPA       RMG-----THQLHALTCPLLTTASGAKMGKTA-AG-AVWLNGDMLAPYDYWQYWRNTEDA
SYY_BRADU       RMG-----THQLFALTTPLLTTASGAKMGKTA-QG-AVWLNADQFSPYDFWQYWRNTEDA
SYY_MAGSA       RAD-----QAELFGLTSPLLTTSSGAKMGKTV-NG-AVWLNDDMLSAWEFWQYWRNTEDA
SYY_RHORT       RVD-----GLELFGLTSPLITTASGAKMGKTA-QG-AVWLNEARLPAYDYWQFWRNTEDA
SYY_CAUVC       RVD-----QKSAFGLTTPLLATASGAKMGKTA-AG-AVWLNAEQLSPYDYWQFWRNTEDA
SYY_NOVAD       RMD-----GVEVFGVTTPLLTTADGSKMGKTA-AG-AVWLNEDALPAWDFWQYWRNTDDR
SYY_ZYMMO       RMD-----GKEVFGLTSPLMTTADGVKMGKTV-GG-AVWLNGDMCSPYDYWQFWRNTHDA
SYY_RHOS4       RVL-----EGEIFGLTSPLLTTSDGRKMGKSA-GG-AVWLNGEMLAPYDFWQFWRNTTDA
SYY_RUEPO       RVI-----DHEVYGLTSPLLTTSDGKKMGKSQ-DG-AVWLNPDMRSPYEFWQFWRNTTDA
SYY_GLUOX       RTD-----GKQIFGLTTPLVTTSSGAKMGKSA-KG-ATWVRPEKLPVFEYWQFWRNTEDA
SYY1_PSEAE      RQG-----GAQLFGLTMPLLATSDGRKMGKSA-QG-AVWLNAERLAPFDFWQFWRNCDDR
SYY_EHRRG       KLK-----LPQLFGLTTHLLLTSTGEKMGKTA-NG-AVWLDGEMYSPADYWQYFRNVKDE
SYY_EHRRW       KLK-----LPQLFGLTTHLLLTSTGEKMGKTA-DG-AIWLDGEMYSPADYWQYFRNVKDE
SYY_EHRCJ       KLQ-----LSELFGLTTNLVLTSSGEKMGKTA-QG-AVWLNGDMYSPVDYWQYFRNVRDE
SYY_ANAMM       KLG-----LPQLYGLTTHLLLTSTGEKMGKTA-DG-AVWLDAEMFDPGNYWQYFRNVADV
SYY_WOLPM       KLN-----LPELFGLTMPLLLNAQGKKMGKTE-SG-AVWLDDNMLKPYDYWQYFRNVDDQ
SYY_WOLTR       KLN-----LPELFGLTTPLLLSAQGKKMGKTE-SG-TVWLDGDMLKPYDYWQYFRNIDDQ
SYY_RICCN       KIS-----GKEVFGMTTPLLTTSSGAKMGKTA-AG-AVWLNEDLLSPYDYYQYWRNCEDA
SYY_RICFE       KIS-----GKDVFGMTTPLLTTSSGAKMGKTA-AG-AVWLNEDLLSPYDYYQYWRNCEDA
SYY_RICPR       KIS-----GKEVFGMTTPLLTTASGAKMGKTA-AG-AVWLNEDLLSPYDYYQYWRNCEDA
SYY_RICTY       RIS-----GKEVFGMTTPLLTTASGAKMGKTA-AG-AVWLNEDLLSPYDYYQYWRNCEDA
SYY_PELUB       RYS-----NNHVYGLTTPLITLASGAKMGKTE-SG-AVWLDKKFLSSYDYWQFWRNIDDR
SYY_BORBU       KKN-----GSETFGLTFPLITRSDGKKMGKSE-KG-AVYLDSNLFSIYDFYQYFRNTSDS
SYY_BORBP       RKM-----GVEAFGLTFPLITRSDGKKMGKSE-KG-AVYLDSSLYSIYDFYQYFRNTSDS
SYY_TREDE       RKG-----GGEVFALTFSLVTRADGQKMGKSE-KG-AIFLDTALVSPYDFFQYWRNTADA
SYY_TREPA       RVR-----GKTVHGLTFPLITRADGQKMGKTE-QG-ALFLDPALVSPYDFFQYWRNTPDE
SYY1_CLOAB      RKS-----NKKAYAMTSALLTNSEGKKMGKTE-KG-ALWLDAEKTSPYDFFQYWRNVNDA
SYY_CLOPE       KKS-----QESAYAMTCTLLTNSEGQKMGKTV-NG-ALWLDPEKTSPYEFYQYWRNVNDA
SYY_FUSNN       RKD-----RKPAYAMTCTLLTNSEGKKMGKTA-KG-ALWLDPEKTTPYEFYQYWRNIDDQ
SYY_CLOTE       REE-----SKSAYAMTCTLLTNSEGNKMGKTV-NG-ALWLDKDKTSPYEFYQYWRNVDDA
SYY_CALS4       KKE-----GKQAYGMTFVLLTTSEGKKMGKTE-KG-AIWLDPKKTSPYEFYQYWRNIGDA
SYY_SYNAS       RVE-----GKVAHSMTFPLLTTATGQKMGKTE-KG-AVWLDRELTSPYEYYQYWINTGDI
SYY_MYCGE       RKN-----NASVFGLTANLLVKANGEKMGKTS-SG-ALWLDENKTSVFDFYQYWINLDDQ
SYY_MYCPN       RKT-----QKQVYGMTTNLLVKANGEKMGKSA-SG-ALWLDPQKTSPYDFYQYWINLDDA
SYY_MYCPE       RKS-----SKEAFALTLNLLTKHDGTKMGKTA-TG-AIWLDKNKTSPYEFYQYWLNIDDQ
SYY_CHLAB       RHG-----LGQAYGLTYPLLTNSQGKKIGKTE-SG-TIWLDPKLTSPYELYQYFLRLPDQ
SYY_CHLCV       RKG-----LGQAYGLTYPLLTNSQGKKIGKTE-SG-TIWLDPTLTSPYELYQYFLRLPDA
SYY_CHLPN       RKG-----LGQAYGLTYPLLTNAQGKKIGKTE-SG-TVWLDSDLTSPFELYQYLLRLPDD
SYY_CHLTA       RRG-----LGQAYGLTYPLLTDSKGKKIGKTE-SG-TIWLDPALTPPYELFQYFLRLPDQ
SYY_CHLTR       RRG-----LGQAYGLTYPLLTDSKGKKIGKTE-SG-TIWLDPALTPPYELFQYFLRLPDQ
SYY_CHLMU       RKG-----LGQAFGLTYPLLTDSKGKKIGKTE-SG-TVWLDPELTSPYELFQYFLRLSDQ
SYY_PARUW       KVH-----AKPAYGITFPLLTKSDGQKFGKSE-KG-AVWLSPDKLSSYEFYQHLIRVEDA
SYY_TROW8       KTE-----GAGVHAFGSPLLTASDGSKFGKTE-GN-AIWLDADLTSPWSFYQFFLNSDDA
SYY_TROWT       KTE-----GAGVHAFGSPLLTASDGSKFGKTE-GN-AIWLDADLTSPWSFYQFFLNSDDA
SYY_LEIXX       RVE-----GGHAHAVGTPLITNSDGTKFGKSE-GN-AVWLDPALTSPYAMYQFWLNTDDA
SYY_BIFLO       KVR-----GVDVNVFTSPIITDASGKKFGKSE-GN-AVWLDATMLSPYKFYQFWINRPDV
SYY_CORDI       RVS-----GTKTHALTVPLVTDAQGQKFGKST-GGGKLWLDPEKTSAYSWYQYFLNAGDS
SYY_CORJK       RVN-----GAKVHGLTVPLVTDAEGNKFGKST-GGGKLWLDPQLTSPYSWYQYFINAGDS
SYY_COREF       RVQ-----GKSVHGITVPLVTDSEGKKFGKST-GGGSLWLDPEMTSPYSWYQYFINAADA
SYY_CORGL       RVN-----GTSVHAVTVPLVTDSDGKKFGKST-GGGSLWLDPEMTSPYAWYQYFINASDA
SYY_MYCBO       QKL-----GATVHALTVPLVTAADGTKFGKST-GGGSLWLDPQMTSPYAWYQYFVNTADA
SYY_MYCTU       QKL-----GATVHALTVPLVTAADGTKFGKST-GGGSLWLDPQMTSPYAWYQYFVNTADA
SYY_MYCPA       QKL-----GATVHALTVPLVTAADGTKFGKST-GGGSLWLDPALTTPYAWYQYFFNTADA
SYY_MYCLE       QKL-----GATVHALTVPLVTAADGAKLGKST-GGGSLWLDPEMTSPYAWYQYFINTSDA
SYY_MYCFO       QKL-----GATVHAMTTPLVTDSEGKKFGKST-GGGNLWLDPEMTSPYAWYQYFVNTADA
SYY_NOCFA       RLD-----GESVHALTVPLVTSADGKKFGKST-GGGSLWLDPEMTSPYAWYQYFVNTADA
SYY_STRAW       RAE----PDAVVHALGTPLITKADGTKFGKTE-SG-TIWLDPEMTTPYAFYQFWLNADDR
SYY_STRCO       RLE----PDASVHAYATPLMTKADGTKFGKTE-GG-AVWLDPEMTTPYAFYQFWLNVDDR
SYY_THEFY       RMEGNE-PHGPAHALTTTLLTKADGTKFGKTE-SG-AVWLDPELTSPYAFYQFWFNSDDR
SYY_CUTAK       KTT-----GDVVHGLVTPLITKADGTKYGKTE-SG-TVWVDPELTSAYAFHQFFLNAEDS
SYY_BACFN       RTN-----GGEAYALTCPLITKADGGKFGKTE-SG-NIWLDPRYTSPYKFYQFWLNVSDA
SYY_BACFR       RTN-----GGEAYALTCPLITKADGGKFGKTE-SG-NIWLDPRYTSPYKFYQFWLNVSDA
SYY_BACTN       RTN-----GGEVFALTCPLITKADGGKFGKTE-SG-NIWLDPRYTSPYKFYQFWLNVSDS
SYY_PORGI       RKD-----GGEAFALTCPLITKADGGKFGKTE-SG-NIWLDPARTSPYAFYQFWLNVSDA
SYY_ANADE       RKD-----GASVHGLTFPLLTTASGTKFGKTE-GG-AVWLDPARTSPYKFFQFWLNTDDR
SYY_RHOBA       RML-----GKQLFGITAPLLTTSDGRKMGKTE-SG-AVWLDPERTSPYAFYQYWINVADE
SYY1_BACAN      KSEED----AKAFGLTIPLVTKSDGTKFGKTE--GGAIWLDPEKTTPYEFYQFWINTDDR
SYY1_BACHK      KSEED----AKAFGLTIPLVTKSDGTKFGKTE--GGAIWLDPEKTTPYEFYQFWINTDDR
SYY1_BACCZ      KSEED----AKAFGLTIPLVTKSDGTKFGKTE--GGAIWLDPEKTTPYEFYQFWINTDDR
SYY1_BACC1      KSEED----AKAYGLTIPLVTKSDGTKFGKTE--GGAIWLDPEKTTPYEFYQFWINTDDR
SYY1_BACCR      KSEED----AKAFGLTIPLVTKSDGTKFGKTE--GGAIWLDPEKTTPYEFYQFWINTDDR
SYY1_BACLD      KSEEN----AKAFGLTIPLVTKADGTKFGKTE--GGAIWLDKEKTSAYEFYQFWINTDDR
SYY1_BACSU      KSEEEG---AKAFGLTIPLVTKADGTKFGKTE--GGAIWLDKEKTSPYEFYQFWINTDDR
SYY_BACCA       KTKGE----ARAFGLTIPLVTKADGTKFGKTE--SGTIWLDKEKTSPYEFYQFWINTDDR
SYY_GEOKA       KTKGE----ARAFGLTIPLVTKADGTKFGKTE--SGTIWLDKEKTSPYEFYQFWINTDDR
SYY_GEOSE       KTKGE----ARAFGLTIPLVTKADGTKFGKTE--SGTIWLDKEKTSPYEFYQFWINTDDR
SYY2_ENTFA      R-EQE----VQGFGLTMPLITKADGTKFGKTE--GNAVWLDAEKTSPYEFYQFWINTDDR
SYY_OCEIH       RSRENLDENIEVFGLTVPLITKADGTKFGKTA--GNAIWLDASKTSPYEFYQFWFNTDDR
SYY2_BACAN      KLEGH---EAKVFGLTIPLLLKSDGTKFGKSA--GGAVWLDPEKTTPFEFYQFWVNTDDR
SYY2_BACHK      KLEGH---EAKVFGLTIPLLLKSDGTKFGKSA--GGAVWLDPEKTTPFEFYQFWVNTDDR
SYY2_BACCZ      KLEGH---EAKVFGLTIPLLLKSDGTKFGKSA--GGAVWLDPEKTTPFEFYQFWVNTDDR
SYY2_BACC1      KLEGH---EAKVFGLTIPLLLKSDGTKFGKSA--GGAVWLDPEKTTPFEFYQFWVNTDDR
SYY2_BACCR      KLEGH---EAKVFGLTIPLLLKSDGTKFGKSA--GGAVWLDPEKTTPFEFYQFWVNTDDR
SYY_LISMF       KKQGE---NAKAFGLTIPLLTKADGTKFGKSE--GGAIWLNPEKTTPYEFYQFWINTDDR
SYY_LISMO       KKQGE---NAKAFGLTIPLLTKADGTKFGKSE--GGAIWLNPEKTTPYEFYQFWINTDDR
SYY_LISIN       KKQGE---NAKAFGLTIPLLTKADGTKFGKSE--GGAIWLNPEKTTPYEFYQFWINTDDR
SYY_LACBR       KIKGA---DEAVYGLTIPLMLKADGTKFGKTA--GGAIWLDADKTSPYEFYQFWLNQDDR
SYY_LACSS       KIEGS---ETEVYGLTIPLMLKADGTKFGKTA--GGAIWLDPEKTTPYEFYQFWLNQDDR
SYY1_ENTFA      KKEGP---EAKVFGLTIPLMLKADGTKFGKTA--GGAIWLDPKKTSPFEFYQFWLNQDDR
SYY_LACPL       RLEGN---DAKAYGLTIPLLLKADGTKFGKTA--GGAVWLNPERTSPYEFYQFWINQDDR
SYY_LACAC       KLEGS---DRPAFGLTIPLMLKADGTKFGKSA--GGAVWLDPEKTSPYEFYQFWINQDDR
SYY_LACJO       KLDGS---DRPAFGLTIPLMLKADGTKFGKSA--GGAVWLDPEKTSPYEFYQFWINQDDR
SYY_STAA3       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAW       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAR       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAS       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAM       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAN       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAB       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAAC       RMYG----QTDAYGLTIPLVTKSDGKKFGKSE--SGAVWLDAEKTSPYEFYQFWINQSDE
SYY_STAEQ       RMYG----QTEAYGLTIPLVTKSDGKKFGKSE--SGAVWLDPEKTSPYEFYQFWINQSDE
SYY_STAES       RMYG----QTEAYGLTIPLVTKSDGKKFGKSE--SGAVWLDPEKTSPYEFYQFWINQSDE
SYY_STAHJ       RMYG----QTEAYGLTIPLVTKSDGKKFGKSE--SGAVWLDADKTSPYEFYQFWINQSDD
SYY_STAS1       RMYG----QTEAYGLTIPLVVKSDGKKFGKTE--GGAVWLDAAKTSPYEFYQFWINTTDD
SYY_STRA3       RKSNG-----VSHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDA
SYY_STRA5       RKSNG-----VSHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDA
