CLUSTAL format seed alignment for MF_02007

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYY_AQUAE       ---------------MTPEEQLRIIKEGTVEIIE--------EEELLKKLK----EGRPL
SYY_THEMA       ---------------MTPEEQVKILKRNVVDLIS--------EEELLDRIK----RKGKL
SYY_HAEIN       --------------MTDINTVLAELKRGTDEILS--------EADLIEKLK----ENRPL
SYY_HAEI8       --------------MTNINTVLAELKRGTDEILS--------EADLIEKLK----ENRPL
SYY_MANSM       --------------MSDINVVLAELKRGVDEVLS--------EADLIEKLK----ENRPL
SYY_PASMU       --------------MTEINTVLAELKRGVDEILS--------EADLIEKLK----ENRPL
SYY_HAEDU       -------------MAQSIEAILAELKRGVENIYS--------EEDLIAKLK----ENRPL
SYY_PHOPR       --------------MASIEQALAEIKRGIDELIP--------EEELIAKLK----ENRPL
SYY2_VIBCH      --------------MASIEAALAEIKRGVEELIP--------EEELIAKLK----ENRPL
SYY2_VIBVU      --------------MASIEAALAEIKRGVEELIP--------EEELIAKLK----EGRPL
SYY2_VIBVY      --------------MASIEAALAEIKRGVEELIP--------EEELIAKLK----EGRPL
SYY2_VIBPA      --------------MASIEAALAEIKRGVEELIP--------EEELIAKLK----EGRPL
SYY_SHEON       --------------MADLDQVLAEIRRGTDEILL--------ESDLLEKLK----KGRPL
SYY_FRATT       --------------MSSIKETLEIIKRGADEVLI--------EEELIKKLQ----KHKPL
SYY_COLP3       --------------MTDFNQAFAELKRGAEEILV--------EEELLTKLK----TGKPL
SYY2_PSET1      ---------------MDLQTALAEIKRGTEEILI--------EDELVEKLK----SGKKL
SYY_IDILO       -------------MKTEVAEAIAEITRGAEEVLL--------EQELAEKLA----SGKPL
SYY_HYDCU       -------------MMKTVEEQMAVIQRGAEEILV--------EKELIEKLK----KGKPL
SYY_LEGPH       --------------MIVQDSVCSELMRGCEEILP--------VPELEKKLQ----KGIPL
SYY_LEGPL       --------------MIVQDSVCSELMRGCEEILP--------VPELEKKLQ----KGIPL
SYY_LEGPA       --------------MIVQDSVCSELMRGCEEILP--------VPELEKKLQ----KGIPL
SYY_COXBU       --------------MISSQEAFEEIKRGAVEIIH--------EDELLSRLA----EEKPL
SYY_METCA       -----------------MNDVITQLLRGTHEVLR--------LEELQKRIE----SGKPL
SYY_NITOC       --------------MVSPQQILDEIRRGTEEVLL--------EEELKLRLE----QGRIL
SYY_AROAE       --------------MTDVQAALELIKRGAEELLV--------EAELVEKLE----SDRPL
SYY_THIDA       -----------------MEHALQEIKRGADELLV--------EAELVEKLK----TGRPL
SYY_NITEU       -------------MSESISHQLQLIRRGCQELLI--------EEEFAQKLA----QGRPL
SYY_NITMU       -------------MTIPISEQIEIIKRGCSELLL--------EDELEQKLA----QNRPL
SYY_BORBR       ------MSHPEAPITPEVEADLAIARRGCDELLV--------ESEFARKLACSRATGVPL
SYY_BORPE       ------MSHPEAPITPEVEADLAIARRGCDELLV--------ESEFARKLARSRATGVPL
SYY_BORPA       ------MSHPEAPITPEVEADLAIARRGCDELLV--------ESEFARKLARSRATGVPL
SYY_BORA1       ------MSQAEFPITPEVEADLRIARRGCDELLV--------ESEFARKLARSRATGVPL
SYY_BURP1       -MSTDPTSKPAFPITDEVRHALAVTKRGVDELLI--------EEEFAQKLAKSAATDKPL
SYY_BURPS       -MSTDPTSKPAFPITDEVRHALAVTKRGVDELLI--------EEEFAQKLAKSAATDKPL
SYY_BURMA       -MSTDPTSKPAFPITDEVRHALAVTKRGVDELLI--------EEEFAQKLAKSAATGKPL
SYY_BURTA       -MSTDPTSKPAFPITDEIRHALAVTKRGVDELLI--------EEEFAQKLARSAATGKPL
SYY_BURL3       -MSTEPSSKPVFPITDEVRHALAVTKRGVDELLV--------EEEFAQKLARSAATGTPL
SYY_CUPPJ       MTEASSGPAAKYPLTPSVMHALEVSKRGCDELLI--------EAEWLQKLARSEATGVPL
SYY_RALSO       ---------------------MEVTQRGCDELLI--------AAEWEQKLARSAATGVPL
SYY_ACIAD       -----------MSNFLPAEEQLALIQRGTHEIIS--------EEDLLKKLK----ENRPL
SYY_PSYA2       ----------MTEKTYTLEEQLALIQRGAQEILS--------EEDLVKKLK----LNRPL
SYY_PSE14       --------------MKSVEEQLALIKRGADELLV--------EAELVEKLK----RGQPL
SYY_PSEU2       --------------MKSVEEQLALIKRGADELLV--------EAELVEKLK----RGQPL
SYY_PSESM       --------------MKSVEEQLALIKRGADELLV--------EAELVEKLK----RGQPL
SYY_PSEF5       --------------MKSVEEQLALIKRGAEELLV--------ESELIEKLK----RGEPL
SYY_PSEPF       --------------MKSVEEQLALIKRGAEELLV--------ESELIEKLK----RGQPL
SYY_PSEPK       --------------MKSVEEQLALIKRGAEEVLV--------ESELVEKLK----RGQPL
SYY2_PSEAE      --------------MKSVEEQLALIQRGADEILV--------EAELVAKLK----RGQPL
SYY_HAHCH       --------------MPSVEESLALIKRGAEEIIQ--------EEGLIEKLK----RGEPL
SYY_XANAC       --------------MTTIEESLALIGRGTEEILK--------LDQLQARLA----TGKPL
SYY_XANC5       --------------MATIEESLALIGRGAEEILK--------LDQLQARLA----TGKPL
SYY_XANOM       --------------MTTLDESLALIGRGAEEILK--------LDQLEARLT----SGVPL
SYY_XANOR       --------------MTTLDESLALIGRGAEEILK--------LDQLEARLT----SGVPL
SYY_XANC8       --------------MATIDESLALIGRGAEEILK--------LEQLEARLT----SGVPL
SYY_XANCP       --------------MATIDESLALIGRGAEEILK--------LEQLEARLT----SGVPL
SYY_XYLFA       --------------MSLVSNSLALIERGANEILK--------FDELERRLR----SGRPL
SYY_XYLFT       --------------MSLVSNSIALIERGANEILK--------FDELERRLR----SGRPL
SYY_DESAG       ---------------MDMDQQLKTILRGSAEFID--------EEELKKKLA----KGRPL
SYY_DESVH       --------------MIDIDRQLEHIKRGCAELID--------EGELRKKLE----RGTPL
SYY_GEOMG       ---------------MSVAEQMAIIKRGATEILL--------EKELEEKIEKSLSTGVPL
SYY_GEOSL       ---------------MSVADQMALIKRGAVEILV--------EKELEEKLEKSAKTGVPL
SYY_PELCD       --------------MKSVQEQMAIIRRGAVEILV--------ESELEAKLKKSVETGVPL
SYY_DESPS       ------------MDMPSLEEQIELIERGCVDCIS--------RDELVKKLKKSAETGIPL
SYY_HELPY       -------------MEQKIAIALKEIARGTNEIIG--------LEYIEKLVRKYYETNERF
SYY_HELPJ       -------------MEQKISVALKEIKRGANEIIG--------LEYIEKLVRKYYETNERF
SYY_CAMJE       ---------------MDIKKILAEVKRGCAELID--------EERIENLIKNYYEKGENF
SYY_CAMJR       ---------------MDIKKILAEVKRGCAELID--------EERIEKLIKNYYEKGENF
SYY_SULDN       ----------------MLKEAISEIQRGCAEIID--------EPRVEKLLKAYFEKGETY
SYY_HELHP       ---------------MKIKQAMQEISRGCVEFIG--------EEYIRDLVERFYNTGERF
SYY_WOLSU       ---------MQEGIEVRVQEAMREIARGVNEIIG--------IEYIQSLVERYYKSGETF
SYY_ACIFR       -------------MTMKHQDAFEQIAFGTVDMLP--------EGEMLARLAAAQRDNRPL
SYY_BDEBA       --------------MMSPQEQLERIKFGTADFIN--------DEDMLKKLKRSIETKKPL
SYY_LEPIC       ---------------MDIQKQIEIIRRGTVDLIS--------EEELKSKLQ----KKKTL
SYY_LEPIN       ---------------MDIQKQIEIIRRGTVDLIS--------EEELKSKLQ----KKKTL
SYY2_BACSU      --MMRTFEQLTASQQKEVERQLQLYMTGAHEVIP--------PEELKAKLVKSISTGTPL
SYY2_BACLD      -MQQQQFDQLTTAEKREVERQLHLYMDGAEEVIP--------PEELRAKLAKSILTGEPL
SYY_BACHD       ---MEEK-ALTPEQTQEVERQLEILKRGVVEIVP--------EEALREKIEKSVRTGKPL
SYY_BACSK       ---MDEKQPLTPEQQKLVDEQVEALMRGVVEVVP--------KEAFREKIEKSVRTGKPL
SYY2_CLOAB      --------------MKNIDEQIKIIKKGAEEIID--------AKELKEKLIKAEKENTQL
SYY_CARHZ       ------------MPVDELKRQLEIIKRGVAEIVP--------EEELVEKLKKSLNEGKPL
SYY_MOOTA       ---MHDYFGGWFKLEQEVARQLRILRRGVAEIVP--------EEDLQAKLRKSLATGKPL
SYY_DEHM1       -------------MNQAENRIDQILKRGVAEVIV--------EEDFKKLLL----SGKKL
SYY_DEHMC       -------------MNQSENQIDQILKRGVAEVIV--------EEDFKKLLL----SGRKL
SYY2_PHOLL      -----------------MKENIDKLLSNIAIMEP--------PLGLQDKLALARQENRKL
SYY_CHLCH       ------------MNFPSIQEQLDLITRNTVEIIS--------VDELEQKLVSSQKSGKPL
SYY_PELLD       ------------MSFPSLQEQLDIITANTVEIIS--------SAELEQKIQHSIKTGAPL
SYY_CHLTE       ------------MIFPSVKEQLDIIVNNTVEVIS--------TDELERKLTKSLKNGTPL
SYY_SALRD       ------------MAFPPVDEQMTVLRRGAEEIVP--------EDELAEKLRTSRETDTPL
SYY_SYMTH       ----------MTMAFMSVDEQMKILMRGVVDLVS--------EEELRQKLERSVKTGRPL
SYY_THET2       ----------MAGTGHTPEEALALLKRGAEEIVP--------EEELLAKLK----EGRPL
SYY_THET8       ----------MAGTGHTPEEALALLKRGAEEIVP--------EEELLAKLK----EGRPL
SYY_DEIRA       ------MKMSEIRRNVPVNEQIQLLKRGVVDLVS--------EEDLKRKIE----KGEPL
SYY_SYNP6       -----------------MTDSWTWLQRGTHEIFP---DQPESADPDVSLLARLQQGDRPL
SYY_SYNE7       -----------------MTDSWTWLQRGTHEIFP---DQPESADPDVSLLARLQQGDRPL
SYY_SYNY3       ---------------MVVNSDPDWLWRGTAEIFP---HNADSNNPQ-EHLGILTQQDRPL
SYY_THEEB       -------------MSSDLEATIARLQRGVVETFP---HVPDSVKPEENLWAYLRQTQRPL
SYY_NOSS1       -----------------MAENFSWLHRGIAEVFP---QPTDAESDIESLEKRLATTDRPL
SYY_TRIV2       -----------------MAENFSWLHRGIAEVFP---QPTDAESDIESLEKRLATTDRPL
SYY_PROM9       --------------MSDKLILPSWLSRGIEEYFP----IKGIDQTFSEIIDDAKKNNKKL
SYY_PROMP       --------------MVDKFELPKWLLRGIEESFP----LRNFDQTLSSKINDANKSKSKL
SYY_SYNPX       -------------MPESTPSLPDWLSRGMADLFP-AGDPTDADQALAARLAQAEKEGRPL
SYY_SYNSC       -------------MPDSIPSLPDWLSRGMADLFP-AGDPSDADQALAARLAQAEKEGRPL
SYY_SYNS9       -------------MPETNPSLPSWLNRGMADLFP-AGEPSDVDQSLAARLAAAEAEGRPL
SYY_PROMM       -------------MPETPITMPAWLQRGMVDLFP-SGQWGDADQQLATRLDEAREQNRPL
SYY_PROMA       -------------MLEQLTSLPDWLARGVADLFPLATNNSEKDQSLLLRLSQASRSNVPL
SYY_PROMT       -------------MLDHINELPDWISRGLDDLFP-NDNSGDSDQSFLKRLELSSVDKKPL
SYY_SYNJA       MEPTSRTFPTAVSSAQGDPRIAEITQRGVAEVFP------GGAAALAERLATTDR---PL
SYY_SYNJB       ----MSISSASVSPAYRDPLIAQIVERGVAEIFP------GGAAALAERLAQADR---PL
SYY_GLOVI       ---------------MDERQVERLSGHGVAEIFP------GGAEALTRRLADAETARMPL
                                           .                                