SYY_STRA1       RKSNG-----VSHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDA
SYY_STRPN       RKADK-----TGHVITVPLITDATGKKFGKSE--GNAVWLNPEKTSPYEMYQFWMNVMDA
SYY_STRR6       RKADK-----TGHVITVPLITDATGKKFGKSE--GNAVWLNPEKTSPYEMYQFWMNVMDA
SYY_STRP3       KKADK-----TGHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDD
SYY_STRP8       KKADK-----TGHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDD
SYY_STRP6       KKADK-----TGHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDD
SYY_STRPM       KKADK-----TGHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDD
SYY_STRP1       KKADK-----TGHVMTVPLITDSTGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDD
SYY1_STRT1      RKADK-----SGHVITVPLITDSTGKKFGKSE--GNAVWLDATKTTPYEMYQFWLNVMDD
SYY1_STRT2      RKADK-----SGHVITVPLITDSTGKKFGKSE--GNAVWLDATKTTPYEMYQFWLNVMDD
SYY_STRMU       RKANK-----TAHVITVPLITDATGKKFGKSE--GNAVWLDADKTSPYEMYQFWLNVMDA
SYY_LACLA       RKANK-----QGHVITIPLITDSTGKKFGKSE--GNAIWLDADKTSPYEMYQFWLNVDDA
SYY_BLOPB       RIYKR-----TTYGLTMPLLTKSDNTKFGKTE--KHTIWLDAKKTSPYTFYQYWINTSDE
SYY_BLOFL       RMYKK-----NAYGLTVPLLTNFNNIKFGKTE--KNTIWLDPEKTSPYQFYQYWINIDDK
SYY_BUCAI       RKTKR-----VVYGLTVPLLIQSNGIKFGKTE--SGTIWLDSNKTSPYKFYQFWMNIEDA
SYY_BUCAP       RISKK-----EAYGLTLPLLMQSNGIKFGKTE--SGTVWLDPQKTTPYRFYQFWMNIEDS
SYY_BUCBP       RLHKK-----RAYGITVPLLTKKDGRKFGKTE--LDTIWLDKMKTSPYKFYQYWMNISDS
SYY_WIGBR       KINKK-----KVYGITTPLLTRSNGSKLGKSDDKEKVIWLDKKKTSVYEFYQFWLNTPDE
SYY_CHRVO       RLNQT-----QVYGLTMPLVTKADGTKFGKTE--SGTIWLDAKKTSPYAFYQFWLGTADA
SYY_DECAR       RLHQK-----HVFGLTLPLITKADGTKFGKTE--SGAIWLDPKKTSPYAFYQFWLNTSDA
SYY_NEIMA       RLNQK-----QVFGLTLPLVTKSDGTKFGKTE--GGAVWLNAKKTSPYQFYQFWLKVADA
SYY_NEIMB       RLHQK-----QVFGLTLPLVTKSDGTKFGKTE--GGAVWLNAKKTSPYQFYQFWLKVADA
SYY_NEIG1       RLNQK-----QVFGLTLPLVTKSDGTKFGKTE--GGAVWLNAKKTSPYQFYQFWLKVADA
SYY_ECOLI       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SHISS       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_ECO57       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SHIDS       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_ECOL6       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SHIBS       RLHQN-----HVLGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SHIFL       RLHQN-----HVLGLPDPLITNGDGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SALCH       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SALPA       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SALTI       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SALTY       RLHQN-----QVFGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_PECAS       RMNQK-----QVYGLTVPLITKSDGTKFGKTE--GGAIWLDASKTSPYKFYQFWINTADA
SYY1_PHOLL      RITQK-----QVFGMTVPLITKSDGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_YERPE       RLHQQ-----QVYGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_YERPS       RLHQQ-----QVYGLTVPLITKADGTKFGKTE--GGAVWLDPKKTSPYKFYQFWINTADA
SYY_SODGM       RLHQN-----TVYGLTVPLITKADGTKFGKTE--GGAVWLDPSKTSPYKFYQFWINTADS
SYY_VIBF1       RMNRN-----KVFGLTLPLVTKSDGTKFGKTE--SGTIWLDSNKTSPYAFYQFWLGTADA
SYY1_PSEHT      RLNKQ-----TVYGLTLPLITKSDGTKFGKTE--GGAIWLDPKKTSPYRFYQFWLNCDDA
SYY1_VIBPA      RQNGE-----QVFGLTLPLITKSDGTKFGKTE--GGAVWLDPSKTSPYAFYQFWLGAEDA
SYY1_VIBVU      RLNGT-----NVHGLTLPLITKSDGTKFGKTE--GGAIWLDAAKTSPYMFYQFWLNCDDA
SYY1_VIBVY      RLNGT-----TVHGLTLPLITKSDGTKFGKTE--GGAIWLDAAKTSPYMFYQFWLNCDDA
SYY1_VIBCH      RLNGV-----EVCGLTLPLITKSDGTKFGKTE--SGAVWLESSKTSPYRFYQFWLNSDDA
SYY_MYCCT       DT--INK-NNKASGVTINLLTKSDGQKFGKTE-SG-AVWLDKTKTSEYEFYQFWFNQTDE
SYY_MYCMS       DT--INK-NNKAAGLTINLLTKSDGQKFGKTE-SG-TIWLDKTKTSEYEFYQFWFNQTDQ
SYY_MESFL       TR--VGSANTEAAGFTIPLLTKSDGQKFGKTE-SG-AVWLDSNKTSVYDFYQFWINQDDN
SYY_MYCGA       RK-YGEEKTPYLCGLTFNLLLNPNGNKFGKSE-QG-ALYLDENLTHPYLIWQYIYNQDDQ
SYY_UREPA       KN-LGDD--NIACGLTINLLTNSEGKKFGKSE-KG-AIYLDENKSTVYEMYQFLINQSDA
SYY_MYCMO       KR-NGEN--SFSGGFTIKLLLKSDGTKFGKSE-QG-AIYLDPSLTSPYTMYQFLLNQNDS
SYY_MYCH2       KSNLVQKD--EAFVFTTNLLTDENGQKFGKSL-GK-PIWLDPEMYSPFHLYQFLLNQNDE
SYY_MYCHJ       KSNLVQKD--EAFVFTTNLLTDENGQKFGKSL-GK-PIWLDPEMYSPFHLYQFLLNQNDE
SYY_MYCH7       KSNLDQKD--EAFVFTTNLLTDENGQKFGKSL-GK-PIWLDPEMYSPFHLYQFLLNQSDE
SYY_MYCS5       KV-VGDNH--KAIAITANLLTDSNGNKFGKST-GGGNLWLDAQKTKPFDMYQFLINQPDS
SYY_MYCPU       KT-LSKNL--PTIGITMNLLVDSNGNKIGKST-GGASLWIDKTLTSPYVLYQYLLNTNDD
                                  ::    . * **:       ::           *.     * 

SYY_AYWBP       EVINYLKMLTLIPKKGILELEKKTLENPQ-KRLAQKALTQSIINLIHSSDILQECIKTNQ
SYY_ONYPE       EVINYLKMLTLIPKQEILELEKNTLENPQ-QRLAQKALTQNIITLIHSSDILQECIKTNQ
SYY_AGRFC       DVVRFAKLFTTLPMDEIARIATLGGSE---INEAKKILATEVTAILHGRAAAEEAAETAR
SYY_RHIME       DVARFLKLYTTLPMAEINRLSKLGGSE---INEVKKVLATEVTAMLHGRAAAEQAAETAR
SYY_BRUA2       DVERFLKLYTTLPLDEIARLAELGGAE---INEAKKILATEVTAMLHGRDAAEEAAETAR
SYY_BRUAB       DVERFLKLYTTLPLDEIARLAELGGAE---INEAKKILATEVTAMLHGRDAAEEAAETAR
SYY_BRUME       DVERFLKLYTTLPLDEIARLAELGGAE---INEAKKILATEVTAMLHGRDAAEEAAETAR
SYY_BRUSU       DVERFLKLYTTLPLDEIARLAELGGAE---INEAKKILATEVTAMLHGRDAAEEAAETAR
SYY_RHILO       DVERFLKIFTRLPLPEIARLAALGGSE---INEAKKILATETTAIVHGREAANQAEETAR
SYY_BARHE       DVTRFLKLYTPLPMDEILKLSALQGTE---INEAKKILATEITAMLHGRDLANAVAETAR
SYY_BARQU       DVTRFLKLYTTLPMDEILKLSALQGTE---INEAKKILATEITAMLHGRDLANTAAKTAR
SYY_NITWN       DVGRFLKLFTILPMGEIAKLAALQGSE---INEAKKVLATEATALLHGRDEAEKAADTAR
SYY_RHOPA       DVGRFLKLFTLLPMDEIERLSKLQGAE---INDAKKILATEATALMHGREAADKAETTAR
SYY_BRADU       DVGKFLKLFTTLPMSEIGKLEALGGSE---INEAKKVLATEATALLHGRDAANEAAETAR
SYY_MAGSA       DVGRFLKLYTELPLDEIARLEKLEGAE---INEAKKILANEVTRLCHGDAAALQAAETAR
SYY_RHORT       DVGRFLRLFTDLPLDEVARLEALGGAE---INEAKKILAERATTMAHGPEAALTAAETAR
SYY_CAUVC       DVGRFLKLFTDLPLDRIAELEALEGAQ---INEAKKVLADEATRMAHGEEEARKARDAAE
SYY_NOVAD       DVGKFLRLFTDLPLDEIARLEALEGSE---INAAKVVLANEVTRLVRGEEAAKAAEATAA
SYY_ZYMMO       DVERFLKLFTDLPLDEIARLAALEGSE---INEAKKILANEATKLAHGEKAAEEAAATAK
SYY_RHOS4       DVGRFLKLYTELPVEECDRLGALQGSE---INAAKILLANEVTTLLHGRDAAEAAEATAR
SYY_RUEPO       DVGRFLKLYTELPVGECDRLGALAGSE---INAAKVILANEVTALCHGAEAAATAEATAR
SYY_GLUOX       DVGRFLKFFTDLPVEECERLGALEGSE---INEAKKILATEATAICHGRGAAEEAAETAR
SYY1_PSEAE      DVGRFLALFSELPMDEVRRLGALQGAE---LNEAKVVLANAATALAHGEHAARSAADAAR
SYY_EHRRG       DVGRFLRLFTELPLTEIEKLENLKGYE---INEAKKILATEATRICHGEKIAQDIAYDAL
SYY_EHRRW       DVGRFLRLFTELPLTEIEKLENLKGYE---INEAKKILATEATRICHGEKIAQDIAYDAL
SYY_EHRCJ       DVGRFLKLFTELPLDKIKELELLQGHE---INEAKKMLATEATKICHGEEIAKNIAADAL
SYY_ANAMM       EVGRLLRLFTELPMNEIAELENLQGEA---INEAKKVLATEATAICHGKSAALAAENAAL
SYY_WOLPM       DVGRFLRLLTDVPIDEIRKLESLKDQE---INEAKKVLATEVTKICHGDKEAELAQFAAI
SYY_WOLTR       DIGRFLRFFTDLPIDEIKKLESLKNQE---INEAKKALATEVTKICHGDKEAELAQSSAV
SYY_RICCN       DIVRFAKLYSEFTQEELNRFESLAAED---INAAKKQLAYELTKLCHSEQAAKSALETAV
SYY_RICFE       DIVRFAKLYSELTQEELNKFESLAAED---INSAKKQLAYELTKLCHSEQAAKSALETAV
SYY_RICPR       DVMRFAKLYSELDIVELNKFESLVSED---INAAKKQLAYELTKLCHGERLAKLALETAV
SYY_RICTY       DVIRFAKLYSELDIIELNKFEHLVSED---INAAKKQLAYELTKLCHGERLAKLALETAV
SYY_PELUB       DVLKFLKIFTDINVDEI---ENIKDDN---INELKILLANKATSMLHGEDEARKCQETAK
SYY_BORBU       DVKTFLYLFTFLEEDEIELISNFKGNS---LNKAKEILAFEITKIVHGEAEALKVQEASF
SYY_BORBP       DVKTFLYLFTFLEEDEIESISNFKGNS---LNKAKEILAFEITKIVHGEVEALKVQEASF
SYY_TREDE       DVEKFMLLFTFLSIEEIKSVCAG---D---INKAKERLAFEVTALIHGKEEAEKALEGAR
SYY_TREPA       DVRRFLLLFTFLSVRDVEAILTQ---G---INCAKELLAYEVTRLMHGTAVAQVALQGAR
SYY1_CLOAB      DVEKCLSMLTFLPMDEVRRLASLKDQE---INKAKEVLAYEVTKLVHGEEEAKKALNSSK
SYY_CLOPE       DVEKCLKLLTFIPMDEVRRLSSLEGSQ---INEAKKVLAFEVTKLVHGEEEATKAQQAAE
SYY_FUSNN       DVEKCLALLTFLPMDEVRRLGALKDAE---INEAKKVLAYEVTKIIHGEEEATKAKEATE
SYY_CLOTE       DVEKCLALLTFLPMDEVRRLAALEGNK---INEAKKVLAYEVTKLIHGEDEAKKAEEASE
SYY_CALS4       DVEKALALLTFLPMDEVRRLGRLRDKE---INEAKKVLAFEVTKLVHGEEEALKAQKAAE
SYY_SYNAS       DVGKFLALFTFLPMEEIHQVKSLSDKE---LNMAKAILAFEATKITHGEDAALAAWNASA
SYY_MYCGE       SLKKTFLMLTMLDKKVIDELCNLKGPK---IKQTKQMLAFLITELIHGTKKAKEAQQRSE
SYY_MYCPN       SLQKVFLMLTKLDTKAIETLCNLKGAA---IKEAKAKLAFELTDAIHGTKAALVAQAKSA
SYY_MYCPE       DVERFLLLLTELDDKTISDLCKEKGKK---IVEAKKVLASELTKMIHGQEELDKAIEQSK
SYY_CHLAB       EVPKVARTLTLLSNEEIFDLDQKFLLD---PVAVKKFVAETLVTSIHGEDGLREAQVVTQ
SYY_CHLCV       EVPKIARTLTLLSNEEIFDLDKKFLSD---PIAVKKFVTETIVTSIHGEDGLKKAQMVTQ
SYY_CHLPN       TIPKIARTLTLLSNEEIQDIDRRVQTD---PVAVKEFVAQDILSAIHGDLGLEEALSVTR
SYY_CHLTA       EISKVMRTLTLLDNEEIFALDERLTSD---PQAVKKYIAEVIVKDVHGSEGLAQAQAATE
SYY_CHLTR       EISKVMRTLTLLDNEEIFALDERLTSD---PQAVKKYIAEVIVKDVHGSEGLAQAQAATE
SYY_CHLMU       EIPKIARMLTLLDDDEVLALDKRLEND---PQAVKRYVAEVIVKDVHGAEGLAQALATTE
SYY_PARUW       DVINLMRMLTFLDMGEIRHYEQMMKEADYVPRTAQKRLAEEITRLVHGEEGLKIAIKVTE
SYY_TROW8       DIPRLLRVFTFFTRSEIEDLNRSVRENAS-ARLAHRHLAYSVTRLVHGADVADQVLLACS
SYY_TROWT       DIPRLLRVFTFFTRSEIEDLNRSVRENAS-ARLAHRHLAYSVTRLVHGADVADQVLLACS
SYY_LEIXX       DVIARLKVFTFLHRDEIERLERAVAEEPF-RREAQRRLALDVTSLVHGAAAAEAVIAASE
SYY_BIFLO       EMESLLKAFTFLPKAEIERLVEESKTNPG-KREAQKTLAWEVTSFVHGEAATQAAIDASG
SYY_CORDI       VVIDYLRWFTFLTQEEIAELETEVRERPH-LRAAQRRLAQEMTDLVHGHDATVSVELAAQ
SYY_CORJK       VVIDYLRWFTFLSQEEIAELERKVAEEPF-KREAQRVLAREMTTLVHGAAATEAVELAAQ
SYY_COREF       DVIRYLRWFTFLTKEELDELEVEVAERPF-KREAQRRLAREMTNLVHGEEATAAVELAAQ
SYY_CORGL       DVIRYLRWFTFLTQEELAELEVEVAERPF-KREAQRRLAREMTNLVHGTEATEAVELAAQ
SYY_MYCBO       DVIRYLRWFTFLSADELAELEQATAQRPQ-QRAAQRRLASELTVLVHGEAATAAVEHASR
SYY_MYCTU       DVIRYLRWFTFLSADELAELEQATAQRPQ-QRAAQRRLASELTVLVHGEAATAAVEHASR
SYY_MYCPA       DVIRYLRWFTFLSADELGELERATAERPQ-QRAAQRRLARELTVLVHGEAATEAVKHASR
SYY_MYCLE       DVIRYLRWFTFLLPEELVELEQTTVSRPQ-ERAAQRRLATELTVLVHGAAATQAVEHASR
SYY_MYCFO       DVIGYLRWFTFLSADEIAELEDATQNRAH-ERAAQKRLARELTTLVHGEGATTAVELASQ
SYY_NOCFA       DVVRYLRWFTFLDREELAELERATAERPH-AREAQRRLAAEMTTLVHGEQHTRAVQLASQ
SYY_STRAW       DVSKFLRIFSFKSHEEIEELEKQTEERPQ-ARAAQRALAEELTTLVHGADQTAAVIAASK
SYY_STRCO       DISTYMRILSFRSRAELEELERQTEERPQ-ARAAQRALAEELTTLVHGAGQTAAVIAASK
SYY_THEFY       DIPRYLRIFSFRSREEIEELEQKTIERPA-ERAAQRALAEELTTLVHGEQECRNVIEASK
SYY_CUTAK       KVIEYLKIFSPRSREEIEDLARKTEEEPW-RRAAQHCLADDLTDLVHGVEQRKAAEAAAQ
SYY_BACFN       DAERYIKIFTSLDKAEIDGLIAEHNEAPH-LRVLQKRLAKEVTVMVHSEEDYNAAVDASN
SYY_BACFR       DAERYIKIFTSLDKAEIDGLVAEHNEAPH-LRVLQKRLAKEVTVMVHSEEDYNAAVDASN
SYY_BACTN       DAERYIKIFTSIEKEEIEALVAEHQQAPH-LRALQKRLAKEVTIMVHSEEDYNAAVDASN
SYY_PORGI       DAEKYIKIFTGLNQDEIAELASRQAEAPH-LRPLQKRLAEEITVMVHSREAYDAAVEASE
SYY_ANADE       DVERLLKFFTFLSLDEIAALLAEQARDPG-KRPAQRRLAEDVTARVHGPDVTRSVIEASR
SYY_RHOBA       DVMRCLAYLTEIERAEYDELEDKTKNDPG-QRTAQKRLAQWLTELVHGEAGVQSAQRATQ
SYY1_BACAN      DVVKYLKYFTFLSHEEILELE-KQVAEAPEKRAAQKALGAEMTKLVHGEEALEQAIKISA
SYY1_BACHK      DVVKYLKYFTFLSHEEILELE-KQVAEAPEKRAAQKALGAEMTKLVHGEEALEQAIKISA
SYY1_BACCZ      DVVKYLKYFTFLSHEEILELE-KQVAEAPEKRAAQKALGAEMTKLVHGEEALEQAIKISA
SYY1_BACC1      DVVKYLKYFTFLSHEEILELE-KQVAEAPEKRAAQKALGAEMTKLVHGEEALEQAIKISA
SYY1_BACCR      DVVKYLKYFTFLSHEEILELE-KQVAEAPEKRAAQKALGSEMTKLVHGEEALEQAIKISA
SYY1_BACLD      DVVKYLKYFTFLSKEEIEDLA-EKTETAPEKREAQKRLAEEVTVLVHGREAFEQAVNISK
SYY1_BACSU      DVVKYLKYFTFLSKEEIEAYA-EKTETAPEKREAQKRLAEEVTSLVHGREALEQAINISQ
SYY_BACCA       DVIRYLKYFTFLSKEEIEALE-QELREAPEKRAAQKALAEEVTKLVHGEEALRQAIRISE
SYY_GEOKA       DVIRYLKYFTFLSKEEIEALE-QELREAPEKRAAQKALAEEVTKLVHGEEALRQAIRISE
SYY_GEOSE       DVIRYLKYFTFLSKEEIEALE-QELREAPEKRAAQKTLAEEVTKLVHGEEALRQAIRISE
SYY2_ENTFA      DVVKFLKYFTFLTLDEIATIE-EEFTANPGQRAAQKALAKEVTTLVHGEAAYHQAVKISE
SYY_OCEIH       DVIRFIRYFTFLSVEEITELE-KEVETQPEKRVAQKRLAEEMTKTVHDEAALEQAKRITN
SYY2_BACAN      DVVKYLKYFTFLTKERIDELA-VKVETEPHKREAQKVLAEEMTKFVHGEEALLQAVKITA
SYY2_BACHK      DVVKYLKYFTFLTKERIDELA-VKVETEPHKREAQKVLAEEMTKFVHGEEALLQAVKITA
SYY2_BACCZ      DVVKYLKYFTFLTKERIDELA-VKVETEPHKREAQKVLAEEMTKFVHGEEALLQAVKITA
SYY2_BACC1      DVVKYLKYFTFLTKERIDELA-VKVETEPHKREAQKVLAEEMTKFVHGEEALLQAVKITE
SYY2_BACCR      DVIKYLKYFTFLTKERIDELA-TKVEVEPHKREAQKVLAEEMTKFVHGEEAFLQAEKITA
SYY_LISMF       DVVKYLKYFTFLTEAEIDELA-KQVETEPHLRAAQKTLAAEMTKFVHSEEALEQALKISK
SYY_LISMO       DVVKYLKYFTFLTEAEIDELA-KQVETEPHLRAAQKTLAAEMTKFVHSEEALEQALKISK
SYY_LISIN       DVVKYLKYFTFLTEAEIDELA-KQVEEEPHLRAAQKTLAAEMTKFVHSEEALEQALKISK
SYY_LACBR       DVIRYLKFFTFLGQDEINQLA-AAVEDEPEKRLAQRRLAEEVTRFVHGEEALESAQHISE
SYY_LACSS       DVVKYLKYFTFLDEAEINELA-KTVETAPEKREAQRRLAEEVTRFVHGQAELEGAQKITE
SYY1_ENTFA      DVIKYLKFFTFLDKEEIDALA-EKVEKEPGKREAQRRLAEEVTRFVHDDAALEEAQKISE
SYY_LACPL       DVVKYLKYFTFLSHEEIDRLA-ETVKTAPEKREAQRRLAEEVTEFVHGKQAVVEAENITK
SYY_LACAC       DVVKYLKYFTFLSHEEIEDLA-EKTEKEPWKRAAQKKLAEEVTKFVHGEEGLKEAQMITD
SYY_LACJO       DVVKYLKYFTFLSREEIEDLA-EKTEKEPWKRAAQKRLAEEVTKFVHGEEGLKEAQIITE
SYY_STAA3       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAW       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAR       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAS       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAM       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAN       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAB       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAAC       DVIKFLKYFTFLGKEEIDRLE-QSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQ
SYY_STAEQ       DVIKFLKYFTFLEKEEINRLE-QSKNEAPHLREAQKALAENVTKFIHGEAALKDAIRISK
SYY_STAES       DVIKFLKYFTFLEKEEINRLE-QSKNEAPHLREAQKALAENVTKFIHGEAALKDAIRISK
SYY_STAHJ       DVIKFLKYFTFLDKDEINRLE-ESKNQEPHLREAQKALAENVTEFIHGKEALDDAIRISK
SYY_STAS1       DVIKFLKYFTFLEQEEIEALE-KSLNEAPHLREAQKALAENVTRFIHGQDALDDAIRISQ
SYY_STRA3       DAVRFLKIFTFLSLKEIEDIR-IQFEEAPHQRLAQKTLAREVVTLVHGEKAYKEAVNITE
SYY_STRA5       DAVRFLKIFTFLSLKEIEDIR-IQFEEAPHQRLAQKTLAREVVTLVHGEKAYKEAVNITE
SYY_STRA1       DAVRFLKIFTFLSLKEIEDIR-IQFEEAPHQRLAQKTLAREVVTLVHGEKAYKEAVNITE
SYY_STRPN       DAVRFLKIFTFLSLDEIEDIR-KQFEAAPHERLAQKVLAREVVTLVHGEEAYKEALNITE
SYY_STRR6       DAVRFLKIFTFLSLDEIEDIR-KQFEAAPHERLAQKVLAREVVTLVHGEEAYKEALNITE
SYY_STRP3       DAVRFLKIFTFLSLDEIAEIE-SQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITE
SYY_STRP8       DAVRFLKIFTFLSLDEIAEIE-SEFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITE
SYY_STRP6       DAVRFLKIFTFLSLDEIAEIE-TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITE
SYY_STRPM       DAVRFLKIFTFLFLDEIAEIE-TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITE
SYY_STRP1       DAVRFLKIFTFLSLDEIAEIE-TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITE
SYY1_STRT1      DAVRFLKIFTFLSLEEIEEIG-KEFDQARHQRLAQKVLAREVVTLVHGKEAYEQAVHITE
SYY1_STRT2      DAVRFLKIFTFLSLEEIEEIG-KEFDQARHQRLAQKVLAREVVTLVHGKEAYEQAVHITE
SYY_STRMU       DAIRFLKIFTFLSLDEIEDIR-VKFEAAPHERLAQKILAKEVVTFVHGQTAYQEAVKITE
SYY_LACLA       DAVKMLKIFTFLSLEEIAEIE-EQFEAARHERLAQKVLAREVVSLVHGKAAYEQAVKTSE
SYY_BLOPB       EVYRFLKFFTNIDVDAINTLK-KEDKMKNTKPQAQIILAEEITRLVHGKSGLKTAQKITR
SYY_BLOFL       SAYHFLKIFTDISVQDINSFK-NRD---HSYSQAQYILAENMTQLVHGKRGLNIAQRISQ
SYY_BUCAI       NVYYFLKLFTFIKVSEINKLE-KNKNIKNQIINDKSLLAKHITQLVHGKEKLLAAERITK
SYY_BUCAP       NVYRFLKLFTFIDIHEINERE-KNSYKKNQIVSDKVLLAKHMTRLVHGDEKLSAAERITN
SYY_BUCBP       DIYSFLKMFTFLSLSEIKAL--KDTTKPTELNSVKKILAEYLTNLVHGSNEVRAIQRITS
SYY_WIGBR       KIFRYLKLFTFISMSEINKLKCKFFNKEINPFQAQKILADEITKIVHGISQLRLAQKATN
SYY_CHRVO       DVYKFLRYFSFLSVDEIASIE-EADKSREGKPEGQRILAEQVTELVHGKAALEAAQRITH
SYY_DECAR       DVYKFMNFFTFLPVARIAEIE-AADKASGTKPEAQRILAEEATRLVHGEVALMAARRITE
SYY_NEIMA       DVYKFLKYFTFLSIEEIDAIE-AKDKASGTKPEAQRILAEEMTRLIHGEAALQAAQRISE
SYY_NEIMB       DVYKFLKYFTFLSIEEIDAIE-AKDKASGSKPEAQRILAEEMTRLIHGEEALAAAQRISE
SYY_NEIG1       DVYKFLKYFTFLSIEEIGVVE-AKDKASGSKPEAQRILAEEMTRLIHGEEALAAAQRISE
SYY_ECOLI       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITE
SYY_SHISS       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITE
SYY_ECO57       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITE
SYY_SHIDS       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITE
SYY_ECOL6       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEDGLQAAKRITE
SYY_SHIBS       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITE
SYY_SHIFL       DVYRFLKFFTFMSIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITE
SYY_SALCH       DVYRFLKFFTFMDIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLVAAKRITE
SYY_SALPA       DVYRFLKFFTFMDIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLVAAKRITE
SYY_SALTI       DVYRFLKFFTFMDIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLVAAKRITE
SYY_SALTY       DVYRFLKFFTFMDIEEINALE-EEDKNSGKAPRAQYVLAEQVTRLVHGEEGLVAAKRITE
SYY_PECAS       DVYRFLKFFTFMSLENIDALE-EEDKNSGKAPRAQYVLAEDVTRMVHGEAGLEAARRITQ