SYY_AQUAE       RVKAGFDPTAPDLHLGHVVLLQKLRQFQQLGHEVFFIIGDFTAMIGDPTGRSQTRPPLSR
SYY_THEMA       RVKLGVDPSRPDLHLGHAVVLRKLREFQDLGHTVVLIIGDFTARIGDPSGRNETRPMLTK
SYY_HAEIN       KVKLGADPTAPDIHLGHTVVLNKLRQFQQLGHEVYFLIGDFTGMVGDPSGKNATRPPLSR
SYY_HAEI8       KVKLGADPTAPDIHLGHTVVLNKLRQFQQLGHEVYFLIGDFTGMVGDPSGKNATRPPLSR
SYY_MANSM       KIKLGADPTAPDIHLGHTVVLNKLRQFQNFGHEVIFLIGDFTGMVGDPSGKNKTRPPLSR
SYY_PASMU       RVKLGADPTAPDIHLGHTVVLNKLRQFQQFGHEVIFLIGDFTGMVGDPSGKNTTRPPLSR
SYY_HAEDU       RIKLGADPTAPDIHLGHTVVINKLRQFQQLGHEVIFLIGDFTGMVGDPSGKNTTRPPLTR
SYY_PHOPR       RIKLGADPTAPDIHLGHTVILNKLRTFQELGHDVTFLIGDFTGMVGDPTGKNTTRPPLTR
SYY2_VIBCH      RIKLGADPTAPDIHLGHTVILNKLRTFQDLGHDVTFLIGDFTGMVGDPTGKNTTRPPLTR
SYY2_VIBVU      RIKLGADPTAPDIHLGHTVILNKLRAFQDLGHDVTFLIGDFTGMVGDPTGKNSTRPPLTR
SYY2_VIBVY      RIKLGADPTAPDIHLGHTVILNKLRAFQDLGHDVTFLIGDFTGMVGDPTGKNSTRPPLTR
SYY2_VIBPA      RIKLGADPTAPDIHLGHTVIFNKLRLFQELGHEVTFLIGDFTAMVGDPTGKNTTRPPLSR
SYY_SHEON       RIKLGADPTAPDIHLGHTVILNKLRLFQELGHEVIFLIGDFTGMVGDPSGKNSTRPPLTR
SYY_FRATT       IIKFGCDPTAPDIHLGHTVVINKLKQLQDLGHKIHFLIGDFTAQIGDPTGKNATRPPLTA
SYY_COLP3       KIKAGFDPTAPDLHLGHTVLINKLRQFQQLGHEVIFLIGDFTGMIGDPTGKNVTRKALTK
SYY2_PSET1      KIKAGFDPTAPDLHLGHTVLINKMKTFQDLGHEVVFLIGDFTGMIGDPTGKNVTRKPLTR
SYY_IDILO       TVKAGFDPTAPDLHLGHTVLINKLRVFQDFGHKVVFLIGDFTGMIGDPTGKNVTRKPLTT
SYY_HYDCU       KIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHEILFLIGDFTAMIGDPTGKSATRPPLSE
SYY_LEGPH       KIKAGFDPTAPDLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDPTGKNVTRMPLSQ
SYY_LEGPL       KIKAGFDPTAPDLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDPTGKNVTRMPLSQ
SYY_LEGPA       KIKAGFDPTAPDLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDPTGKNVTRMPLSQ
SYY_COXBU       RIKLGFDPTAPDIHLGHTVVLNKLRQFQTLGHEVIFLIGDFTAMIGDPTGKNITRQPLTR
SYY_METCA       RIKAGFDPTAPDLHLGHTVLLNKLKQFQDLGHETIFLIGDFTGMIGDPTGKNVTRRPLTR
SYY_NITOC       RVKAGFDPTAPELHLGHTVLLNKLRQFQEFGHEVLFLIGDFTGMIGDPSGKNVTRQPLTR
SYY_AROAE       RVKAGFDPTAPDLHLGHTVLLNKLRHFQELGHQVMFLVGDFTAMIGDPSGKNATRPPLSR
SYY_THIDA       RIKAGFDPTAPDLHLGHTVLLNKLRQFQVLGHRIVFLIGDFTGMIGDPTGKNATRPPLTR
SYY_NITEU       RVKAGFDPTAPDLHLGHTVLLNKLRQLQDLGHHILFLIGDFTGMIGDPSGKSATRPPLTR
SYY_NITMU       RIKAGFDPTAPDLHLGHTVLLNKMRHLQDLGHHALFLIGDFTGMIGDPSGKNTTRPPLSR
SYY_BORBR       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHNVIFLIGDFTSTIGDPSGRNSTRPPLTR
SYY_BORPE       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHNVIFLIGDFTSTIGDPSGRNSTRPPLTR
SYY_BORPA       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHNVIFLIGDFTSTIGDPSGRNSTRPPLTR
SYY_BORA1       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTVIFLIGDFTSTIGDPSGRNSTRPPLTR
SYY_BURP1       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTR
SYY_BURPS       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTR
SYY_BURMA       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTR
SYY_BURTA       RIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTR
SYY_BURL3       RIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTR
SYY_CUPPJ       RIKLGLDPTAPDIHIGHTVVLNKLRQLQDLGHQVIFLIGDFTSTIGDPSGRNSTRPPLTR
SYY_RALSO       RIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHQVIFLIGDFTSTIGDPSGRNATRPPLTR
SYY_ACIAD       RIKAGFDPTAPDLHLGHTVLINKLKAFQDLGHEVTFLIGDYTAMIGDPTGKSATRPPLTR
SYY_PSYA2       RIKAGFDPTAPDLHLGHTVLINKLKHFQDLGHEIYFLIGDYTAKIGDPSGKNSTRPPLTD
SYY_PSE14       RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQIIFLIGDFTGMIGDPSGKSATRPPLTR
SYY_PSEU2       RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQIIFLIGDFTGMIGDPSGKSATRPPLTR
SYY_PSESM       RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTR
SYY_PSEF5       RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTR
SYY_PSEPF       RIKAGFDPTAPDLHLGHTVLINKLRQFQELGHQVIFLIGDFTGMIGDPSGKSATRPPLTR
SYY_PSEPK       RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTR
SYY2_PSEAE      RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSVTRPPLTR
SYY_HAHCH       RIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPTGKSATRPPLTK
SYY_XANAC       RVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQVIFLIGDFTGMIGDPSGKNATRKPLSR
SYY_XANC5       RVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQVIFLIGDFTGMIGDPSGKNATRKPLSR
SYY_XANOM       RVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQVIFLIGDFTGMIGDPSGKNATRKPLSR
SYY_XANOR       RVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQVIFLIGDFTGMIGDPSGKNATRKPLSR
SYY_XANC8       RVKAGFDPTAPDLHLGHTVLLNKMRQFQELGHQVIFLIGDFTGMIGDPSGKNVTRKPLSR
SYY_XANCP       RVKAGFDPTAPDLHLGHTVLLNKMRQFQELGHQVIFLIGDFTGMIGDPSGKNVTRKPLSR
SYY_XYLFA       RIKAGFDPTAPDLHLGHTVLLNKMRQFQELGHQVIFLIGDFTGMIGDPTGKNVTRKPLSH
SYY_XYLFT       RIKAGFDPTSPDLHLGHTVLLNKMRQFQDLGHQVVFLIGDFTGMIGDPTGKNVTRKPLSR
SYY_DESAG       RVKAGFDPTAPDLHLGHTVLIHKLRHFQELGHTVIFLIGDFTGMIGDPSGRSETRPPLTR
SYY_DESVH       RIKAGFDPTAPDLHLGHTVLIHKLRHFQELGHTVIFLIGDFTGLIGDPSGRSDTRPPLTR
SYY_GEOMG       RIKAGFDPTAPDLHLGHTVLLHKMRQFQQLGHEVCFLIGDFTGMIGDPTGKSETRKALTR
SYY_GEOSL       KIKAGFDPTAPDLHLGHTVLLHKMRQFQQLGHEVIFLIGDFTGMIGDPTGKSETRKALSR
SYY_PELCD       KVKAGFDPTAPDLHVGHTVLIQKLKQFQDLGHEVNFLIGDFTGMIGDPTGKNETRKALTR
SYY_DESPS       KVKAGFDPTAPDLHLGHTVLLQKLKQFQDLGHQVIFLIGDFTGMIGDPTGKSETRKALTV
SYY_HELPY       IVKAGFDPTAPDLHLGHTVLIQKLALLQQYGARVKFLIGDFTAMIGDPTGKNETRKPLNR
SYY_HELPJ       IVKAGFDPTAPDLHLGHTVLIQKLALLQQYGARVKFLIGDFTAMIGDPTGKNETRKPLNR
SYY_CAMJE       FIKAGFDPTAPDLHLGHSVVLTKMAFLQKHGAIVQFLIGDFTGQIGDPSGKSATRKKLDK
SYY_CAMJR       FIKAGFDPTAPDLHLGHSVVLTKMAFLQKHGAIVQFLIGDFTGQIGDPSGKSATRKKLDK
SYY_SULDN       TVKAGFDPTAPDLHLGHTVLLQKLAIFQKYGARVQFLIGDFTAQIGDPSGKSATRKILST
SYY_HELHP       CVKAGFDPTAPDLHLGHTVLLQKLATFQRYGGDVKFLIGDFTATIGDPSGKSETRKPLSA
SYY_WOLSU       SIKAGFDPTAPDLHLGHTVLIQKMATFQKHGAIVTFLIGDYTAMIGDPTGKSETRKPLTR
SYY_ACIFR       RIKLGMDPTAPDLHLGAYVLLHKARQFQDLGHRLLFVIGDFTAMIGDPTGKSVTRKALSR