SYY1_PHOLL      DVYRFLKFFTFMNLEDIDALE-EEDKNSGKAPRAQYVLAEQVTGMVHGEEGLAAAKRITE
SYY_YERPE       DVYRFLKFFTFMSLEEINALE-EEDKNSGKAPRAQYVLAENVTGMVHGPEGLAAAKRITD
SYY_YERPS       DVYRFLKFFTFMSLEEINALE-EEDKNSGKAPRAQYVLAENVTGMVHGPEGLAAAKRITE
SYY_SODGM       DVYLFLKFFTFLDLAAIDALE-QEDRASDKAPRAQYVLAEEVTRMVHGEQGLAAAKRITA
SYY_VIBF1       DVYNFLRFFTFLTVEEIAAVE-ESDKSVQGRPEGQGILAREVTRLVHGEEGLASAERITK
SYY1_PSEHT      DVYNFLRFYTFLSVKEIEAIE-ANDITSQQKPQAQGILAEQLTRFVHGEQGLASAQRITQ
SYY1_VIBPA      DVYHFLRYYTFLSCEEIASIE-AQDQASQGKPQAQRILAEEMTRFVHGEEGLASAERITQ
SYY1_VIBVU      DVYRFLRYYTFLSVEQIEQLE-ATDKAQVGKPSAQRILAEEMTRFVHGQAGLESAQRISQ
SYY1_VIBVY      DVYRFLRYYTFLSVEQIEQIE-ATDKAQVGKPSAQRILAEEMTRFVHGHAGLESAQRISQ
SYY1_VIBCH      DVYRFLAYYTFLSTAEIEEIR-QADALRAGKPQAQQILAEHVTRFVHGEEGLAAAQRITQ
SYY_MYCCT       DSINLLKCLTF-LTKDQIEQLIKQHNQQPAKHFLQKALASEMTKFVHQQQGLDKALKLTE
SYY_MYCMS       DSINLLKCLTF-LTKEQIDNLIKEHQNQSSKHLLQKALASEMTKFVHQQQGLDKALKLTE
SYY_MESFL       DCVKMLKYLTF-LTKEEIDELEAKHKEAPHLRTMQKTLASEITKFVHGDKELNKAIKLTD
SYY_MYCGA       FIIDLIHRYVLDQSLEQLQELIEAHLANKKTRIAQKFLADYLVKFIHSQEHLDTVHKMNK
SYY_UREPA       DVEKLLNFLTL-IDVEEIKKIMQAHKNNPALRVAQKALAKAVVVDIHGQQKYEQALHISE
SYY_MYCMO       DLLNLFNFISD-LGIKEILEIITKHSENPEKRYGQKMLANNIVNRIHGKNALNEVENISN
SYY_MYCH2       QAEKIMLWLSF-LDLKVINELIFKHKNDKKQRILQYNLAQEVVFNIHGDKGLKIAKKITK
SYY_MYCHJ       QAEKIMLWLSF-LDLKVINELIFKHKNDKKQRILQYNLAQEVVFNIHGDKGLKIAKKITK
SYY_MYCH7       QAEKIMLWLSF-LDLKVINELIFKHKKDKKQRILQYNLAKQVVFDIHGDKGLEIAKKITK
SYY_MYCS5       EVEKLLKWLTF-LEISEIKDLVNKHNKNPKDRLAQKALAYEVIKDIHGKSAAENCTFLSE
SYY_MYCPU       DAYNLLLQLTF-LQLSEIERIKNEHLKNPKLRLMQSRLSFEVVKDIHGKEEAQRALHIST
                                                  :  :        :             

SYY_AYWBP       ILFSNAK--------------KESFQEKDFILLQKT------------------------
SYY_ONYPE       ILFSNAK--------------KESFQEKDFILLQKT------------------------
SYY_AGRFC       KTFEE------------------GALAENLPSI---------------------------
SYY_RHIME       KTFEE------------------GALAENLPSV---------------------------
SYY_BRUA2       KTFED------------------GELSENLPTV---------------------------
SYY_BRUAB       KTFED------------------GELSENLPTV---------------------------
SYY_BRUME       KTFED------------------GELSENLPTV---------------------------
SYY_BRUSU       KTFED------------------GELSENLPTV---------------------------
SYY_RHILO       KTFEE------------------GALADTLPTV---------------------------
SYY_BARHE       KTFEE------------------RTLGENLPTF---------------------------
SYY_BARQU       KTFEE------------------KTFGENLPTI---------------------------
SYY_NITWN       TTFEQ------------------GAISESLPTL---------------------------
SYY_RHOPA       TTFEQ------------------GGTAQDLPSV---------------------------
SYY_BRADU       RTFEE------------------GALAESLPTV---------------------------
SYY_MAGSA       QTFEQ------------------GVASSDLPTV---------------------------
SYY_RHORT       KVFEQ------------------GGTGDALPTH---------------------------
SYY_CAUVC       KAFEQ------------------GALSADLPTY---------------------------
SYY_NOVAD       ATFAG------------------GGLGQDLPTL---------------------------
SYY_ZYMMO       KTFEE------------------GAAGDALPVM---------------------------
SYY_RHOS4       AVFEE------------------GGVGGALEVV---------------------------
SYY_RUEPO       EVFEK------------------GGIGDDLPTL---------------------------
SYY_GLUOX       RVFEQ------------------GSAQAALPEI---------------------------
SYY1_PSEAE      GVFAD------------------GTRDSGLPVM---------------------------
SYY_EHRRG       KVFEC------------------ND-HSGLPVF---------------------------
SYY_EHRRW       KVFEC------------------ND-HSGLPVF---------------------------
SYY_EHRCJ       KVFEC------------------ND-DSGLSTF---------------------------
SYY_ANAMM       QVFEH------------------ND-DAGLPHF---------------------------
SYY_WOLPM       SAFEN------------------ED-SSLLPDY---------------------------
SYY_WOLTR       SVFEN------------------GD-SSLLPDY---------------------------
SYY_RICCN       KIFEE------------------GQIDENLPTV---------------------------
SYY_RICFE       KIFEE------------------GQIDENLPIV---------------------------
SYY_RICPR       KIFEQ------------------GDIDENLHTF---------------------------
SYY_RICTY       RIFEQ------------------GDIDENLHTF---------------------------
SYY_PELUB       QTFSE------------------NSLGDNLPTT---------------------------
SYY_BORBU       AAFRG------------------SGDRSNIPFF---------------------------
SYY_BORBP       AAFRG------------------SGDRSNIPFF---------------------------
SYY_TREDE       AAFSG------------------GGNKDAMPTA---------------------------
SYY_TREPA       AAFGG------------------CGDKCALPTF---------------------------
SYY1_CLOAB      ALFGG------------------GTNMDNVPTV---------------------------
SYY_CLOPE       ALFGK------------------GGDMSNVPTY---------------------------
SYY_FUSNN       ALFGS------------------GNNLDNAPKI---------------------------
SYY_CLOTE       ALFGA------------------GKDMSNVPTV---------------------------
SYY_CALS4       ALFEG------------------GGEMEHVPSI---------------------------
SYY_SYNAS       VAFGVKLIDTSLMPSSTIPRGQLSQDASAIPFI---------------------------
SYY_MYCGE       LIFSN--------------------QPD--------------------------------
SYY_MYCPN       RIFAF--------------------QPD--------------------------------
SYY_MYCPE       AAFEN--------------------ASDNLPTY---------------------------
SYY_CHLAB       SIHPGK-----------------VSSVSEKDFQ---------------------------
SYY_CHLCV       SMHPGK-----------------VSSISEKDFQ---------------------------
SYY_CHLPN       SMHPGN-----------------LSSLSEKDFH---------------------------
SYY_CHLTA       SFFASK-----------------GKSITEAELV---------------------------
SYY_CHLTR       SFFASK-----------------GKSITEAELV---------------------------
SYY_CHLMU       SFFANK-----------------GKNITESELA---------------------------
SYY_PARUW       GVAPGS-----------------QTSLNADILE---------------------------
SYY_TROW8       VLFGDGGALG------KTQTGLPRIDSDTLNDSSGVTTIKAQDNTYTPYSPEGVRFAGTF
SYY_TROWT       VLFGDGGALG------KTQTGLPRIDSDTLNDSSGVTTIKAQDNTYTPYSPEGVRFAGTF
SYY_LEIXX       ALFGRGG-------------DLAQQDTDTLA-----------------------------
SYY_BIFLO       ALFGRGG-------------NLEDIDEEMLESV---------------------------
SYY_CORDI       ALFGRAS--------------LQDLDEATLDGA---------------------------
SYY_CORJK       ALFGKAE--------------LQDLDEPTLASA---------------------------
SYY_COREF       ALFGRAE--------------LRDLDEKTLEAS---------------------------
SYY_CORGL       ALFGRAE--------------LRDLDEKTLAAS---------------------------
SYY_MYCBO       ALFGRGE--------------LARLDEATLAAA---------------------------
SYY_MYCTU       ALFGRGE--------------LARLDEATLAAA---------------------------
SYY_MYCPA       ALFGQGE--------------LERLDAATLAAA---------------------------
SYY_MYCLE       ALFGQGE--------------LARLDEATLATA---------------------------
SYY_MYCFO       ALFGRAE--------------LADLDESTLGAA---------------------------
SYY_NOCFA       ALFGRGD--------------LRELDEATLGAA---------------------------
SYY_STRAW       ALFGQGE--------------LTELDEATLAAA---------------------------
SYY_STRCO       ALFGQGE--------------LAELDEATLAAA---------------------------
SYY_THEFY       ALFGHGT--------------LADLNPDTLGAA---------------------------
SYY_CUTAK       AIFGRGE--------------LRDLDERTVLSL---------------------------
SYY_BACFN       ILFGNATS-----------DALKKLDEDTLLAV---------------------------
SYY_BACFR       ILFGNATS-----------DALKKLDEDTLLAV---------------------------
SYY_BACTN       ILFGNATS-----------ESLRKLDEDTLLAV---------------------------
SYY_PORGI       ILFGKSTT-----------EQLRKLDEATLLDV---------------------------
SYY_ANADE       ILFGGT--------------DLRAAGVDVLDVL---------------------------
SYY_RHOBA       ILFGGE---------------LGDTTDSQLREI---------------------------
SYY1_BACAN      ALFSG---------------SVAELTASEIEQGFKD------------------------
SYY1_BACHK      ALFSG---------------SVAELTASEIEQGFKD------------------------
SYY1_BACCZ      ALFSG---------------SVAELTASEIEQGFKD------------------------
SYY1_BACC1      ALFSG---------------SVAELTASEIEQGFKD------------------------
SYY1_BACCR      ALFSG---------------SVAELTASEIEQGFKD------------------------
SYY1_BACLD      ALFSG---------------DIKQLTAEEVKVGFKG------------------------
SYY1_BACSU      ALFSG---------------NIKELSAQDVKVGFKD------------------------
SYY_BACCA       ALFSG---------------DIANLTAAEIEQGFKD------------------------
SYY_GEOKA       ALFSG---------------DIANLTAAEIEQGFKD------------------------
SYY_GEOSE       ALFSG---------------DIANLTAAEIEQGFKD------------------------
SYY2_ENTFA      ALFSG---------------DIQSLTAEEIKQGFKD------------------------
SYY_OCEIH       ALFSG---------------DIKQLNVEEVEQAFKD------------------------
SYY2_BACAN      ALFSG---------------DIKSLTADEIEQGFKE------------------------
SYY2_BACHK      ALFSG---------------DIKSLTADEIEQGFKE------------------------
SYY2_BACCZ      ALFSG---------------DIKSLTADEIEQGFKE------------------------
SYY2_BACC1      ALFSG---------------DIKSLTADEIEQGFKE------------------------
SYY2_BACCR      ALFSG---------------DIKSLTADEIEQGFKE------------------------
SYY_LISMF       ALFSG---------------DVKALTADEIEQGFKD------------------------
SYY_LISMO       ALFSG---------------DVKALTADEIEQGFKD------------------------
SYY_LISIN       ALFSG---------------DVTALTADEIEQGFKD------------------------
SYY_LACBR       ILFSG---------------DIQRLTLTEVQEAFEK------------------------
SYY_LACSS       VLFSG---------------DIKALDVKEAEQAFQK------------------------
SYY1_ENTFA      ALFSG---------------NIKDLTIEEIEQGLEH------------------------
SYY_LACPL       ALFTG---------------DVQSLTADEIEQGFKG------------------------
SYY_LACAC       ALFSG---------------DIKNLSVTQIEQGLKN------------------------
SYY_LACJO       ALFSG---------------NVKSLSVPQIEQALKN------------------------
SYY_STAA3       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAW       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAR       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAS       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAM       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAN       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAB       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAAC       ALFSG---------------DLKSLSAKELKDGFKD------------------------
SYY_STAEQ       ALFSG---------------DLKSLSAKELKEGFKD------------------------
SYY_STAES       ALFSG---------------DLKSLSAKELKEGFKD------------------------
SYY_STAHJ       ALFSG---------------DLKSLSGKELKEGFKD------------------------
SYY_STAS1       ALFAG---------------DLQSLSASELKEGFKD------------------------
SYY_STRA3       QLFAG---------------NIKGLSVKELKQGLRG------------------------
SYY_STRA5       QLFAG---------------NIKGLSVKELKQGLRG------------------------
SYY_STRA1       QLFAG---------------NIKGLSVKELKQGLRG------------------------
SYY_STRPN       QLFAG---------------NIKNLSVKELKQGLRG------------------------
SYY_STRR6       QLFAG---------------NIKNLSVKELKQGLRG------------------------
SYY_STRP3       QLFAG---------------NIKNLSANELKQGLSN------------------------
SYY_STRP8       QLFAG---------------NIKNLSANELKQGLSN------------------------
SYY_STRP6       QLFAG---------------NIKNLSANELKQGLSN------------------------
SYY_STRPM       QLFAG---------------NIKNLSANELKQGLSN------------------------
SYY_STRP1       QLFAG---------------NIKNLSANELKQGLSN------------------------
SYY1_STRT1      QLFAG---------------NLKALSARDLKVALNG------------------------
SYY1_STRT2      QLFAG---------------NLKALSARDLKVALNG------------------------
SYY_STRMU       QLFAG---------------HIKSLSAKELKQGLSN------------------------
SYY_LACLA       ILFGGG--------------DLRQLDAKSILTGLKA------------------------
SYY_BLOPB       NLFTG---------------QIHKLTLDDFEQLFQD------------------------
SYY_BLOFL       NLFSY---------------NILKLTLNDFHQLIQD------------------------
SYY_BUCAI       FLFLK---------------NTTHIEESDLQQLKQD------------------------
SYY_BUCAP       ILFFK---------------NINDIQISDLEQLRKD------------------------
SYY_BUCBP       SLFSG---------------KFSEMKETDFFQLEQD------------------------
SYY_WIGBR       FLFYK---------------KISELSIEDFYLLSTS------------------------
SYY_CHRVO       SLFSN---------------DLTNLTADDFAQLAQD------------------------
SYY_DECAR       CLFSG---------------QLADLTENDLEQLAQD------------------------
SYY_NEIMA       SLFAE---------------DQSSLTESDFEQLALD------------------------
SYY_NEIMB       SLFAE---------------DQSSLTESDFEQLALD------------------------
SYY_NEIG1       SLFAE---------------DQSRLTESDFEQLALD------------------------
SYY_ECOLI       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SHISS       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_ECO57       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SHIDS       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_ECOL6       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SHIBS       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SHIFL       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SALCH       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SALPA       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SALTI       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_SALTY       CLFSG---------------SLSALSEADFEQLAQD------------------------
SYY_PECAS       SLFSG---------------ALQDMTQDDFAQLAQD------------------------
SYY1_PHOLL      SLFSG---------------AAADLTEADFAQLAQD------------------------
SYY_YERPE       SLFSG---------------DLHDMTEADFAQLAQD------------------------
SYY_YERPS       SLFSG---------------DLHDMTEADFAQLAQD------------------------
SYY_SODGM       SLFSG---------------ALADLTEDDFAQLAQD------------------------
SYY_VIBF1       ALFSG---------------DLSSLTETDLAQLALD------------------------
SYY1_PSEHT      LLFNG---------------QVQTLTLAELEQLEQD------------------------
SYY1_VIBPA      ALFSG---------------NVQQLSLGELKQLELD------------------------
SYY1_VIBVU      ALFSG---------------QLNQLNLAELKQLEQD------------------------
SYY1_VIBVY      ALFSG---------------QLNQLNLAELKQLEQD------------------------
SYY1_VIBCH      ALFSG---------------DVSYLSLSELAQLELD------------------------
SYY_MYCCT       AFFS---------------GDLFSLTDDLFKMALNS------------------------
SYY_MYCMS       AFFS---------------GDLFSLTNDLFKMALNS------------------------
SYY_MESFL       AFFT---------------GNILNLDDDLLELAIKS------------------------
SYY_MYCGA       ALF---------------DNQLDQLSDQEKLVVFAS------------------------
SYY_UREPA       VLF---------------NGSISTLNQEELEIAIKS------------------------
SYY_MYCMO       ILFK--------------NGKINDLSKSEVSIIINS------------------------
SYY_MYCH2       ILFE--------------KLDYTEITFKDKLELKKI------------------------
SYY_MYCHJ       ILFE--------------KLDYTEITFKDKLELKKI------------------------
SYY_MYCH7       ILFE--------------KLDYTKITFNDKLELKKI------------------------
SYY_MYCS5       MLFNL-------------SLDLSKVTLENMEFAYNQ------------------------
SYY_MYCPU       SLFKE-------------KNSWFNLSLEDLIQLKGS------------------------
                                                                            

SYY_AYWBP       -------------LFCHSIKEDILLVDALVQ--------TKLATSKSEAREFIKDNTIKL
SYY_ONYPE       -------------LFCHSTKEDILLVDALVQ--------TKLATSKSEAREFIKDNTIKL
SYY_AGRFC       ------------EVPTSELDAGVGVLSLIV--------RAGLASSNGEARRHVQGGAVKI
SYY_RHIME       ------------EVPAPELESGLGLLTLLV--------RAGLAASNGEARRHVQGGAVRI
SYY_BRUA2       ------------GVHKATLNDGIGVLALMV--------LAELCTTNGEARRHVEGGAVRI
SYY_BRUAB       ------------GVHKATLNDGIGVLALMV--------LAELCTTNGEARRHVEGGAVRI
SYY_BRUME       ------------GVHKATLNDGIGVLALMV--------LAELCTTNGEARRHVEGGAVRI
SYY_BRUSU       ------------GVHKATLNDGIGVLALMV--------LAELCTTNGEARRHVEGGAVRI
SYY_RHILO       ------------GADKAALEAGIGILSLLV--------TAGLASSNGEARRHIQGGAVRI
SYY_BARHE       ------------EINANDLKMGTGLLILLV--------QAGLSKSNSEARRHIQGGGVRV
SYY_BARQU       ------------EINASDLKTGAGLLALLV--------QAGLAKSNSEARRHIQGGGIRV
SYY_NITWN       ------------DIPRSELASGAGVLALFV--------KAGLVASNGEARRQIKGGGLRV
SYY_RHOPA       ------------EISRGELDAGIGVLVAFAE-------KTGLVASNGEARRQIKAGGLKV
SYY_BRADU       ------------EIPRGELDAGFGVLNAFV--------KAGLVASNGEARRQIKGGGLRV
SYY_MAGSA       ------------EIPAAELAAGIPAFALFV--------RAGLAASNGEARRLLKGGGGKV
SYY_RHORT       ------------DVAAEALAAGLPLAEMMR--------ATGLAASGKEVKRLVSEGGARI