SYY_BDEBA       NIKLGADPTRPDIHLGHTVVINKLKTFQDLGHKVSFLIGDFTAMIGDPSGKNSTRPMLTR
SYY_LEPIC       KIKAGFDPTAPDLHLGHFVQLKKLKHFQDLGHEVSFLLGDFTAMIGDPTGKSETRKRLSR
SYY_LEPIN       KIKAGFDPTAPDLHLGHFVQLKKLKHFQDLGHEVSFLLGDFTAMIGDPTGKSETRKRLSR
SYY2_BACSU      KIKLGLDPSAPDVHLGHTVVLNKLRQFQENGHIVQLLIGDFTGKIGDPTGKSAARKQLTD
SYY2_BACLD      KIKLGLDPSAPDVHLGHTVVLNKLRQFQENGHIVQLLIGDFTGKIGDPTGKSAARKQLTD
SYY_BACHD       KVKLGMDPSAPDVHIGHTVVLHKLRQFQDLGHEVQMLIGDFTGRIGDPSGKSETRKQLTD
SYY_BACSK       NIKLGMDPSAPDVHIGHTVVLQKLRQFQEYGHHIQLLIGDFTGKIGDPTGKSETRKVLTD
SYY2_CLOAB      VVKLGLDPSAPDIHLGHAVVLRKLKQLQDLGHKIVIIIGDFTGMIGDPTGKSKTRKQLSS
SYY_CARHZ       RVKLGLDPTAPDIHLGHTVVLQKLKQFQSLGHEVIIIIGDFTAQIGDPTGKKETRKQLSW
SYY_MOOTA       KVKLGLDPTAPDIHLGHTVVLQKLRQFQELGHQVIIIIGDFTGRIGDPTGKSETRRQLTE
SYY_DEHM1       RLKEGFDPSSPDIHLGHMVALRKLRQLQDLGHQVVLIVGDWTAQIGDPSGASVTRPMLSA
SYY_DEHMC       RLKEGFDPSSPDIHLGHMVALRKLRQLQDLGHQVVLIVGDWTAQIGDPSGASVTRPMLSA
SYY2_PHOLL      TIKLGFDPTAPDLHLGHAVVLQKLKDFQDEGHRIVVIIGDFTAGIGDPTGRNKLRPPLTP
SYY_CHLCH       NIKLGADPSRPDLHLGHSVVLRKLRDFQDLGHHAILIIGNFTAMIGDPSGKSKTRPQLSA
SYY_PELLD       KVKLGADPSRPDLHLGHSVVLRKLREFQDLGHEAILIIGDFTAMIGDPSGKSKTRPQLSA
SYY_CHLTE       KIKLGADPSRPDLHLGHSVVLRKLREFQDLGHEAILIIGDFTAMIGDPSGKSKTRPQLTA
SYY_SALRD       TVKLGCDPSRPDLHLGHTVVLRKLRQFQDFGHRAVLIVGDFTGMIGDPSGRSKTRPQLTL
SYY_SYMTH       RVKLGIDPTGKDLTLGHTVPLRKLRDFVECGHQGVLIIGDYTAMVGDPTGRNEARPQLTH
SYY_THET2       TVKLGADPTRPDLHLGHAVVLRKMRQFQELGHKVVLIIGDFTGMIGDPSGRSKTRPPLTL
SYY_THET8       TVKLGADPTRPDLHLGHAVVLRKMRQFQELGHKVVLIIGDFTGMIGDPSGRSKTRPPLTL
SYY_DEIRA       RVKLGADPTRPDLHLGHAVILRKMRQFQDLGHKVIMLIGDFTATIGDPSGKSKTRPPLSL
SYY_SYNP6       RIKLGIDPTGSDIHLGHSIIFRKLRQFQDAGHTAVLIIGDFTARIGDPTGKSEVRRQLTA
SYY_SYNE7       RIKLGIDPTGSDIHLGHSIIFRKLRQFQDAGHTAVLIIGDFTARIGDPTGKSEVRRQLTA
SYY_SYNY3       RVKLGIDPTGTDIHLGHSIPFRKLRAFQDAGHTAVVIIGDFTAQIGDPTGKSEVRKQLTA
SYY_THEEB       RIKFGIDPTGSEIHLGHSIVLRKLRQFQDAGHCAVLIIGDFTAQIGDPTGKSEVRKQLTP
SYY_NOSS1       RVKYGIDPTGADIHLGHSIPMRKLRGFQDAGHTAVLIIGDFTARIGDPTGKSEMRRQLTE
SYY_TRIV2       RVKYGIDPTGADIHLGHSIPMRKLRGFQDAGHTAVLIIGDFTARIGDPTGKSEMRRQLTE
SYY_PROM9       RVKLGIDPTGTDIHLGHSILFKKLRAFQDNGHIAVLIIGDFTAQIGDPTGKNKTRVQLSE
SYY_PROMP       RVKLGIDPTGTDIHLGHSILFKKLRAFQDNGHVAVLIIGDFTAQIGDPTGKNKTRVQLSE
SYY_SYNPX       RVKLGIDPTGSNIHLGHSILFRKLRAFQDAGHTAVLIIGDFTARIGDPTGKCATRVQLSK
SYY_SYNSC       RVKLGIDPTGSNIHLGHSILFRKLRAFQDGGHTAVLIIGDFTARIGDPTGKSATRVQLSK
SYY_SYNS9       RVKLGIDPTGSNIHLGHSILFRKLRAFQDAGHIAVLIIGDFTARIGDPTGKSATRVQLSK
SYY_PROMM       RVKLGIDPTGRDIHLGHSILFRKLRAFQDAGHTAVLIIGDFTARIGDPTGKSSTRVQLTS
SYY_PROMA       RVKLGIDPTGSEIHLGHSIIFRKLRAFQDAGHTAILIIGDFTARIGDPTGKSKTRVQLSP
SYY_PROMT       RVKLGIDPTGTDIHIGHSILFRKLRAFQDAGHTAILIIGDFTARIGDPTGKSKTRIQLSK
SYY_SYNJA       RVKLGIDPTRPDLHLGHAVVLRKLRQFQDAGHVAILLIGDFTALVGDPTGQSEARPRLTP
SYY_SYNJB       RVKLGIDPTRPDLHLGHSVVLRKLRQFQDAGHVAILLIGDFTALVGDPTGQSEARPRLTP
SYY_GLOVI       RVKLGIDPTRPDLHLGHTVVLRKLREFQDLGHTAILLIGGFTAQIGDPTGKSEARPRLSA
                 :* * **:  :: :*  : : *   :   *    .::*.:*. :***:*    *  *  

SYY_AQUAE       EQVLENAKTYEHQV-------FKVLI---PEKTTVVFNSTWLEELGTKGLIELCAKYTVA
SYY_THEMA       EEVLENAKTYQEQA-------FKILD---PKRTELRFNGEWLDRMTFADVIILASKYTVA
SYY_HAEIN       EDVLRNAETYKEQI-------YKILD---PQKTKIVFNSEWLSKLGTXGMIRLASNYTVA
SYY_HAEI8       EDVLRNAETYKEQI-------YKILD---PQKTKIVFNSEWLSKLGTEGMIRLASNYTVA
SYY_MANSM       EDVLRNAETYKQQI-------YKILD---PQKTRIVFNSDWLGKLGTEGMIRLASNYTVA
SYY_PASMU       DDVLRNAETYKQQI-------YKILD---PQKTRIVFNSSWLGELGTEGMIRLTSNYTVA
SYY_HAEDU       EDVLRNAETYKQQL-------FKILD---PNKTRVVFNSAWLNELGTEGMIRLTSNYTVA
SYY_PHOPR       EDVLANAETYKEQV-------FKILD---PAKTKIEFNSTWLSELGAEGMIRLASNQTVA
SYY2_VIBCH      EDVLRNAETYKQQV-------FKILD---PAKTKIQFNSEWLSKLGAEGMIRLASNQTVA
SYY2_VIBVU      EDVLRNAETYKQQV-------FKILD---PAKTKIQFNSEWLSELGAEGMIRLAANQTVA
SYY2_VIBVY      EDVLRNAETYKQQV-------FKILD---PAKTKIQFNSEWLSELGAEGMIRLAANQTVA
SYY2_VIBPA      EDVLRNAETYKEQV-------FKILD---PAKTKIQFNSEWLSELGAEGMIRLAANQTVA
SYY_SHEON       EQVLANAETYKEQV-------YKILD---PAKTRIEFNSSWLEPLGAAGMIRLASQQTVA
SYY_FRATT       EEVAANAETYTKQV-------FKILD---KDKTIIRRNGDWFNKMSASEMIKLASKSTVA
SYY_COLP3       EDVLANAETYKEQV-------FKILD---PAKTTVAFNSTWMDKLGAAGMLQLASRQTVA
SYY2_PSET1      EDVLANAETYKEQV-------FKILD---PAKTTVAFNSTWMENLGAAGMIKLAARQTVA
SYY_IDILO       EQVIANAETYKEQV-------FKILD---PAKTEIRFNSEWMSKMGAADMIKLAARQTVA
SYY_HYDCU       EDVLKNAETYKEQV-------FKILD---PAKTKVVFNSEWMSKLSAADMIKLAGTTTVA
SYY_LEGPH       ETVLENAKTYQHQV-------FKILD---PDKTTVAFNSQWLNKFNAVDLIRLAATHTVA
SYY_LEGPL       ETVLENAKTYQHQV-------FKILD---PDKTTVAFNSQWLNKFNAVDLIRLAATHTVA
SYY_LEGPA       ETVLENAKTYQHQV-------FKILD---PDKTTVAFNSQWLNKFNAVDLIRLAATHTVA
SYY_COXBU       EIVMENTKTYETQA-------FRILD---PDKTQVTSNSTWINKLKADDLVRLAATYTVA
SYY_METCA       DEVIENAKTYEEQI-------YKVLC---PERTLVMFNSSWMNAMTSADLIQLAAKHTVA
SYY_NITOC       DKILENARTYEEQI-------FRVLD---PEKTLVVFNSSWMSGMTAADLVRLSSHYTVA
SYY_AROAE       EQILENARTYQEQV-------FKILD---PDKTEICFNSSWMESLGTAGMIRLASRYTVA
SYY_THIDA       EAVAENAKTYQEQV-------FKVLD---PALTEVRFNSEWMEGLGSVGMIRLAATHTVA
SYY_NITEU       EQITQNADTYASQV-------FKILK---PEQTEVVFNSSWMDKFSAADVIRLAATYTVA
SYY_NITMU       EQVAENAKSYQDQV-------FRILK---PEQTEVVFNSAWMDRLNAADLIKLAATHTVA
SYY_BORBR       EQIETNAKTYYAQA-------SLVLD---PARTEIRYNSEWCDPLGARGMIQLASRYTVA
SYY_BORPE       EQIETNAKTYYAQA-------SLVLD---PARTEIRYNSEWCDPLGARGMIQLASRYTVA
SYY_BORPA       EQIETNAKTYYAQA-------SLVLD---PARTEIRYNSEWCDPLGARGMIQLASRYTVA
SYY_BORA1       EQIEHNAKTYYAQA-------SLVLD---PARTEIRYNSEWCDPLGARGMIQLASRYTVA
SYY_BURP1       EQIESNAKTYFEQA-------ALVLD---RAKTEIRYNSEWSMPLGADGMIKLASRYTVA
SYY_BURPS       EQIESNAKTYFEQA-------ALVLD---REKTEIRYNSEWSMPLGADGMIKLASRYTVA
SYY_BURMA       EQIESNAKTYFEQA-------ALVLD---REKTEIRYNSEWSMPLGADGMIKLASRYTVA