SYY_CAUVC       ------------EIAAADLDAGVVLAALFA--------DAGLAGSRGEARRLAQGGGLKV
SYY_NOVAD       ------------SVG----ESEIGIVDALV--------GLGFAASRGEAKRLVAGGGARV
SYY_ZYMMO       ------------KVS----DSSISLVDALV--------GLGLVASKAEARRMIRGGGARI
SYY_RHOS4       ------------ELPAATLGEGLSVAHFLV--------AAGLVASGKEAKRLVAENGLRF
SYY_RUEPO       ------------TLGAADLPA--SIVQLIV--------KTGLAKSGKEAKRLIAEDGARL
SYY_GLUOX       ------------DLPANLIAEGLPAFRVFQ--------EAGLAASGGEARRLIRGGGGRV
SYY1_PSEAE      ------------KLSRARLAQGLSLTDLLL--------EHAIQPSRSAVRRLAAGGGLRL
SYY_EHRRG       ------------YVCKSEIELGLSVVKLLQ--------VSGMEKSNSSAKRLINDKGCKI
SYY_EHRRW       ------------YVCKSEIELGLSVVKLLQ--------VSGMEKSNSSAKRLINDKGCKI
SYY_EHRCJ       ------------YVDRCDVDLGLPIIKLLQ--------ISGLEKSSSSARRLINDKGCKI
SYY_ANAMM       ------------PLHKSLIAQGISVAKLLQ--------LAGLEESISAGRRLIKGRGCKI
SYY_WOLPM       ------------IIKKEQVASGISLVDLLH--------DTGFEPSKGAAKRLIQGNGCKI
SYY_WOLTR       ------------TITKKQVANGISLIDLLH--------DIGLEPSKGAAKRLIQGNGCKV
SYY_RICCN       ------------VLEQEVLQAGISAYELFH--------EAGLATSKSEARKLIRGNGAKI
SYY_RICFE       ------------VLEQEVLQAGISAYELFH--------EAGLASSKSEARKLIRGKGAKI
SYY_RICPR       ------------ILAPEILQSGISAYNLFY--------NANLARSKSEARKIIRGKGAKI
SYY_RICTY       ------------ILAPEILQAGISAYKLFY--------NVNLARSKSEARKIIRGKGAKI
SYY_PELUB       ------------QINKKMLDDNISILDLVI--------LSKLESSKSEIRRLIKGNGIKI
SYY_BORBU       ------------KFSFSSLKEEILLVDLML--------DSKIVPSKSEGRRLIDSGGVYI
SYY_BORBP       ------------KFSFSGLEEEILLIDLML--------DSKIVPSKSEGRRLINSGGVYI
SYY_TREDE       ------------NLSLSKLNEGIGIIDLFA--------EAGLASTKSDARRLVEQGGAFI
SYY_TREPA       ------------ELTQCTLQVGIKVTDLFV--------QVGLCTTKSDARRLIAQGGAFV
SYY1_CLOAB      ------------SIPEDMLSSSI--LDVLV--------HTKIIPSKGEGRRLVQQGGITL
SYY_CLOPE       ------------EMGKDKLGAEL--LDILV--------EAEIVPSKAEGKRLVKQGGLSL
SYY_FUSNN       ------------EVTDEDFSKEL--LDVLV--------DRKIIKTKSEGRRLIEQNGMSL
SYY_CLOTE       ------------NISKDDLGKGI--LDILV--------ETKILPSKGEARRLIQQGGLSI
SYY_CALS4       ------------EVSQDIIGRKI--VDVLF--------EAKVIPSKSEGRRLIQQGGLYI
SYY_SYNAS       ------------KKSWNELAKGIPAYEIMH--------ECGLCSSKSEARRLIAQGGGYV
SYY_MYCGE       -------------LDIKLVKTSTNLIDYLV--------ETKFIKSKSEARRLISQKGLTI
SYY_MYCPN       -------------TETKTVRAGTRLVDVIV--------DLGLVVSRSEARRVIQQGGLTI
SYY_MYCPE       ------------ELKASDLNNDYSIANILV--------VTKLSPSKAESRRLITSNAVSV
SYY_CHLAB       ------------DLVAMGQAVSLEGTQALGKRWIDLFVALGVCSSKGEARRLIEQKGLYV
SYY_CHLCV       ------------DLISMGQGISLDRVQTLGKRWIDLFVGVGFCNSKGEARRLIEQKGLYV
SYY_CHLPN       ------------ELFAGGMGASLDKSEVLGKRWLDLFLVLGLCKSKGEIRRLIEQKGVYI
SYY_CHLTA       ------------ALVESGVGVKVARTDLIGKRWLDIVVELGFCSSRGQARRLIQQRGLYI
SYY_CHLTR       ------------ALVESGVGVKVARADLIGKRWLDIVVELGFCSSRGQARRLIQQRGLYI
SYY_CHLMU       ------------ALVQSGVGINVARADVIGKRWLDVVVQLGFCSSKGEARRLIQQRGLYV
SYY_PARUW       ------------KLAADMPSCEMKLENVLNKKLIDLLVETKLQTSKSEARRLLRNGGVYI
SYY_TROW8       PVDPRFLRSILFELPNATVSAHDLITHILQ--------KVGLCRSLSEARRLISQGGIYV
SYY_TROWT       PVDPRFLRSILFELPNATVSAHDLITHILQ--------KVGLCRSLSEARRLISQGGIYV
SYY_LEIXX       --------SALRELPHTVSAPGVAIAQALV--------DTGLTKSLSEARRAVAQGGVSA
SYY_BIFLO       -LDGFKVVDENGEHVFPVSKPGDRVIDAAQ--------AAGLFKSASEARRAIKSGGVYL
SYY_CORDI       ----LSETV----IFEVPAGESPTIIDLLI--------GAGLVDSKGAARRTIKEGGAYV
SYY_CORJK       ----LQETE----VAEVGA--DATILDLLV--------ESGLEKSKGAARRTVGEGGAYV
SYY_COREF       ----VSETE----VAEIQPGEPRTIVDLLI--------ASGLVDSRGAARRTISEGGAYV
SYY_CORGL       ----VSETA----VAEIKAGEPRTIIDLLV--------ASGLADSKGAAKRAVKEGGAYV
SYY_MYCBO       ----LRETT----VAELKPGSPDGIVDLLV--------ASGLSASKGAARRTIHEGGVSV
SYY_MYCTU       ----LRETT----VAELKPGSPDGIVDLLV--------ASGLSASKGAARRTIHEGGVSV
SYY_MYCPA       ----LRETS----VAELKPGAPDGIVDLLV--------ASGLSESRKAARRTLGEGGVSV
SYY_MYCLE       ----LRETV----VAELKPGNPDGIVDLLV--------ASGLSPSRGAARRTIDEGGVLV
SYY_MYCFO       ----LREASN-GQVAELKPGGPDSIVDLLV--------ETGLAASKGAARRNVAEGGVYV
SYY_NOCFA       ----LREAAGEGEVARVTPGEPATIVDLLV--------ATGLAESRGAARRTVNEGGAAV
SYY_STRAW       ----LSELP--HVK----VAEPAPVVDLFA--------EVALVASKSAARRTIKEGGAYV
SYY_STRCO       ----LSELP--HVR----VAEPAPVVDLFA--------EVGLVASKSAARRTVKEGGAYV
SYY_THEFY       ----LKEVP--HVELSGTVRELPPLVDLFA--------STGLVPSKSAARRTIQEGGAYL
SYY_CUTAK       ----SDELG--AAHHE--GGEYPTVVGAMV--------AAGVVDTKSGGRRAVAEGGAYL
SYY_BACFN       ----FEGVPQFEISRDALAEGVKAVDLFVD--------NAAVFASKGEMRKLVQGGGVSL
SYY_BACFR       ----FEGVPQFEISRDALVEGVKAVDLFVD--------NAAVFASKGEMRKLVQGGGVSL
SYY_BACTN       ----FEGVPQFEISRDALAEGVKAVDLFVD--------NAAVFASKGEMRKLVQGGGVSL
SYY_PORGI       ----FAGVPQYHVERSRIATGISLVDLLAD--------ATDIFPSKGELRKTVKAGGVSL
SYY_ANADE       ----AGEIPSATVTGDELA-ALTVADLLV---------KVGLAASKGEVRRGVAGRGFSL
SYY_RHOBA       ----FADVPSCDVPKSALEGEGLWIVEALQ--------TAKLCNSGGDARRALSEGGVYV
SYY1_BACAN      -----------VPSVE-RTAEDTVLIDLLVE--------SKISPSKRQAREDVTNGAIYV
SYY1_BACHK      -----------VPSVE-RTAEDTVLIDLLVE--------SKISPSKRQAREDVTNGAIYV
SYY1_BACCZ      -----------VPSVE-RTAEDTVLIDLLVE--------SKISPSKRQAREDVTNGAIYV
SYY1_BACC1      -----------VPSVE-RTAEDTVLIDLLVE--------SKISPSKRQAREDVTNGAIYV
SYY1_BACCR      -----------VPSVE-RTAEDTVLIDLLVE--------SKISPSKRQAREDVTNGAIYV
SYY1_BACLD      -----------VPSLEVEKADELPLVEILVQ--------SKLSPSKRQAREDITNGAVYV
SYY1_BACSU      -----------VPSMEVDSTQELSLVDVLVQ--------SKLSPSKRQAREDIQNGAVYI
SYY_BACCA       -----------VPSFV-HEGGDVPLVELLVS--------AGISPSKRQAREDIQNGAIYV
SYY_GEOKA       -----------VPSFV-HEGGDVPLVELLVS--------AGISPSKRQAREDIQSGAIYV
SYY_GEOSE       -----------VPSFV-HEGGDVPLVELLVS--------AGISPSKRQAREDIQNGAIYV
SYY2_ENTFA      -----------VPTYEVQPEDQLSLVDLLVT--------SKIEPSKRQAREDVQNGAIYV
SYY_OCEIH       -----------VPNHI-ITREPVGLIDLLVD--------AKISSSKRQAREDVKNGAIYI
SYY2_BACAN      -----------MPTFQ-SSKETKNIVEWLVD--------LGIEPSRRQAREDINNGAISM
SYY2_BACHK      -----------MPTFQ-SSKETKNIVEWLVD--------LGIEPSRRQAREDINNGAISM
SYY2_BACCZ      -----------MPTFQ-SSKETKNIVEWLVD--------LGIEPSRRQAREDINNGAISM
SYY2_BACC1      -----------MPTFQ-SSKETKNIVEWLVD--------LGIEPSRRQAREDINNGAISM
SYY2_BACCR      -----------MPTFQ-SSKETKNIVEWLVD--------LGIEPSRRQAREDINNGAISM
SYY_LISMF       -----------VPTFV-AEDTEANLVDWLVT--------LGIEPSKRQAREDVANGAIYI
SYY_LISMO       -----------VPTFV-AEDSEANLVDWLVT--------LGIEPSKRQAREDVGNGAIYI
SYY_LISIN       -----------VPTFV-AEDAEVNLVDWLVT--------LGIEPSKRQAREDVTNGAIYI
SYY_LACBR       -----------VPNVS-INSEPTNIVELLTE--------TAIEPSRRQAREDITNGAITI
SYY_LACSS       -----------APTVE-ITAEKKNIVDFLVD--------AGIESSKRQAREDVQNGAITI
SYY1_ENTFA      -----------VPTVE-ITKDAKNIVDWLVD--------TEIEPSKRQAREDVSGGAISI
SYY_LACPL       -----------VPSAD-VSAEKQNIVLWLVDA-------TKFEPSRRQAREDIKNGAIRI
SYY_LACAC       -----------APSAE-AGSEKKNIVDFLVD--------TKIEPSKRQAREDVKNGAIYV
SYY_LACJO       -----------APSAE-ATHEAKNIVEFLVE--------TKIEPSKRQAREDVKNGAIYV
SYY_STAA3       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAW       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAR       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAS       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAM       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAN       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAB       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAAC       -----------VPQVT-LSNDTTNIVEVLIE--------TGISPSKRQAREDVNNGAIYI
SYY_STAEQ       -----------VPQVT-LSTKTTNIVEALIE--------TGIASSKRQAREDVNNGAIYI
SYY_STAES       -----------VPQVT-LSTKTTNIVEALIE--------TGIASSKRQAREDVNNGAIYI
SYY_STAHJ       -----------VPQVE-LSTETSNIIDVLIE--------TGIATSKRQAREDVNNGAIYI
SYY_STAS1       -----------VPQVE-LSSETRNIVEVIVE--------TGISSSKRQAREDVNNGAIYI
SYY_STRA3       -----------VPNYHVQTEDNLNIIDLLVT--------SGVVNSKRQAREDVSNGAIYI
SYY_STRA5       -----------VPNYHVQTEDNLNIIDLLVT--------SGVVNSKRQAREDVSNGAIYI
SYY_STRA1       -----------VPNYHVQTEDNLNIIDLLVT--------SGVVNSKRQAREDVSNGAIYI
SYY_STRPN       -----------VPNYQVQADENNNIVELLVS--------SGIVNSKRQAREDVQNGAIYV
SYY_STRR6       -----------VPNYQVQADENNNIVELLVS--------SGIVNSKRQAREDVQNGAIYV
SYY_STRP3       -----------VPNYHVQSEDSLNLVDMLVT--------AGISPSKRQAREDVQNGAIYI