SYY_BURTA       EQIESNAKTYFEQA-------ALVLD---REKTEIRYNSEWSMPLGADGMIKLASRYTVA
SYY_BURL3       EQIESNAKTYFEQA-------ALVLD---RDKTEIRYNSEWSMPLGADGMIKLASRYTVA
SYY_CUPPJ       EQIEANAQTYYRQA-------SLVLD---PARTEIRYNSEWCDPLGARGMIQLAAKYTVA
SYY_RALSO       EQIEANAQTYYRQA-------SMVLD---PSKTEIRYNSEWCDPLGARGIIQLAAKYTVA
SYY_ACIAD       EQVEANAKTYQEQV-------FKILD---PNKTKVRFNSEWFNQRTAADLIQLASQQTVS
SYY_PSYA2       EQIKANAETYAEQV-------FKILD---KEKTRVVFNSEWFNDMSAADMIQLASHQTVS
SYY_PSE14       EQVLDYAETYKSQV-------FKILD---PAKTEVAFNSTWMDKLSPADFIRLSSQYTVA
SYY_PSEU2       EQVLDYAETYKSQV-------FKILD---PAKTEVAFNSTWMDQLSPADFIRLSSQYTVA
SYY_PSESM       EQVLDYAETYKSQV-------FKILD---PAKTEVAFNSTWMDKLSPADFIRLSSQYTVA
SYY_PSEF5       EQVLENAETYKSQV-------FKILD---PAKTEVAFNSTWMDKMGPADFIRLTSQYTVA
SYY_PSEPF       EQVLENAETYKTQV-------FKILD---PAKTEVAFNSTWMDQMGPADFIRLTSQYTVA
SYY_PSEPK       EQVLENAETYKQQV-------FKILD---PAKTEVAFNSTWMDKLTPADFIRLASQYTVA
SYY2_PSEAE      EQVLENAETYKSQV-------FKILD---PAKTEVAFNSTWMDQLTPADFIRLASQYTVA
SYY_HAHCH       EDVAQNAQTYKEQV-------FKILD---PKKTEVRFNSEWMDKLSAADMIRLAGQYTVA
SYY_XANAC       EDVLANARTYEEQV-------FKILD---RERTEVRFNSEWFGQMSAADMIKLSAQHTVA
SYY_XANC5       EDVLANARTYEEQV-------FKILD---RERTEVRFNSEWFGQMSAADMIKLSAQHTVA
SYY_XANOM       EDVLANARTYEEQV-------FKILD---RERTEVRFNSEWFGQMSAADMIKLSAQHTVA
SYY_XANOR       EDVLANARTYEEQV-------FKILD---RERTEVRFNSEWFGQMSAADMIKLSAQHTVA
SYY_XANC8       EDVLANARTYEEQV-------FKILD---RTRTEVRFNSEWFGQMSAADMIKLSAQHTVA
SYY_XANCP       EDVLANARTYEEQV-------FKILD---RTRTEVRFNSEWFGQMSAADMIKLSAQHTVA
SYY_XYLFA       EDVLANARTYEDQV-------FKVLD---RTLTEVRFNSEWFGKMSAVDMIKLAAQHTVA
SYY_XYLFT       EDVLANASTYEDQV-------FKVLD---RTLTEVRFNSEWFEKMSAVDMIKLAAQHTVA
SYY_DESAG       EQVLQNAETYKKQV-------FKILD---PEKTEVRFNSEWMDKFGAADFIRLASRYTVA
SYY_DESVH       EQVLANAETYKQQV-------FKILD---PEKTVVDFNSRWMGEFGAADFIRLASRYTVA
SYY_GEOMG       EDVLKNAETYKEQV-------FKILD---PKKTRVVFNSEWLGKMTASDMIGLAAQSTVA
SYY_GEOSL       EDVLRNAETYKEQV-------FKILD---PEKTRVAFNSEWLAKLDAGGMIGLAAKYTVA
SYY_PELCD       EEVLKNAETYKQQV-------FKILD---PERTKVVFNSSWMGQMSAADLIGLAGRYTVA
SYY_DESPS       EQVAENAETYKKQV-------FKILD---PEKTTVAFNSTWLSKLTAHEMIQLASELTVA
SYY_HELPY       EQVLENAKTYEEQI-------YKILD---EKHTEVCFNSTWLDALGAKGMIELCAKFSVA
SYY_HELPJ       EQVLENAKTYKEQI-------YKILD---QKHTEVCFNSAWLDALGAKGMIELCAKFSVA
SYY_CAMJE       EQVLINAKTYKTQV-------FKVLD---KEKTQIKFNSTWLNELGAAGIVELTSTFSVA
SYY_CAMJR       EQVLINAKTYETQV-------FKVLD---KEKTQIKFNSTWLNELGAAGIVELTSTFSVA
SYY_SULDN       EDILENAKSYKEQV-------FKILD---ASKTDVVFNSEWLNALGASGMITLTTTFNVA
SYY_HELHP       EQVKANALTYKEQV-------FKVLD---PQYTQICFNSKWLNELGALGLITLTSHFSVA
SYY_WOLSU       EQVLQNAQSYQDQV-------FKILD---PQKTVIRFNSEWLEKLGTAGMIELTAKFSVA
SYY_ACIFR       EEVVANAATYRPQV-------FKILD---PERTEVMFNSEWLGALRPEELIQIAACYTVA
SYY_BDEBA       EEIEENGRSYAKQI-------FKILD---PEKTEIVYNSSWIMKMTPAEFITMTSKYTVA
SYY_LEPIC       EEVLENSKTYQNQV-------FKVLD---PVKTKIVYNSNWCSKMNFEDVLVLSSKYNVA
SYY_LEPIN       EEVLENSKTYQNQV-------FKVLD---PVKTKIVYNSNWCSKMNFEDVLVLSSKYNVA
SYY2_BACSU      EEVQHNAKTYFEQF-------GKVLD---PEKVELHYNSKWLKTLNLEDVIELAGKITVA
SYY2_BACLD      EEVRRNAETYFQQF-------GKVLD---QNKVELHYNSKWLKRLTLEDVIELAGKITVA
SYY_BACHD       EQVKANARTYVEQY-------GKILD---MEKATLHYNSKWLSALNFEDVIKLASQMTVA
SYY_BACSK       EQVKQNAQTYVEQY-------GKILD---IEKTEILYNSRWLSELKFDDVLKLAGQMTVA
SYY2_CLOAB      QQVMKNAETYEKQI-------FKILD---RNKTDLRFNSQWLEKLNFKEVIELASKYTVA
SYY_CARHZ       EEVLENAKTYQEQI-------FKILD---PAKTKMVFNSEWLAKLTFADVIKLASKYTVA
SYY_MOOTA       AEILANAETYKEQI-------FKVLD---PEQTRVTFNSHWLGKLTFAEVIELAARTTVA
SYY_DEHM1       EQVKANAKTYLEQF-------FKIVD---KDKTEVRWQSEWYANFKLEDVVRLSSKFTVA
SYY_DEHMC       EQVKANAKTYLEQF-------FKIVD---KDKTEVRWQSEWYGNFKLEDVVRLSSKFTVA
SYY2_PHOLL      EQINKNSQTYINQL-------AKVIN---IENIEIRKNSEWFNNMPFSNVIKLISKITLA
SYY_CHLCH       EEAAENGRSYFEQA-------IKILD---AANTTLCSNADWLGAMTFADVIRLSSHYTVA
SYY_PELLD       EEARENGASYFEQA-------SKILD---PHKTTICYNADWLGNMTFADVIRLSSHYTVA
SYY_CHLTE       EEARENGKSYFEQA-------SKILD---PEKTTICYNADWLSQMHFADVIRLSSHYTVA
SYY_SALRD       EETREHGQSYYEQA-------TRVLD---PNKTEIRYNSEWLDEMRFSDVIELAAQQTVA
SYY_SYMTH       AETTANAQRYLEQA-------ARVLD---VSKLEIRRNSEWLAPMSFSDVIRLAAKSTVA
SYY_THET2       EETRENAKTYVAQA-------GKILRQ-EPHLFELRYNSEWLEGLTFKEVVRLTSLMTVA
SYY_THET8       EETRENAKTYVAQA-------GKILRQ-EPHLFELRYNSEWLEGLTFKEVVRLTSLMTVA
SYY_DEIRA       EEARANAESYLAQC-------RLILRQ-EPEALEIRYNSEWLEQLGYKDIIGLAAKYTVA
SYY_SYNP6       EDVQRNAETYLDQL-------RPILDFETPGRLEIRYNSEWLAGLDLAKILELLGTMTVG
SYY_SYNE7       EDVQRNAETYLDQL-------RPILDFETPGRLEIRYNSEWLAGLDLAKILELLGTMTVG
SYY_SYNY3       DQVKRNAESYLAQL-------KPILDFDTPGRLEIRYNSEWLSNLDLNKILELLATMTVG
SYY_THEEB       EEVAANVQTYLEQV-------RPILDFETPGRLEIRYNSEWLAKLDLRKVLELLGTMTVG
SYY_NOSS1       EDVKQNAQTYLDQV-------RPILDFDTPGRLEVRYNSEWLSRLDLGKITELLATMTVG
SYY_TRIV2       EDVKQNAQTYLDQV-------RPILDFDTPGRLEVRYNSEWLSRLDLGKITELLATMTVG
SYY_PROM9       KQVKDNAKTYLTQLGMGKPANESILDFDSKDKIEIRYNSEWLKGLNLNSIIELMGSATVS
SYY_PROMP       EEVKENSKTYLNQLGMGKSSDKSILDFDSEDRIEIRYNSEWLKNLNLNSIIELMGSATVS
SYY_SYNPX       EDVAANASTYLRQLGQDQPKETALLDFETPGRLEVRYNSEWLEGMDLPAVIGLLGTGTVG
SYY_SYNSC       EQVAANASTYLRQLGQDQPKETALLDFETPGRLEVRYNSEWLEGMDLPAVIGLLGTGTVG
SYY_SYNS9       NDVAVNASTYLRQLGQDQPKETALLDFETPGRLEVRYNSEWLEGMDLPAVIGLLGTGTVG
SYY_PROMM       EQIEANATTYLAQLGQGQSAEKALLDFTTPGRLEVRRNTEWLADLDLPEVIGLLGTATVG
SYY_PROMA       EEVEKNSENYLNQLGKGQSKETSLLDFETEGRLEVRRNSEWLEGFDMVQIIDLLSKSTVG
SYY_PROMT       DEVQSNALNYLEQLGLGKDPKDSLLDFSIPSRIEIRRNSEWLENLNLSKVIELLSNSTVG
SYY_SYNJA       AEVEENARTYLEQA-------GKILDFETPGRLEVRRNSEWLARLTLSELIELQAQMTVG
SYY_SYNJB       AEVEENARTYLEQA-------GKILDFETPGRLEVRRNSEWLAHLTLSELIELQAQMTVG
SYY_GLOVI       AEVEEYAETYLDQA-------RLILNFDT---LEVRNNTEWLSGLDLAAIIKLLASTSVA
                         *  *          ::         :  :  *        .  :    .:.

SYY_AQUAE       RMLEREDFSKRFKEGIPIYIHEFIYPLLQAYDSVAIKADVEIGGTDQKFNLLIGRDIQRE
SYY_THEMA       RMLERDDFAKRFKEGIPIAISEFLYPLAQAYDSVAIQSDVELGGTDQLFNLLVGRKIQEE
SYY_HAEIN       RMLERDDFKKRFGNNQPIAIHEFIYPLLQGYDSVALDADVELGGTDQKFNLLVGRELQKS
SYY_HAEI8       RMLERDDFKKRFGNNQPIAIHEFIYPLLQGYDSVALDADVELGGTDQKFNLLVGRELQKS
SYY_MANSM       RMLERDDFKKRFTEKQPIAIHEFIYPLLQGHDSVALEADVELGGTDQKFNLLVGRELQKS
SYY_PASMU       RMLERDDFKKRFSNNQPIAIHEFIYPLLQGYDSVALDADIELGGTDQKFNLLVGRELQKS
SYY_HAEDU       RMLERDDFKKRFTNNQPIAIHEFIYPLLQGYDSVALQADVELGGTDQTFNLLVGRELQKS
SYY_PHOPR       RMLERDDFKKRYNGGRPIAIHEFMYPLLQGYDSVAMETDVELGGTDQKFNLLMGRELQKS
SYY2_VIBCH      RMLERDDFKKRYNNGQPIAIHEFMYPLLQGYDSVAMETDVELGGTDQKFNLLMGRELQKA
SYY2_VIBVU      RMLERDDFKKRYAGGQPIAIHEFMYPLLQGYDSVAMETDVELGGTDQKFNLLMGRELQKA
SYY2_VIBVY      RMLERDDFKKRYAGGQPIAIHEFMYPLLQGYDSVAMETDVELGGTDQKFNLLMGRELQKA
SYY2_VIBPA      RMLERDDFKKRYAGGQPIAIHEFMYPLLQGWDSVAMETDVELGGTDQKFNLLMGRELQKS
SYY_SHEON       RMMERDDFKKRYASGQSIAIHEFMYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKA
SYY_FRATT       RMLERDDFSKRYKGGQSISIHEFLYPLVQGYDSVAMNADIELGGTDQKFNLLMGRELQKQ
SYY_COLP3       RMMERDDFKKRYANGQAIAIHEFMYPLVQGWDSVALEADVELGGTDQKFNLLMGRELQKS
SYY2_PSET1      RMLERDDFKKRYASGQSIAIHEFLYPLVQGWDSVALEADVELGGTDQRFNLLMGRELQKD
SYY_IDILO       RMLERDDFKKRYQNNQSIAIHEFLYPLVQGWDSVELKADVELGGTDQRFNLLMGRELQKE
SYY_HYDCU       RMLERNDFGERYQSNTPIAIHEFLYPLVQGYDSVALDSDIELGGTDQKFNLLMGRTLQQH
SYY_LEGPH       RMLERDDFNKRYTTGQPIAIHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKH
SYY_LEGPL       RMLERDDFNKRYTTGQPIAIHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKH
SYY_LEGPA       RMLERDDFNKRYTTGQPIAIHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKH
SYY_COXBU       RMLERDDFNKRYLSQQPIAIHEFLYPLLQGYDSVALKADVELGGTDQKFNLLVGRELQKH
SYY_METCA       RMLERDDFAKRYAGGQPISIHEFLYPLIQGYDSVALKADVELGGADQKFNLLVGRHLQEI
SYY_NITOC       RMLERDDFYKRYQGKRPIAIHEFLYPLLQGYDSVALKADVELGGTDQKFNLLVGRDLQKA
SYY_AROAE       RMLERDDFAKRYAGGQAIAIHEFLYPLCQGYDSVAMRADVELGGTDQKFNLLVGRELQKH
SYY_THIDA       RMLERDDFQKRYSSQKPIAIHEFLYPLIQGYDSVELKADVELGGTDQKFNLLMGRELQKH
SYY_NITEU       RMLERDDFSKRYHENRPIAIHEFLYPLVQGYDSVALKADLELGGTDQKFNLLVGRELQKH
SYY_NITMU       RMLERDDFGKRYQSNKPIAIHEFLYPLIQGYDSVALRADIELGGTDQKFNLLMGRELQKH
SYY_BORBR       RMMEREDFTRRFKGGVPIAVHEFLYPLLQGYDSVALKADLELGGTDQKFNLLVGRELQKE
SYY_BORPE       RMMEREDFTRRFKGGVPIAVHEFLYPLLQGYDSVALKADLELGGTDQKFNLLVGRELQKE
SYY_BORPA       RMMEREDFTRRFKGGVPIAVHEFLYPLLQGYDSVALKADLELGGTDQKFNLLVGRELQKE
SYY_BORA1       RMMEREDFTRRFKTGVPIAVHEFLYPLMQGYDSVALKADLELGGTDQKFNLLVGRELQKE
SYY_BURP1       RMLEREDFTKRFQGGIPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQ
SYY_BURPS       RMLEREDFTKRFQGGIPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQ
SYY_BURMA       RMLEREDFTKRFQGGIPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQ
SYY_BURTA       RMLEREDFTKRFQGGIPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQ
SYY_BURL3       RILEREDFTKRFQGGVPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQ
SYY_CUPPJ       RMMERDDFTKRFRSGIPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKE
SYY_RALSO       RMMERDDFTKRYKAGVPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKE
SYY_ACIAD       RMLERDDFTKRYNNHQPIAIHEFLYPLVQGYDSIALEADVELGGTDQTFNLLMGRTLQGR
SYY_PSYA2       RMLERDDFSKRYASQTPIAIHEFLYPLVQGYDSIALKADVELGGTDQTFNLLMGRTLQGR
SYY_PSE14       RMLERDDFDKRYKSNQSIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRA
SYY_PSEU2       RMLERDDFDKRYKSNQSIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRA
SYY_PSESM       RMLERDDFDKRYKSNQSIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRA
SYY_PSEF5       RMLERDDFDKRYSTNQPIAIHEFLYPLVQGYDSVALRADVELGGTDQKFNLLMGRELQRG
SYY_PSEPF       RMLERDDFDKRYTTNQPIAIHEFLYPLVQGYDSVALRADVELGGTDQKFNLLMGRELQRG
SYY_PSEPK       RMLERDDFDKRYTTNQPIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRS
SYY2_PSEAE      RMLERDDFSKRYASNQPIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRA
SYY_HAHCH       RMLERDDFHKRYHGEQSISIHEFLYPLVQGYDSVALRADVELGGTDQKFNLLMGRMLQKH
SYY_XANAC       RMLERDDFAKRFGSQQPIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRGLQEH
SYY_XANC5       RMLERDDFAKRFGSQQPIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRGLQEH
SYY_XANOM       RMLERDDFAKRFGSQQPIAIHEFLYPLVQGYDSVALRADVELGGTDQKFNLLMGRGLQEH
SYY_XANOR       RMLERDDFAKRFGSQQPIAIHEFLYPLVQGYDSVALRADVELGGTDQKFNLLMGRGLQEH
SYY_XANC8       RMLERDDFAKRFAGQQPIAIHEFLYPLVQGYDSVALKADVELGGTDQTFNLLMGRGLQEH
SYY_XANCP       RMLERDDFAKRFAGQQPIAIHEFLYPLVQGYDSVALKADVELGGTDQTFNLLMGRGLQEH
SYY_XYLFA       RMLERDDFAKRFVSQQPIVIHEFLYPLIQGYDSIALRADVELGGTDQKFNLLMGRALQEH
SYY_XYLFT       RMLERDDFAKRFASQQPIVIHEFLYPLIQGYDSIALRADVELGGTDQKFNLLMGRALQEH
SYY_DESAG       RMLERDDFEKRYRSNMTISIHEFLYPLVQGYDSVALEADVELGGTDQKFNLLVGRHLQSQ
SYY_DESVH       RMMERDDFEKRYKEGRPIAVHEFLYPLVQGYDSVALKADVELGGTDQKFNLLVGRHLQSQ
SYY_GEOMG       RMLERDDFGKRFANQLPISIHEFLYPLIQGYDSVALKADVELGGTDQKFNLLVGRELQRV
SYY_GEOSL       RMLERDDFGKRFANQLPISIHEFLYPLIQGYDSVALQADVELGGTDQKFNLLVGRELQRE
SYY_PELCD       RMLERDDFHKRFSGQQPIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLVGRELQKQ
SYY_DESPS       RMLEREDFKNRYESGKPISIHEFMYPLIQGYDSVALEADVEIGGTDQRFNVLMGRDLQRS
SYY_HELPY       RMLERDDFTKRYKENRPISIVEFLYPLLQGYDSVAMDADIELGGNDQKFNLLVGRFLQRA
SYY_HELPJ       RMLERDDFAKRYKENRPISIVEFLYPLLQGYDSVAMGADIELGGNDQKFNLLVGRFLQRA
SYY_CAMJE       RMLERDDFTKRFKEQSPISICEFLYPLLQGYDSVALKSDIEMGGTDQKFNLLMGRQLQRV
SYY_CAMJR       RMLERDDFTKRFKEQSPISICEFLYPLLQGYDSVALKSDIEMGGTDQKFNLLMGRQLQRV
SYY_SULDN       RMLERDDFDKRYKSGTSIAISEFLYPLLQGYDSVHLKSDIEVGGTDQKFNLLMGRHLQRS
SYY_HELHP       RMLERDDFTKRYNNNQSISIVEFIYPLLQGYDSVALNCDIELGGNDQKFNLLVGRSLQRA
SYY_WOLSU       RMLERDDFEKRYKSQTPISLVEFIYPLLQGYDSVALESDVEFGGTDQKFNLLMGRHLQRS
SYY_ACIFR       RMLERDDFNKRYSANQPIAIHEFLYPLLQGYDSVAIKADVELGGTDQRFNLLVGRELQRE
SYY_BDEBA       QLLEREDFTKRYRSGTPIGIHEFIYPLTQGYDSVALKTDVELGGTDQKFNLLVGRAMQAA
SYY_LEPIC       RMLERDDFSKRYKAGQPISMIEFLYPLVQGYDSVAMECDVELGGTDQKFNLLVGRDLQRE
SYY_LEPIN       RMLERDDFSKRYKAGQPISMIEFLYPLVQGYDSVAMECDVELGGTDQKFNLLVGRDLQRE
SYY2_BACSU      RLMERDDFEERIAMQKPISLHEFFYPLMQGYDSVVLESDIELGGTDQHFNVLMGRHFQER
SYY2_BACLD      RLMERDDFEERIAMQKPISLHEFFYPLMQGYDSVVLDSDIELGGTDQHFNVLMGRHFQEK
SYY_BACHD       RMLERDDFEKRYKSGQPISIHEFFYPLMQGYDSVALESDIEIGGTDQKFNLLMGRMLQEA
SYY_BACSK       RMLEREDFSKRYKTGQPISVHEFFYPLMQGYDSVAMETDIEVGGTDQTFNLLMGRQLQEA
SYY2_CLOAB      RMLEREDFKKRFKNQQSIGIHEFFYPLMQAYDSMAIKADIEFGGTDQRFNLLMGRTLQAE
SYY_CARHZ       RMLEREDFAKRFKEGQPISIHEFFYPLMQGYDSVALKADIELGGTDQKFNLLMGRTLQKE
SYY_MOOTA       RMLERDDFARRFQENRPISIHEFFYPLMQGYDSVALAADVELGGTDQKFNLLMGRHLQRE
SYY_DEHM1       QMLARDDFAKRYAAGKPISVTELLYPMLQAYDSVMVKSDVEFGGTDQKFNLLVGRELQEM
SYY_DEHMC       QMLARDDFAKRYAAGKPISVTELLYPMLQAYDSVMVKSDVEFGGTDQKFNLLVGRELQEM
SYY2_PHOLL      QIMHRDDFKTRFESKAPVHLHEIIYPILQGYDSVMIDADIELGGTDQLFNNLVGRTLQEA
SYY_CHLCH       RMLERNDFEQRYRAQEPISIHEFLYPLAQGMDSVHLKNDVELGGTDQKFNLLVGRDLQRE
SYY_PELLD       RMLERDDFERRYRSSEPISIHEFLYPLAQAMDSVHLRNDVELGGTDQKFNLLVGRDLQRE
SYY_CHLTE       RMLERDDFEKRYRSQTPISIHEFLYPLAQGMDSVHLKNDVELGGTDQKFNLLVGRDLQRE