SYY_STRP8       -----------VPNYHVQSEDSLNLVDMLVT--------AGISPSKRQAREDVQNGAIYI
SYY_STRP6       -----------VPNYHVQSEDSLNLVDMLVT--------AGISPSKRQAREDVQNGAIYI
SYY_STRPM       -----------VPNYHVQSEDSLNLVDMLVT--------AGISPSKRQAREDVQNGAIYI
SYY_STRP1       -----------VPNYHVQSIDNHNIVEILVA--------AKISPSKRQAREDVQNGAIYI
SYY1_STRT1      -----------VPTYEISADENLNIVELLVN--------AKISPSKRQAREDVQNGAIYI
SYY1_STRT2      -----------VPTYEISADENLNIVELLVN--------AKISPSKRQAREDVQNGAIYI
SYY_STRMU       -----------VPNYAVKSNDNHNIVELLVT--------AGIVNSKRQAREDLQNGAIYI
SYY_LACLA       -----------APQHQVTDDEDLTLVELLIS--------AGIAPSKRQAREDITNGAIYI
SYY_BLOPB       -----------GIPTVPLK-AGITLQQALVE--------SKLVVSRAQARELISSNSITV
SYY_BLOFL       -----------GIPNIILE-TNTSLQEALTK--------SKLATSRSQARYFIKSNAITI
SYY_BUCAI       -----------GIPFIEVS-NVKDLQEALVL--------TSLAQSRTQAKNMIISNSISI
SYY_BUCAP       -----------GVPVVETY-KIKDLQEALVL--------SSLAQSRTQAKNMIISNSISI
SYY_BUCBP       -----------GMPSVQLY-NSGNLQQLLVY--------SRLALSRSHAKSMIVSNSVRI
SYY_WIGBR       -----------GIKIYYPK-SNENIKDILVN--------SKLSKSKNNAKSVILSSSIRI
SYY_CHRVO       -----------GLPTIKLDKSASGLIDALAA--------GGLAKSKSEARTFIQSGAVSV
SYY_DECAR       -----------GMPGVQLEKSNTGLIDALVA--------SGLAKSKSEARTFIQSGSVAI
SYY_NEIMA       -----------GLPAFEVS-DGINVVEALVK--------TGLASSNKEARGFVNSKAVLL
SYY_NEIMB       -----------GLPAFEVS-DGINVVEALVK--------TGLASSNKEARGFVNSKAVLL
SYY_NEIG1       -----------GLPAFEVS-DGINAVEALVK--------TGLAASNKEARGFVNAKAVLL
SYY_ECOLI       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_SHISS       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_ECO57       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_SHIDS       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_ECOL6       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_SHIBS       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_SHIFL       -----------GVPMVEME-KGADLMQALVD--------SELQPSRGQARKTIASNAITI
SYY_SALCH       -----------GVPMVEME-KGADLMQALVD--------AELQPSRGQARKTIASNAVTI
SYY_SALPA       -----------GVPMVEME-KGADLMQALVD--------AELQPSRGQARKTIASNAVTI
SYY_SALTI       -----------GVPMVEME-KGADLMQALVD--------AELQPSRGQARKTIASNAVTI
SYY_SALTY       -----------GVPMVEME-KGADLMQALVD--------AELQPSRGQARKTIASNAVTI
SYY_PECAS       -----------GMPIIELE-NSADLQQALVS--------AELVPSRGQARTMISSNAVTI
SYY1_PHOLL      -----------GMPVIELE-KGADLQQALVN--------AGLVPSRGQARTMISSNAVAI
SYY_YERPE       -----------GMPTVELN-RDADLQQALVN--------AELVPSRGQARTMIGSNAVAI
SYY_YERPS       -----------GMPTVELN-RDADLQQALVN--------AELVPSRGQARTMIGSNAVAI
SYY_SODGM       -----------GMPTVHLE-RVADLQQALVA--------AELVPSRGQARTLISSNAVSV
SYY_VIBF1       -----------GLPSTELEASEQTIVEVLTQ--------SELAKSNKMAREFIGNGAVSV
SYY1_PSEHT      -----------GLAVHAISDAKINIAELLVK--------SELASSKRTARELINANAIKI
SYY1_VIBPA      -----------GLP--SIESAQQDLVELLIE--------SGLASSKRVAREHISNNAISV
SYY1_VIBVU      -----------GLPCRQLAHVS-DVVTLLLE--------TGLASSKRQAREWLENGAIRI
SYY1_VIBVY      -----------GLPCRQLAHVS-DVVTLLLE--------TGLASSKRQAREWLENGAIRI
SYY1_VIBCH      -----------GLPCVAASRTD-SLLDLLLS--------SGLASSKRQAREWLENGAIRV
SYY_MYCCT       -----------LPNTQIN--KDTKVIDALVE--------LKVASSKREAREFLKNKAILI
SYY_MYCMS       -----------LPNTQIN--KDTKVIDALIE--------VKAASSKREAREFLTNKAIMI
SYY_MESFL       -----------IPTIQLE--KTTSAIDAIVN--------VNAASSKREAREFINAKAISF
SYY_MYCGA       -----------FDKVELDRNQSFMVIDFLLQ--------AKVADSKRILRELIAQGSIQI
SYY_UREPA       -----------LPATKLDKDE-IKIIDLLNL--------ANISSSNRIARDFLNTGSILI
SYY_MYCMO       -----------FEVNHVNFSNDEKIIDILDR--------AKIFKSKNEIRKLIEQKGLVV
SYY_MYCH2       -----------IPYFKV----SFFNANQIID--------LGIFKSKRELNEFISHKALEI
SYY_MYCHJ       -----------IPYFKV----SFFNANQIID--------LGIFKSKRELNEFISHKALEI
SYY_MYCH7       -----------IPYFKV----SFFNANQIID--------LGIFKSKRELNEFISHKALEI
SYY_MYCS5       -----------IESFEVE--KGVNLVNFLVE--------NKILQSKRLAREFIASKSLKF
SYY_MYCPU       -----------VDFVPF----KDDLFLTLVD--------SKIISSKREFNEFVRDKSLKI
                                                            :    .          

SYY_AYWBP       FNQ--KIKSLDFIITKENT---------LFGKYILLKKGKKNNALIVF-----
SYY_ONYPE       FNQ--KIKSLDFAITKKNT---------LFDKYVLLKKGKKNNALIVF-----
SYY_AGRFC       NEQ--GVSDERQIIGTGEV--------TG-DGVIKLSVGKKKHVLVRPA----
SYY_RHIME       NDD--QVSDERRVIGSGDV--------TG-DGVIKLSLGKKKHLLVRPV----
SYY_BRUA2       NDE--PVSDPRMVVNAAAL--------ND-QGLIKLSLGKKRHVLIRPA----
SYY_BRUAB       NDE--PVSDPRMVVNAAAL--------ND-QGLIKLSLGKKRHVLIRPA----
SYY_BRUME       NDE--PVSDPRMVVNAAAL--------ND-QGLIKLSLGKKRHVLIRPA----
SYY_BRUSU       NDE--PVSDPRMVVNAAAL--------NG-QGLIKLSLGKKRHVLIRPA----
SYY_RHILO       NDQ--SVSDDRRMVTLQDL--------SP-ENVVKLSLGKKKHVLVRPA----
SYY_BARHE       NDH--IIEDETHLIREEDI--------NA-QGIIKLSFGKKKHVLIKPL----
SYY_BARQU       NDQ--IIEDETCLILEEDI--------NA-QGIIKLSFGKKKHVLIKPL----
SYY_NITWN       NDV--AVADDKMVLTPDHL--------TP-EGVIKLSMGKKRHVLLRPA----
SYY_RHOPA       NDA--PVTDEKMTLTATDL--------SS-DGVIKLSMGKKKHVLLRLA----
SYY_BRADU       NDE--PVTDDKMALSAAHL--------TP-EGVIKLSFGKKKHILIKPA----
SYY_MAGSA       NDQ--AV-DEAHPVGSNDL--------R--DGAVKLTAGKKRHILVKAV----
SYY_RHORT       NDV--AVSDAARLLGPADV--------Q--DGAIKLSAGKKRHALIRVLPG--
SYY_CAUVC       NDK--AEADANRLITAADL--------V--EGVVKLAAGKKKIVLVKPV----
SYY_NOVAD       DGE--PVTDEGFRILVNDK--------E-----IRVSSGKKKHGILRKA----
SYY_ZYMMO       NGE--KALDEKAVIEVTAE--------N-----IRISAGKKAHGVIQAG----
SYY_RHOS4       NNE--PVGDANTPVTAATV--------G---EELKVSIGRKKHKLVRLS----
SYY_RUEPO       NDA--PLTDAGMMIEAGDL--------A---APIKLSAGKKRHALVQLG----
SYY_GLUOX       NDV--VVSDENQTFTLDDL--------R--DGVLKVSYGKKKHILLRPV----
SYY1_PSEAE      DGT--PVSDPDTPLAGEVD--------G-----LRLSLGKKQHLHLRLED---
SYY_EHRRG       NDI--IILDVNYKLSLQDF--------C-GMSYIKLSCGKKRHLKVVLESNL-
SYY_EHRRW       NDI--IILDVNYKLSLQDF--------C-GMSYIKLSCGKKRHLKVVLESDL-
SYY_EHRCJ       NDV--VVLDVNYKLSLEHF--------C-NASYVKLSCGKKRHLKIMLKSSF-
SYY_ANAMM       NGM--VVEDADHALTHADF--------ARNSGYITVFCGKKRRIKVVVED---
SYY_WOLPM       NDN--VVNNIDHVINFESF--------K-DQPFIKLSAGKKRHIKVVVD----
SYY_WOLTR       NDY--TINDINYIINSKSF--------K-DQSFIKLSAGKKRHIKVMVS----
SYY_RICCN       NDR--LVEDENMIINTNFL--------L-DKKVIKLSAGKKKHILVRV-----
SYY_RICFE       NDR--LVEDENMIINTTFL--------L-DKNVIKLSAGKKRHILVRV-----
SYY_RICPR       NDQ--LVEDENMTIDTNFL--------R-NRKVIKLSVGKKRHILVKV-----
SYY_RICTY       NDQ--LVEDENMTIDTNFL--------L-DKKVIKLSVGKKRHILVKV-----
SYY_PELUB       NGQ--AISDEKFLITEDLF--------K--SSLIKLSLGKKKHIKVELI----
SYY_BORBU       NGK--RVESQSHLLTKKDF--------N--NNEVELRVGKKKFLRIVI-----
SYY_BORBP       NGK--RVENQNHCITREDF--------N--NNEIELRVGKKKFLRIVL-----
SYY_TREDE       NEE--KISDIKALIGKEKL--------DK-DNEMILRAGKKRFMRIIFS----
SYY_TREPA       GLQ--RVADIGAVIDQSAL--------DL-DGTVIVRAGKKRVVRIVTDVLE-
SYY1_CLOAB      NDT--KVEDFNYEITKEDF--------ND-DGFALVRRGKKKYYKIVIG----
SYY_CLOPE       NGE--KVADFKKTLEEADF--------EN--GEVLIKRGKKNYNKIVLA----
SYY_FUSNN       NDE--KIKDVKFTL-------------ND-NTLGLLKLGKKKFYNIVKK----
SYY_CLOTE       NEE--KVTDINMAVTEDLF--------EE--NSIIIRRGKKSYNRIVIE----
SYY_CALS4       NDK--RVENVDECIKEEMV--------KE--NAILVRKGKKEYHRLLVKE---
SYY_SYNAS       NEN--PIFAFDELITTEHL--------DR-SGQIKLRKGKKKYMIIKVE----
SYY_MYCGE       NNK--HVLDLNQIIEWK-------------EELQIIRKGKKSFLTIKTVNS--
SYY_MYCPN       NQE--KVTDVEMVLQAS-------------SQPLVIGKGKKRFVTVQVIANTK
SYY_MYCPE       NET--KITDVNTKLEDLKI--------D--QTNFTLHKGKKNHIKVIINK---
SYY_CHLAB       NSE--PIENEHSVFEETQV--------CF-DQYVLLAQGKKKKLVLRLI----
SYY_CHLCV       NSE--PIADEHSVFEERQV--------CY-DQYVLLAQGKKKKLVLHLI----
SYY_CHLPN       NNV--PIANEHSVCEEQDI--------CY-GHYVLLAQGKKRKLVLYLN----
SYY_CHLTA       NQE--PLADEQSILDGTQL--------CF-DRYVLLSQGKRKKQVIDLN----
SYY_CHLTR       NQE--PLADEQSILDGTQL--------CF-DRYVLLSQGKRKKQVIDLN----
SYY_CHLMU       NQE--PLIDEQSVLDGTYL--------CF-DRYILLSQGKKKKQVIDLN----
SYY_PARUW       NNK--KIEDENHIISVECL--------IS-SRLILLAAGKKNKMIIRLMEE--
SYY_TROW8       NNI--KVTCPDALLDSFLDN-------SMPIRAAILRKGKKHLAAVFY-----
SYY_TROWT       NNI--KVTCPDALLDSFLDN-------SMPIRAAILRKGKKHLAAVFY-----
SYY_LEIXX       NNA--TVQDADAPVGDAL----------LPGGMLVLRRGKKTLAGVFVEEGV-
SYY_BIFLO       NNN--RIEDEEQVLAEAD---------FLAGRFALIRRGKKALGAVENR----