SYY_SALRD       QMLKRDDFNERYEAGQPISLHEFLYPLAQARDSVHIEADVELGGTDQRFNLLLARRLQEA
SYY_SYMTH       RMLEREDFKKRYEEGRPIFIHEFFYPLMQGTDSVAVQADVELGGTDQKFNLLAGRDLQRD
SYY_THET2       QMLEREDFKKRYEAGIPISLHELLYPFAQAYDSVAIRADVEMGGTDQRFNLLVGREVQRA
SYY_THET8       QMLEREDFKKRYEAGIPISLHELLYPFAQAYDSVAIRADVEMGGTDQRFNLLVGREVQRA
SYY_DEIRA       RILERDDFTKRLSAGTPISMHELLYPLTQGYDSVALHADVELGGTDQLFNNLVGRALQRD
SYY_SYNP6       QMLAKEGFSERYDKGTPVYLHEFLYPLMQGYDSVAVQSDVELGGTDQKFNIAVGRDLQRH
SYY_SYNE7       QMLAKEGFSERYDKGTPVYLHEFLYPLMQGYDSVAVQSDVELGGTDQKFNIAVGRDLQRH
SYY_SYNY3       QMLAKEGFAERFQKENPIFLHEFLYPLMQGYDSVAVNADVELGGTDQKFNIAVGRDLQRH
SYY_THEEB       QMLAKEGFAERYAKETPIFLHEFLYPLMQGYDSVAVAADVELGGTDQKFNIAVGRDLQRH
SYY_NOSS1       QMLAKEGFADRYKKENPIFLHEFLYPLMQGYDSVAIEADVELGGTDQKFNIAVGRDLQRH
SYY_TRIV2       QMLAKEGFADRYKKENPIFLHEFLYPLMQGYDSVAIEADVELGGTDQKFNIAVGRDLQRH
SYY_PROM9       QMLAKEEFNKRYNSQVPIALHEFLYPLLQGYDSVVVQSDIELGGTDQKFNIAIGRDLQRH
SYY_PROMP       QMLAKEEFNKRYNSQTPIALHEFLYPLLQGYDSVAVNSDIELGGTDQKFNIAIGRDLQRH
SYY_SYNPX       QMLAKDDFSKRYGSGTPIALHEFLYPLLQGYDSVAVNADVELGGTDQKFNVAMGRDLQRH
SYY_SYNSC       QMLAKDDFSKRYGSGTPIALHEFLYPLLQGYDSVAVNADVELGGTDQKFNVAMGRDLQRH
SYY_SYNS9       QMLAKEDFSNRYNSGTPIALHEFLYPLLQGYDSVAVNADVELGGTDQKFNVAMGRDLQRH
SYY_PROMM       QMLAKEDFGNRYGSGVPIALHEFLYPLLQGYDSVAVQADVELGGTDQKFNVAMGRDLQRH
SYY_PROMA       QMLAKEEFANRYTSGTSIALHEFLYPLFQGYDSVAVQADVELGGVDQKFNVAMGRDMQRH
SYY_PROMT       QMLAKEDFSNRYKSGTPISLHEFLYPLLQGYDSVAINSDVELGGTDQKFNIAMGRDLQKA
SYY_SYNJA       QMLAKEDFAQRYRSGTPIYLHEFLYPLLQGYDSVALEADVELGGTDQRFNLLVGRELQLW
SYY_SYNJB       QMLAKEDFAQRYQAGTPVYLHEFLYPLLQGYDSVALAADVELGGTDQRFNLLTGRDLQIW
SYY_GLOVI       QMLAKEDFGQRYEAGTAIYLHEFLYPLMQGYDSVALDADIELGGTDQRFNLLMGRNLQEL
                ::: :: *  *     .: : *::**: *. **: :  *:*.** ** **   .* .*  

SYY_AQUAE       YGQ-EPQVCITLPLLVGTDGVRKMSKSYGNYVGITEDPKTMFAKIMSIPDEIMWDWFLLL
SYY_THEMA       YGQ-EPQIVMTMPIIEGTDGKLKMSKSYGNYIAFNDPPEEMYGKLMSIPDELIIKYMRLL
SYY_HAEIN       AGK-KPQVAITLPLLVGLDGEKKMSKSLGNYIGVTEAPSDMFGKVMSISDELMWDWYNLL
SYY_HAEI8       AGK-KPQVAITLPLLVGLDGEKKMSKSLGNYIGVTEAPSDMFGKVMSISDELMWDWYNLL
SYY_MANSM       AGQ-KPQVAMTLPLLVGLDGEKKMSKSLGNYIGVTDAPNDMFGKIMSISDDLMWDWYDLL
SYY_PASMU       AGQ-KPQVAITLPLLVGLDGEKKMSKSLGNYIGVAESPTEMFGKVMSISDELMWDWYDLL
SYY_HAEDU       AEQ-KPQVAITLPLLVGLDGEKKMSKSLGNYIGVTEAPNEMFGKVMSISDELMWDWYNLL
SYY_PHOPR       HGQ-KPQVVLTMPLLVGLDGVKKMSKSAHNYIGVSEVPTEMFGKIMSISDDLMWNYFECL
SYY2_VIBCH      NGQ-KPQVVLMMPLLVGLDGEKKMSKSAHNYIGVSEAPSEMFGKIMSISDDLMWSYYELL
SYY2_VIBVU      NGQ-KPQVVLMMPLLVGLDGEKKMSKSANNYIGVSEAPSEMFGKIMSISDDLMWSYYELL
SYY2_VIBVY      NGQ-KPQVVLMMPLLVGLDGEKKMSKSANNYIGVSEAPSEMFGKIMSISDDLMWSYYELL
SYY2_VIBPA      HGQ-KPQVVLMMPLLVGLDGEKKMSKSAGNYIGISEAPSEMFGKIMSISDDLMWSYYELL
SYY_SHEON       EGQ-KPQAVIMMPLLEGLDGVKKMSKSAHNYIGVSEPANEMFGKIMSISDELMWRYFELL
SYY_FRATT       QGQ-EPQVIITMPLLEGLDGVKKMSKSSQNYIGIEEPANEIFGKIMSISDEFMWRYYELL
SYY_COLP3       EGQ-RPQTVLMMPLLEGLDGVQKMSKSLGNYIGITDTPTDMFGKIMSISDVLMWRYYELL
SYY2_PSET1      EGQ-KPQTVIMTPLLEGTDGVQKMSKSLGNYIGITDAPNDMFGKIMSISDVLMWRYYDLL
SYY_IDILO       EGQ-RPQTVIMTPLLEGLDGVQKMSKSLNNYIGITEPANDMFGKIMSVSDELMWRYFQLL
SYY_HYDCU       YGK-EAQCTLTMPILEGLDGVQKMSKSLNNYIGIKDAPNDMFGKVMSVSDELMWRYFELL
SYY_LEGPH       YGF-EPQVVMMTPLIEGLDGVKKMSKSLDNYIGINETPEQMFGKIMSVSDELMWRYIDLL
SYY_LEGPL       YGF-EPQVVMMTPLIEGLDGVKKMSKSLDNYIGINETSEQMFGKIMSVSDELMWRYIDLL
SYY_LEGPA       YGF-EPQVVMMTPLIEGLDGVKKMSKSLDNYIGINETPEQIFGKIMSVSDELMWRYIDLL
SYY_COXBU       FGQ-RPQCVLTVPLLEGLDGIQKMSKSLNNYIGITEPPEEMFGKVMSISDELMWRYYELL
SYY_METCA       YGQ-TPQVVMTMPILEGLDGIQKMSKSLGNYIGIADPPDDMFGKIMSISDDLMWRYYDLL
SYY_NITOC       YGQ-EQQIIITMPILEGLDGVQKMSKSLGNYIGISEPPREIFGKLMSISDDLMWRYLELL
SYY_AROAE       DRQ-APQCVLMMPLLEGLDGVNKMSKSLGNYIGITEAPREIFGKIMSISDSLMWRYFDLL
SYY_THIDA       YGQ-PPQCILTMPLLEGTDGVNKMSKSLGNYIGINEAPGQIFGKLMSISDALMWRYIDLL
SYY_NITEU       YGQ-PPQCILTMPLLEGLDGIQKMSKSLNNYVGINESPAEIFGKLMSVSDTLMWRYIELL
SYY_NITMU       FGQ-ASQCVITMPLLEGLDGVNKMSKSAGNYIGITESPGNMFGKLMSISDELMWRYIELL
SYY_BORBR       YGQ-EQQCILTMPLLVGTDGVEKMSKSKGNYIGISEAPESMFGKLMSISDTLMWRYYELL
SYY_BORPE       YGQ-EQQCILTMPLLVGTDGVEKMSKSKGNYIGISEAPESMFGKLMSISDTLMWRYYELL
SYY_BORPA       YGQ-EQQCILTMPLLVGTDGVEKMSKSKGNYIGISEAPESMFGKLMSISDMLMWRYYELL
SYY_BORA1       YGQ-EPQCILTMPLLVGTDGVDKMSKSKGNYIGISESPDSMFGKLMSISDTLMWRYFELL
SYY_BURP1       YGQ-EQQCILTMPLLEGLDGVEKMSKSKGNYVGISEKPTDMFGKLMSISDVLMWRYFELL
SYY_BURPS       YGQ-EQQCILTMPLLEGLDGVEKMSKSKGNYVGISEKPTDMFGKLMSISDVLMWRYFELL
SYY_BURMA       YGQ-EQQCILTMPLLEGLDGVEKMSKSKGNYVGISEKPTDMFGKLMSISDVLMWRYFELL
SYY_BURTA       YGQ-EQQCILTMPLLEGLDGVEKMSKSKGNYVGIGEKPNDMFGKLMSISDVLMWRYFELL
SYY_BURL3       YGQ-EQQCILTMPLLEGLDGVEKMSKSKGNYVGISEQPTDMFGKLMSISDTLMWRYFELL
SYY_CUPPJ       YGQ-EPQCILTMPLLVGLDGVEKMSKSKGNYVGVTEAPNEMFGKLMSISDDLMWQYFTLL
SYY_RALSO       YGQ-EPQCILTMPLLVGLDGVEKMSKSKGNYVGISEAPNEMFGKLMSISDDLMWTYYTLL
SYY_ACIAD       YGQ-ESQVCITVPILEGLDGVNKMSKSLGNYIGVFDAPGAMYQKVLSMPDTLIERYFELL
SYY_PSYA2       YGQ-EQQVCITVPILEGLDGVNKMSKSLNNYVGIYDAPGTMYQKLLSMPDTLIRRYFEFL
SYY_PSE14       YGQ-EPQCILTMPLLEGLDGVKKMSKSLGNYVGIQEAPGIMYSKLVSIPDSLMWRYFELL
SYY_PSEU2       YGQ-EPQCILTMPLLEGLDGVKKMSKSLGNYVGIQEAPGIMYSKLVSIPDSLMWRYFELL
SYY_PSESM       YGQ-EPQCILTMPLLEGLDGVKKMSKSLGNYVGIQEAPGIMYSKLVSIPDSLMWRYFELL
SYY_PSEF5       YGQ-EAQCILTMPLLEGLDGVKKMSKSLGNYVGIQEAPGVMYGKLVSIPDALMWRYFELL
SYY_PSEPF       YGQ-EAQCILTMPLLEGLDGVKKMSKSLGNYVGIQEAPGVMYSKLVSIPDALMWRYFELL
SYY_PSEPK       YGQ-EAQNIVTMPLLEGLDGVKKMSKSLGNYVGIQEAPGVMYSKLVSIPDTLMWRYFELL
SYY2_PSEAE      YGQ-EAQVILTMPLLEGLDGVKKMSKSLGNYIGIQEAPGVMYSKLVSIPDTLMWRYFELL
SYY_HAHCH       YDQ-EPQVIMTMPILEGLDGVQKMSKSLGNYIGVNDLPGEMFGKLLSIPDELMWRYFELL
SYY_XANAC       YGQ-APQIVLTMPLLEGLDGVAKMSKSLGNYIGINEPAIDIVTKTMKIGDALTWRWIDLL
SYY_XANC5       YGQ-APQIVLTMPLLEGLDGVAKMSKSLGNYIGINEPAIDIVTKTMKIGDELTWRWIDLL
SYY_XANOM       YGQ-APQIVLTMPLLEGLEGVAKMSKSLGNYIGINEPAIDIVTKTMKIGDELTWRWIDLL
SYY_XANOR       YGQ-APQIVLTMPLLEGLEGVAKMSKSLGNYIGINEPAIDIVTKTMKIGDELTWRWIDLL
SYY_XANC8       YGQ-APQVVLTMPLLEGLDGVAKMSKSLGNYIGINEPAIDIVTKTMKIGDTLTWRWIDLL
SYY_XANCP       YGQ-APQVVLTMPLLEGLDGVAKMSKSLGNYIGINEPAIDIVTKTMKIGDTLTWRWIDLL
SYY_XYLFA       HGQ-PPQVVLTMPLLEGLDGVAKMSKSLGNYIGIKEPPIDIVTKTMKIGDDLMWRWIELL
SYY_XYLFT       HGQ-PPQIVLTMPLLEGLDGVAKMSKSLGNYIGIKEPPIDIVTKTMKIGDDLMWRWIELL
SYY_DESAG       EGQ-EPQCVLTVPILEGLDGVKKMSKSLGNYVGIDEPPADMFGKLMSVSDELMWRYYELI
SYY_DESVH       YGQ-EPQCILTMPLLEGLDGVKKMSKSLGNYVGIDESPADMFGKLMSVSDELMWRYFELI
SYY_GEOMG       WKQ-SPQSVITMPLLEGLDGVNKMSKSLGNYIGINEPADEIFGKIMSISDELMLRYYELL
SYY_GEOSL       WGQ-TPQTVITMPLLEGLDGVNKMSKSLGNYIGINEPADEIFGKIMSISDELMLRYYELL
SYY_PELCD       EGQ-VPQCVLTMPLLEGLDGVNKMSKSLGNYIGITEPAKEVFGKVMSISDELMLRYYELL
SYY_DESPS       RGQ-APQVVLTLPLLEGLDGVNKMSKSLGNYIGITEDADSIYGKVLSVSDDLMFRYYELL
SYY_HELPY       YGLNKEQSVITMPLLEGLDGVQKMSKSLGNYVGITEEPNAMFGKIMSVSDDLMWRYYTLL
SYY_HELPJ       YGLNKEQSIITMPLLEGLDGVQKMSKSLGNYVGITEEPNAMFGKIMSVSDDLMWRYYTLL
SYY_CAMJE       YNIGKEQAVIMMPLLEGLDGVNKMSKSLNNYIGVTEKANDMYAKILSISDELMFRYYELL
SYY_CAMJR       YNIGKEQAVIMMPLLEGLDGVNKMSKSLNNYIGVTEKANDMYAKILSISDELMFRYYELL
SYY_SULDN       YDVGKEQAVLMVPILEGLDGVQKMSKSLGNYIGVSENPNEIFGKVLSISDELMWRYYELL
SYY_HELHP       YKLNKEQSVMTLPLLEGLDGVHKMSKSLNNYIGVTESANTMYAKILSINDEMMWRYYELL
SYY_WOLSU       YGLKKEQSVLMVPILEGLDGVQKMSKSLGNYIGVTEEPNTMYAKVLSVSDELMWRYYELL
SYY_ACIFR       YGQ-KPQLVLTMPILEGLDGVQKMSKSLGNFIAVEDPPAEMFGKIMSISDFLMWRYYALL
SYY_BDEBA       YGM-EAQCVLTMPILEGIDGVNKMSKSLDNYISVVDTPKDMFGKTMRISDELMYRWYELL
SYY_LEPIC       YGK-EAQCVLTLPLLVGLDGSKKMSKSLGNYVGITETPIDMFGKLMSISDDLMWNYFELL
SYY_LEPIN       YGK-EAQCVLTLPLLVGLDGSKKMSKSLGNYVGITETPIDMFGKLMSISDDLMWNYFELL
SYY2_BACSU      YNK-EKQVVILMPLLEGLDGVEKMSKSKHNYIGINEHPNDMYGKTMSLPDSLMKKYIHLA
SYY2_BACLD      YGK-EKQVVILMPLLEGLDGIEKMSKSKNNYIGIDEDPHEMFGKTMSLPDSLMKKYIHLA
SYY_BACHD       YGN-DKQVAITMPLIEGLDGERKMSKSLNNYIGIDEAPNEIFGKAMSIPDELMVKYYELA
SYY_BACSK       YGK-EKQVMLTLPLIEGLDGVRKMSKSLNNYIGIDEAPNEIFGKAMSIPDELMVKYYKLA
SYY2_CLOAB      YGE-EKQIAIFMPLLEGIDGKEKMSKSLGNYIGIEESAKDMYVKVMQIPDSLIIKYFELC
SYY_CARHZ       YGQ-EPQIAIMMPILEGTDGVQKMSKSLGNYIGINETPQEMFGKIMSIPDTLILRYLELL
SYY_MOOTA       YGQ-EPQVAMMMPILPGLDGVQKMSKSLGNYIGIKESPREMYGKTMSLPDELMLTYYELV
SYY_DEHM1       LGQ-KPQQVLMVPILVGTDGVHKMSKSLGNYIGVAEEPTEIFGKCMSIPDELILQYFELV
SYY_DEHMC       VGQ-KPQQVLMVPILVGTDGVHKMSKSLGNYIGVAEDPSEIFGKCMSIPDELILQYFELV
SYY2_PHOLL      YEK-KGQIVITMPLLEGLDGIEKMSKSKNNYIGLTDNANDMYGKVMSIPDSVIINYLTLA
SYY_CHLCH       YGI-APQVCITMPLLVGTDGKDKMSKSLDNAISFTDTPNDMYGRALSIPDTLIETYSRLL
SYY_PELLD       YGI-LPQVCITMPLLVGTGGEDKMSKSLGNAVCFNDLPSDMYGRVLSIPDTLIENWCRLL
SYY_CHLTE       YGI-EPQVCITMPLLVGTDGSEKMSKSLGNAICFNDTPEDMYGRTLSIPDSLIETYWNLL
SYY_SALRD       NDQ-AAQVCMMLPLLEGTDGSDKMSKSLDNAIGIAEAPEDMYGKTMSVPDDLIYRYVELV
SYY_SYMTH       AGQ-EPQVCLMTPIVEGLDGVQKMSKSLGNYIGLDHTPDEMFGRTMSIPDSLIITYFTYF
SYY_THET2       YGQ-SPQVCFLMPLLVGLDGREKMSKSLDNYIGLTEPPEAMFKKLMRVPDPLLPSYFRLL
SYY_THET8       YGQ-SPQVCFLMPLLVGLDGREKMSKSLDNYIGLTEPPEAMFKKLMRVPDPLLPSYFRLL
SYY_DEIRA       YGQ-EAQVVLTLPLLVGLDGTEKMSKSLDNYIGLTDEPHAMFAGLMKVPDPLLDNYFTLL
SYY_SYNP6       FGL-QPQFGLLLPILIGLDGSQKMSKSLGNYVGLNEDALSMYSKLEKVPDALVADYFELL
SYY_SYNE7       FGL-QPQFGLLLPILIGLDGSQKMSKSLGNYVGLNEDALSMYSKLEKVPDALVADYFELL
SYY_SYNY3       FGK-TPQFGLLLPILLGTDGQQKMSKSLNNYVGLQEDALSMYSKLEKTPDRLLGEYFELL
SYY_THEEB       FRLPTVQFGLLMPILVGTDGVQKMSKSLGNYVALTESAASMYSKLEKIPDALVNQYIELL
SYY_NOSS1       FGQ-KPQFGVLLPILIGTDGVQKMSKSLGNYVSLSEHPGQKYQKLQGVPDVLLKDYFELL
SYY_TRIV2       FGQ-KPQFGVLLPILIGTDGVQKMSKSLGNYVSLSEHPGQKYQKLQGVPDQMLEQYFELL
SYY_PROM9       FKQ-EPQFGVLLPILTGLDGIKKMSKSEFNTVGLTEDSLSMYSKLEKVPDNIIPTYFELL
SYY_PROMP       FKQ-EPQYGILLPILTGLDGIKKMSKSESNTVGLSEDSLSMYSKLEKVPDNIIPSYFELL
SYY_SYNPX       FNK-GTQFGLLLPILVGLDGVQKMSKSLGNVVGLEEDPLSMYSKLEKVGDGAINDYVTLL
SYY_SYNSC       FNK-GTQFGLLLPILVGLDGVQKMSKSLGNVVGLEEDPLSMYSKLEKVGDAAIDDYVTLL
SYY_SYNS9       FGR-GTQFGLLLPILVGLDGAQKMSKTLGNTVGLEDDPLSMYSKLEKVGDTAINDYVTLL
SYY_PROMM       FDQ-RPQFGLLLPILAGLDGVQKMSKSLSNTVGLNEDPLSMYSKLEKVPDALVSSYVVLL
SYY_PROMA       FSQ-KPQFGLLLPILVGLDGVQKMSKSLGNTVGLAEDALSMYSKLEKVPDSQVNNYLTLL
SYY_PROMT       FGQ-KPQFGMLLPILVGLDGARKMSKSLDNIVGINEDSLSMYSKLEKVPDDLVLTYLNLL
SYY_SYNJA       KGQ-TPQFCLTVPLLEGLDGYQKMSKSKNNYVGLTEDPLTMYSKLEKVPDQLVERYFELL
SYY_SYNJB       KGQ-APQFCLTVPLLEGLDGYQKMSKSKNNYVGLTEDPLTMYSKLEKVPDHLVERYFELL
SYY_GLOVI       FGK-KPQLALTVPLLVGLDGVKKMSKSLDNYVGVTEDPLTMYSKLEKTPDALVETYFELL
                      *  .  *:: *  *  ****:  * : . . .           *     :    

SYY_AQUAE       TDY-NKEEIEKMRREM-------HPMEAKKLLAFTIVKRFHS------------------
SYY_THEMA       TDI-PEERIEEYERKMKE--KTINPRDVKMVLAYEITRFFHG------------------
SYY_HAEIN       SFR-PLNEIAQLKSEVEN--GK-NPRDVKILLAKELIARFHN------------------
SYY_HAEI8       SFR-PLSEIAQLKSEVEK--GK-NPRDVKILLAKELIARFHN------------------
SYY_MANSM       SFR-PLTEIAQFKEEVKN--GR-NPRDVKILLAKEIIARFHS------------------
SYY_PASMU       SFR-PLTEIAQLKQEVEN--GR-NPRDIKVLLAKELIARFHS------------------
SYY_HAEDU       SFR-PLAEITQLKADVDA--GK-NPRDVKILLAKEIITRFHS------------------
SYY_PHOPR       SFR-PLEEIEQFKQDMAN--GK-NPRDVKILLAKEIIARFHS------------------
SYY2_VIBCH      SFR-PLEEVAQFKAEVAN--GA-NPRDIKILLAKEIIARFHS------------------
SYY2_VIBVU      SFR-PLEELAQFKADVAA--GK-NPRDIKVLLAKEIIARFHS------------------
SYY2_VIBVY      SFR-PLEELAQFKADVAA--GK-NPRDIKVLLAKEIIARFHS------------------
SYY2_VIBPA      SFR-PLEEIEQFKADVQA--GK-NPRDIKVLLAKEIIARFHS------------------
SYY_SHEON       SFR-PLAEIEQFKQDIAN--GA-NPRDTKISLAKEIIARFHD------------------
SYY_FRATT       SFK-SLENIAKLKQDVAA--GA-NPRDIKIELAKELIERFHS------------------
SYY_COLP3       SFK-PLEEIEGYKTEIEN--GK-NPRDVKIDLAKELIARFHD------------------
SYY2_PSET1      SGL-SIAGINAQKERVEQ--GT-NPRDIKIELAKELIARFHS------------------
SYY_IDILO       SFR-SITEIDELKAAVAD--GK-NPRDVKVLLAKEIIARFHS------------------
SYY_HYDCU       SFE-SLETIAGYKDAVAN--GE-NPRNIKIKLALELIERFHD------------------
SYY_LEGPH       SFK-TGKEIQQLKQSVLE--GK-NPRDVKIDFAKEIVARFHD------------------
SYY_LEGPL       SFK-TGKEIQQLKQSVLE--GK-NPRDVKIDFAKEIVARFHD------------------
SYY_LEGPA       SFK-TGKEIQQLKQSVLE--GK-NPRDVKIDFAKEIVARFHD------------------
SYY_COXBU       SFR-PMREINRWREEVSE--GR-NPRDIKILLAEELVTRFHS------------------
SYY_METCA       SFA-PLAEVARWRRECSE--GA-NPRDVKVRLGQEIVERFHG------------------
SYY_NITOC       SSR-PMSEISRWKKEVEQ--GA-NPRDIKVKLAKEIVARFHD------------------
SYY_AROAE       SFH-PAVEIARYRAEVEG--GR-NPRELKVLLAQEIVARFHS------------------
SYY_THIDA       SFE-SIARIEGWRSDVAA--GL-NPREVKVAFAQEIVGRFHG------------------
SYY_NITEU       SFE-SLETVRQWQNEVES--GC-NPREIKMRFAREIVARFHS------------------
SYY_NITMU       SFE-PLRVVRQWQQDVGN--GR-NPRDIKVLFAQEIVTRFHS------------------
SYY_BORBR       SFR-SLADIAALKAEIDG--GR-NPRDAKVALAQEIVARFHS------------------
SYY_BORPE       SFR-SLADIAALKAEIDG--GR-NPRDAKVALAQEIVARFHS------------------
SYY_BORPA       SFR-SLADIAALKAEIDG--GR-NPRDAKVALAQEIVARFHS------------------
SYY_BORA1       SFR-SLEDIAALKAEIDA--GR-NPRDAKVALAQEIITRFHS------------------
SYY_BURP1       SFR-SLDEIARFRGEAEG--GR-NPRDFKVMLAQEIVARFHS------------------
SYY_BURPS       SFR-SLDEIARFRGEAEG--GR-NPRDFKVMLAQEIVARFHS------------------
SYY_BURMA       SFR-SLDEIARFRGEAEG--GR-NPRDFKVMLAQEIVARFHS------------------
SYY_BURTA       SFR-SLDEIARLRGEAEG--GR-NPRDFKVMLAQEIVARFHS------------------
SYY_BURL3       SFR-PMDEIGGFKREIEG--GR-NPRDFKVLLAQEIVARFHS------------------
SYY_CUPPJ       SFR-PLAEIDLMKQEIAA--GR-NPRDCKVLLAQEIVARFHS------------------
SYY_RALSO       SFR-PLAEIDLMKQEVTL--GR-NPRDCKVLLAQEIIARFHS------------------
SYY_ACIAD       SFK-SLDEIQGLLDEMAN--GR-NPQDLKKILALELVERFHD------------------
SYY_PSYA2       SFK-PMEEVENLMAEMED--GR-NPQEIKRILAEELIERFHD------------------
SYY_PSE14       SFR-SMEEINGLKADCEA--GA-NPRDIKIKLAEELVARFHG------------------
SYY_PSEU2       SFR-SMEEIDGLKADCEA--GA-NPRDIKIKLAEELVARFHG------------------
SYY_PSESM       SFR-SMEEINGLRADCEA--GA-NPRDIKIKLAEELVARFHG------------------
SYY_PSEF5       SFR-SMDEINAFKADVDA--GA-NPRDIKIKLAEEIVARFHG------------------
SYY_PSEPF       SFR-SMDEINAFRADVEA--GA-NPRDIKIKLAEEIVARFHG------------------
SYY_PSEPK       SFR-SMEEIEQFRADVAN--GA-NPRDIKIKLAEEIVARFHG------------------