SYY_CORDI       NNE--RIESEDWQPTDDV---------LLHGAWLVLRKGKKNFAGVKYSA---
SYY_CORJK       NNQ--RIEDIEWSPSAEE---------LLHGSWLVLRKGKKRFAGARVGASS-
SYY_COREF       NNE--RITADDWEPSESD---------LLHGQWLVLRKGKKNFAGVKIK----
SYY_CORGL       NNE--RIESDDWEPFAED---------LLHGSWLVLRRGKKNFAGVQILG---
SYY_MYCBO       NNI--RVDNEEWVPQSSD---------FLHGRWLVLRRGKRSIAGVERIG---
SYY_MYCTU       NNI--RVDNEEWVPQSSD---------FLHGRWLVLRRGKRSIAGVERIG---
SYY_MYCPA       NNV--RIDREDWAPQPSD---------FLHGKWLVLRRGKRTIAGVEKL----
SYY_MYCLE       NNI--RIQSEEWTPRTSD---------FLHGRWLVLRRGKRNIAGIERV----
SYY_MYCFO       NNI--RIESDEWIPQHSD---------FLHERWLVLRRGKRHIAGVERVGA--
SYY_NOCFA       NNQ--KIADPDWTPADGD---------YLHGRWLVVRRGKRNMAGVLRDGN--
SYY_STRAW       NNV--KVAAEDAVPAKED---------LLHGRWLVLRRGKKNLAAVEVTGG--
SYY_STRCO       NNA--KVTGEDAVPAKED---------LLHGRWLVLRRGKKNLAAVEITGA--
SYY_THEFY       NNA--KVTDIEARVSEAD---------LLHGRYLVLRRGKRNVGGVILR----
SYY_CUTAK       NNV--KVADPDQRLTDDD---------FLCGRVALVRRGKKTVGALTR-----
SYY_BACFN       NKE--KLAAFDQVITTAD---------LLDEKYLLVQRGKKNYYLIIAK----
SYY_BACFR       NKE--KLAAFDQVITTAD---------LLDEKYLLVQRGKKNYYLIIAK----
SYY_BACTN       NKE--KLEAFDQVITTAD---------LLDGKYLLVQRGKKNYFLLIAK----
SYY_PORGI       NKE--KVADAEQTVGEDD---------LLSDRYLLAQKGKKSYYLIIVE----
SYY_ANADE       NGA--VLESGDAKVAAGE---------LLAGGYALLQKGKRNYALVKVR----
SYY_RHOBA       NNT--RVEDVQKRLTVDD---------LDGRSVLVLRRGKRKYALLKIQD---
SYY1_BACAN      NGE--RTQALDYVVT---------EKDRIEGKFTIIRRGKKKYFLIRY-----
SYY1_BACHK      NGE--RTQALDYVVT---------EKDRIEGKFTIIRRGKKKYFLIRY-----
SYY1_BACCZ      NGE--RTQALDYVVT---------EKDRIEGKFTIIRRGKKKYFLIRY-----
SYY1_BACC1      NGE--RTQALDYVVT---------EKDRIEGKFTIIRRGKKKYFLIRY-----
SYY1_BACCR      NGE--RTQALDYVVT---------ENDRIEGKFTIIRRGKKKYFLIRY-----
SYY1_BACLD      NGE--RRTDVADVLT---------ADDRIEGQFTVIRRGKKKYFLLTYK----
SYY1_BACSU      NGE--RQTEINYTLS---------GEDRIENQFTVLRRGKKKYFLVTYK----
SYY_BACCA       NGE--RLQDVGAILT---------AEHRLEGRFTVIRRGKKKYYLIRYA----
SYY_GEOKA       NGE--RLQDVGAILT---------AEHRLEGRFTVIRRGKKKYYLIRYA----
SYY_GEOSE       NGE--RLQDVGAILT---------AEHRLEGRFTVIRRGKKKYYLIRYA----
SYY2_ENTFA      NGE--RRQDLAAELT---------ETDKIEGQFTVIRRGKKKYFLLKY-----
SYY_OCEIH       NGE--RVQDMNYHVE---------EKDHLGNKFTVVRRGKKKYFLIQVESIS-
SYY2_BACAN      NGE--KVTDVGTDVT---------VENSFDGRFIIIRKGKKNYSLVKLG----
SYY2_BACHK      NGE--KVTDVGTDVT---------VENSFDGRFIIIRKGKKNYSLVKLG----
SYY2_BACCZ      NGE--KVTDVGTDVT---------VENSFDGRFIIIRKGKKNYSLVKLG----
SYY2_BACC1      NGE--KVTDVGTDVT---------VENSFDGRFIIIRKGKKNYSLVKLG----
SYY2_BACCR      NGE--KVTDVGTDVT---------VENSFDGRFIIIRKGKKNYSLVKLGE---
SYY_LISMF       NGE--RQQDLEKIMD---------ASDRIENKFTIVRRGKKKYFLVSYK----
SYY_LISMO       NGE--RQQDLEKIMD---------ASDRIENKFTIVRRGKKKYFLVSYK----
SYY_LISIN       NGE--RQQNVEKVID---------ASDRIENKFTIVRRGKKKYFLVSYK----
SYY_LACBR       NGE--RCTDTDAQLN---------PKTNFSGKFMVIRRGKKNYFLAKVKD---
SYY_LACSS       NGD--RLRETTLEID---------PSENFEGKFVIVRRGKKKYFLARVK----
SYY1_ENTFA      NGD--RVTDLDFAVD---------PTQHFDGKFVVVRKGKKNYFLAKVMD---
SYY_LACPL       NGE--KVTDVEAEID---------PSAAFNGKFVIVRRGKKRYFLAHVK----
SYY_LACAC       NGD--REQSVDFEVD---------PSSAFDGKYVIIRKGKRKYTLVTIK----
SYY_LACJO       NGE--RQDDIDFIIE---------PDSDFDGKYVIIRKGKRKYTLVKIK----
SYY_STAA3       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAW       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAR       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAS       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAM       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAN       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAB       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAAC       NGE--RQQDVNYALA---------PEDKIDGEFTIIRRGKKKYFMVNYQ----
SYY_STAEQ       NGE--RQQSVDYELS---------SKDLIEDEITIIRRGKKKYFMVNYQS---
SYY_STAES       NGE--RQQSVDYELS---------SKDLIEDEITIIRRGKKKYFMVNYQS---
SYY_STAHJ       NGE--RQQSVDYELS---------NEDKIDDEFTIIRRGKKKYFMVNYK----
SYY_STAS1       NGI--RQQDVNYELT---------SEDKIENEFTIIRRGKKKYFMVNYK----
SYY_STRA3       NGD--RIQDLEYTIS---------ENDKLENEITVIRRGKKKYFVLNFK----
SYY_STRA5       NGD--RIQDLEYTIS---------ENDKLENEITVIRRGKKKYFVLNFK----
SYY_STRA1       NGD--RIQDLEYTIS---------ENDKLENEITVIRRGKKKYFVLNFK----
SYY_STRPN       NGD--RIQELDYVLS---------DADKLENELTVIRRGKKKYFVLTY-----
SYY_STRR6       NGD--RIQELDYVLS---------DADKLENELTVIRRGKKKYFVLTY-----
SYY_STRP3       NGD--RIQDLDYQLS---------NDDKIDDQLTVIRRGKKKYAVLTY-----
SYY_STRP8       NGD--RIQDLDYQLS---------NDDKIDDQLTVIRRGKKKYAVLTY-----
SYY_STRP6       NGD--RVQDLDYQLS---------NDDKIDDQLTVIRRGKKKYAVLTY-----
SYY_STRPM       NGD--RVQDLDYQLS---------NDDKIDDQLTVIRRGKKKYAVLTY-----
SYY_STRP1       NGD--RVQDLDYQLS---------NDDKIDDQLTVIRRGKKKYAVLTY-----
SYY1_STRT1      NGE--RVQDLDYTLS---------DTDKIDNEITVIRRGKKKNFVLTY-----
SYY1_STRT2      NGE--RVQDLDYTLS---------DTDKIDNEITVIRRGKKKNFVLTY-----
SYY_STRMU       NGE--RIQDLTYNLS---------QQDKIDNELTVIRRGKKKYFVLTY-----
SYY_LACLA       NGE--RVQALDYVIT---------DSDKIENRLTVIRRGKKKNFVLTY-----
SYY_BLOPB       NSK--KQLKTEYIFC---------ATDRLYNRFTLLRRGKKHHCLITWE----
SYY_BLOFL       NAH--KQSKIEYIFQ---------DSDRIYNLYTLLKRGKKNYCLIQWNI---
SYY_BUCAI       NTE--KI-RKNHIFH---------EKDKLFGKFTLLSRGKKQHSLLCW-----
SYY_BUCAP       NTK--KIVNKNYIID---------DNDKLFNQFTLLSRGKKNHCLIYWNK---
SYY_BUCBP       NNI--IQNNPFYILC---------NRDKMYHKYTLLSRGKKNFCLLCWTK---
SYY_WIGBR       NNK--KQKSIDFMFK---------KEDKLFNLFTLIKKGKKDFCLLIWKNY--
SYY_CHRVO       NGI--KVDSLEHAIG---------DGERLFGQYSLLKRGKKLYALVDWQ----
SYY_DECAR       NGN--KAEALDHAIG---------GDELLYGRFTILRRGKKNYGLISWQ----
SYY_NEIMA       NGKPAEANNPNHAAERPDDACLLTDEHKRFGKYTILRRGKRNHALLVWK----
SYY_NEIMB       NGKPAEANNPNHAAERPDDACLLNGEHKRFGKYTILRRGKRNHALLVWK----
SYY_NEIG1       NGKPAEANNPNHAAERPDDAYLLIGEYKRFGKYTILRRGKRNHALLVWK----
SYY_ECOLI       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_SHISS       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_ECO57       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_SHIDS       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_ECOL6       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_SHIBS       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_SHIFL       NGE--KQSDPEYFFK---------EEDRLFGRFTLLRRGKKNYCLICWK----
SYY_SALCH       NGE--KQSDPEYIFN---------DEDRLFGRYTLLRRGKKNYCLICWK----
SYY_SALPA       NGE--KQSDPEYIFN---------DEDRLFGRYTLLRRGKKNYCLICWK----
SYY_SALTI       NGE--KQSDPEYIFN---------DEDRLFGRYTLLRRGKKNYCLICWK----
SYY_SALTY       NGE--KQSDPEYIFN---------DEDRLFGRYTLLRRGKKNYCLICWK----
SYY_PECAS       NGE--KQANPEYIFS---------ASDRLFDRYTLLRRGKKHYCLICWKA---
SYY1_PHOLL      NGE--KQSEPEYLFT---------DSNRLFDRYTLLRRGKKHDCLICWK----
SYY_YERPE       NGE--KQADPEYVFT---------DADRLFGRYTLLRRGKKHYCLISWL----
SYY_YERPS       NGE--KQADPEYVFT---------DADRLFGRYTLLRRGKKHYCLISWL----
SYY_SODGM       NGE--KQASIDYVFD---------DADRLYSRYTLLRRGKKHYCLLNWQ----
SYY_VIBF1       NGE--KVADTEAVLK---------KEDALFGKYSVIKRGKKLFNLYIWK----
SYY1_PSEHT      NGEAITDEHAQLDFP-------------LFDRFWVMQRGKKQFRLIKLA----
SYY1_VIBPA      NGEKVSADNPSLSFP-------------LFDQYWLLQRGKKHFCLVKRAA---
SYY1_VIBVU      NGERWHELTLAQTFA-------------LYDQYYIVQRGKKQFAMVKLAQV--
SYY1_VIBVY      NGERWNEQTLAQTFA-------------LYDQYYIVQRGKKQFAMVKLAQV--
SYY1_VIBCH      NGERVQQEGGLSGFA-------------LFDRYYVLQRGKKQFALIKLEGLAE
SYY_MYCCT       NNQ--VIEDENLVISSFDL---------IQNKYLLVKKGKKKYFVILVK----
SYY_MYCMS       NNQ--IIEDENTLISSFDL---------IQNKYLLVKKGKKKYFVILIK----
SYY_MESFL       NDV--AVQDENMLLSEIKT---------IKNNKIIVKKGKKKYYLLEIK----
SYY_MYCGA       DDL--KITDPQAQLNVR-----------KDQQLTVIKKGKKNYFIVVWKG---
SYY_UREPA       NDI--KINDENFLVKKQDA---------INQKFSIIRKGKRNYFLILWNKD--
SYY_MYCMO       GAE--IITDFDQILKDSN----------LTHGVIFARQGKKKIFIIKKS----
SYY_MYCH2       NGS--KISNIGDITEELK----------DKSNLFLLRKGKKYFFIIELI----
SYY_MYCHJ       NGS--KISNIGDITEELK----------DKSNLFLLRKGKKYFFIIELI----
SYY_MYCH7       NGS--KISNISDITEELK----------DKSNLFLLRKGKKYFFMIELI----
SYY_MYCS5       NYE--PIDEDFSVSSNYF----------E-GKYATLHLGKKKILICKVK----
SYY_MYCPU       NGQ--DVTGLDYDLPWEN----------YDNKYLILKKGKKQYWVIYK-----
                                                      *::