SYY2_PSEAE      SFR-SLDEIDSFRKDVEA--GA-NPRDIKIKLAEEIVARFHG------------------
SYY_HAHCH       SFR-DMAEIEDFKVQVNA--GE-NPQNIKRLLAEEIVARFHG------------------
SYY_XANAC       SFDISMAEAARLKEEVAS--GELHPREVKLRLARELATRFHD------------------
SYY_XANC5       SFDISLAEAARLKEQVAA--GELHPREVKLRLARELATRFHD------------------
SYY_XANOM       SLDISVAEAVRLKEQVTS--GELHPREVKLRLARELATRFHD------------------
SYY_XANOR       SLDISVAEAVRLKEQVTS--GELHPREVKLRLARELATRFHD------------------
SYY_XANC8       SFDISVAEAARFKEDVAA--GNLHPRDVKLRLARELATRFHD------------------
SYY_XANCP       SFDISVAEAARFKEDVAA--GNLHPRDVKLRLARELATRFHD------------------
SYY_XYLFA       SFKISAAEVVALREAVAK--SELNPREVKLRLAHELVSRFYD------------------
SYY_XYLFT       SFKISAAEAVALREAVAK--SELNPREVKLRLAHELVSRFYD------------------
SYY_DESAG       TTK-TLDEIAELQRRVAS--GELHPKTAKEELAEHITAQYHG------------------
SYY_DESVH       SSR-SLDEIADLRRKVET--GEAHPKLVKESLAYELTTRYHG------------------
SYY_GEOMG       SDL-TLAEIEKLKAAMRD--GDVHPMAAKKQLAREIVARYHG------------------
SYY_GEOSL       SDL-SMAEIDGMRTGIRD--GSVHPMEAKKQLGREVVARYHG------------------
SYY_PELCD       SDV-DLAQLQLVRDGVEGKAGGAHPMESKKSLARELVARFYD------------------
SYY_DESPS       SDL-TTAEIADLRAQMEA--GTLHPKEVKKQLARELTARYHS------------------
SYY_HELPY       STK-TLEEIEDLKHGILN--QTLHPKAVKEDLASEIVARYYD------------------
SYY_HELPJ       SAK-TLEEIEDLKHGILH--QTLHPKAVKEDLASEIVARYYD------------------
SYY_CAMJE       SQK-SLEEIAQIKKDIEQ--GNLHPKKAKENLALEITERFHS------------------
SYY_CAMJR       SQK-SLEEIAQIKKDIEQ--SNLHPKKAKENLALEITERFHS------------------
SYY_SULDN       STK-TLAEIERLKSGVEA--GTLHPKKVKEELAIEITARFHS------------------
SYY_HELHP       SSL-SLQEIVMLKEQVNT--GNAHPKAVKEQLALEITTRYHN------------------
SYY_WOLSU       SAK-SLDEIHKLQEDVKS--GNYHPKKAKEDLALEITTRYHS------------------
SYY_ACIFR       SRV-PAVEQTRLQKEAAS--GARNPRDIKLDLAGELVRRFHG------------------
SYY_BDEBA       TDV-GAAGLNQLRADVAE--GRKHPRTVKVELAKFLIKRFHS------------------
SYY_LEPIC       TDL-PLPEIENRKNGMAK--KELHPKEIKTELAKLIMDQFSS------------------
SYY_LEPIN       TDL-PLPEIENRKNGMAK--KELHPKEIKTELAKLIMDQFSS------------------
SYY2_BACSU      TDL-ELEEKKQLVKDLET--GAVHPRDAKMLLARTIVRMYHG------------------
SYY2_BACLD      TDL-EAEEKKRLVKDLET--GAVHPRDAKMLLGKTIVNMYHG------------------
SYY_BACHD       TDL-SMDEVKAIAKGLED--GSVHPRDAKMKLGATLVRMYHG------------------
SYY_BACSK       TDV-PMDEIEALEKGLAD--GSVHPRDAKMRLGHKFVEMYHG------------------
SYY2_CLOAB      TDM-HPDAIDIIRKQLNE--DKVNPRDIKMKLAKEIVCLYHN------------------
SYY_CARHZ       TSV-PMETINEMKIQMET--GVLNPRDAKVFLAKEIITQYHS------------------
SYY_MOOTA       TAV-PLEELAAIRQGLAS--GSLHPRDAKMRLAREIVAMYHT------------------
SYY_DEHM1       TDI-PATEIADFKNQMAN--GLVNPMVLKKRLARELITQLYS------------------
SYY_DEHMC       TDI-PDQEIADFKAQMEN--GQVNPMILKKRLASELLTQLYN------------------
SYY2_PHOLL      TDM-EAEKQSAIVSQLEL---GLNPMKIKKDIAYNIVKRYHD------------------
SYY_CHLCH       LSQ-FGAALNEILSQIET-----NPRLAKRAMARHIVADYYS------------------
SYY_PELLD       LPL-TGEGRRAILEGWEE-----DPRTAKRRLAREIVMQYYS------------------
SYY_CHLTE       VPH-HSGNDKPIAERIAA-----DPRETKRELARELVAQYYS------------------
SYY_SALRD       TDI-PTEQLPKVKQFAES-----NPRAAKAQLARRIVEMYHG------------------
SYY_SYMTH       TDV-PQEEIERIEAAMAA--GE-NPMTFKKQLGRAIITTYGGT-----------------
SYY_THET2       TDL----EEEEIEALLKA-----GPVPAHRVLARLLTAAYALPQIPPRIDRAFYESLGYA
SYY_THET8       TDL----EEEEIEALLKA-----GPVPAHRVLARLLTAAYALPQIPPRIDRAFYESLGYA
SYY_DEIRA       TDL----PRERIEELLAG-----HPVAAHRELAREVVRAFHPD-----------------
SYY_SYNP6       TSQ----DLAALP---------ENPRDRQKLLALDVVSQYHG------------------
SYY_SYNE7       TSQ----DLAALP---------ENPRDRQKLLALDVVSQYHG------------------
SYY_SYNY3       TNL----DLAELP---------ENPRECQKLLAKEVTAQFHG------------------
SYY_THEEB       TDL----PLDSLP---------THPRDRQKALALAVVSQYHG------------------
SYY_NOSS1       TNL----PIDALP---------ENPRDRQMLLAWEIVKQYHG------------------
SYY_TRIV2       TDL----PIDKLP---------ANPRDRQMLLAWEIVKQYHG------------------
SYY_PROM9       TEL----DLSVLND--------ANPRELQRRMALEVTTLFHG------------------
SYY_PROMP       TEL----DLTLLKD--------NNPRDLQRRMALEVTSLYHG------------------
SYY_SYNPX       TDL----DLATLP---------ENPREKQKAMALAVTASRHG------------------
SYY_SYNSC       TDL----DLASLP---------DNPREKQKAMALAVTASRHG------------------
SYY_SYNS9       TDL----NVEALP---------ENPREKQKAMALAVTATRHG------------------
SYY_PROMM       TDL----DPEALP---------VNPRERQKAMAIAVTASRHG------------------
SYY_PROMA       TDC----EIRDLT---------LNARELQKFMALNVTAQFHG------------------
SYY_PROMT       TNE----NLKELS---------SNPREVQKFMALKVTSNFKG------------------
SYY_SYNJA       TSV----PPSELP---------ADPRQRQILLAKTLVAQFHS------------------
SYY_SYNJB       TSV----PLAELP---------QDPRQRQILLAKTLVAQFHS------------------
SYY_GLOVI       TDL----SVSALS---------ANPRERQKRLALAVTGWLHS------------------
                                        .   :  :.  .                        

SYY_AQUAE       -----------EEEARKAKEWWEKTFSQ----REFPEDAPLVKLNEKKL------RAVDF
SYY_THEMA       -----------EENAKKAQEHFVKVFQK----KEIPDEMPVVEISQEK-------NIVDL
SYY_HAEIN       -----------EEAANAAEQEFINRFQK----GAMPDEMPEFTFSGE-------MGLATL
SYY_HAEI8       -----------EEAANAAEQEFINRFQK----GAMPDEMPEFTFSGE-------IGLATL
SYY_MANSM       -----------EADADTAEQEFINRFQK----GAMPDEMPEFTFEGE-------IGLANL
SYY_PASMU       -----------EADAEAAEQEFINRFQK----GAMPEDMPELTFEGE-------MGLANL
SYY_HAEDU       -----------EAEADLAEQHFINRFQK----GAIPDEMPEFCFNGE-------IGLATL
SYY_PHOPR       -----------EADADAAEQEFINRFQK----GAMPEEMPELEFEAG-------IAISNL
SYY2_VIBCH      -----------QADADAAEQEFINRFQK----GAMPEEMPEFEFESG-------IAISNL
SYY2_VIBVU      -----------EADADAAEQEFVNRFAK----NQIPDEMPEFTFAAG-------TPMANL
SYY2_VIBVY      -----------EADADAAEQEFVNRFAK----NQIPDEMPEFTFAAG-------TPMANL
SYY2_VIBPA      -----------EADADAAEQEFVNRFAK----NQIPDEMPEFDFDAG-------TPVANL
SYY_SHEON       -----------AAAAESAHQAFIDRFQK----GAIPDDIPEVELAAGEG-----LAIANL
SYY_FRATT       -----------KEDAESAHQDFIQRFQK----NQIPDDINVVELNQE-------LPIANL
SYY_COLP3       -----------EAAAQAAHDEFINRFQK----GALPDDMPELTITTENGE----IAIANL
SYY2_PSET1      -----------EADAQAAHDDFIQRFQK----KALPDEIPELTVTIEQDS----ILIANL
SYY_IDILO       -----------EDDAEKAEQDFIQRFQK----NALPDDIPEKTVQVGAEG----MAIGNV
SYY_HYDCU       -----------KESAEAALKDFETRFSK----NAIPDEMPEFTF---NEV----MPLANL
SYY_LEGPH       -----------QTQAEFAHNKFIERFQK----GNIPEDLEELSLVIAEP-----IALAQL
SYY_LEGPL       -----------QTQAEFAHNKFIERFQK----GNIPEDLEELSLVIAEP-----IALAQL
SYY_LEGPA       -----------QTQAELAHNNFIERFQK----GNIPEDLEELSLVIVEP-----IALAQL
SYY_COXBU       -----------KEAATKAHQHFIDRFKR----HELPTDLDEIELTAENTH----LTIGYI
SYY_METCA       -----------ASAARKALENFEARHRD----NAVPDDLVEQVIAVPDGG----YPIANL
SYY_NITOC       -----------DSMAEQVHEAFVAQFRR----GAMPEDIPEILIVAGREG----IAIARL
SYY_AROAE       -----------HAAAEDALADFEARFQR----GVLPDDIPEVNVVVGDGG----LPVFQV
SYY_THIDA       -----------DKAARDAVAEFEARFQR----GVLPDDMPEVDLHGIDGG----LPVPQL
SYY_NITEU       -----------QTDAVRAAEEFEARFSK----GVIPDDIPEKKLYIQDAG----LALPQL
SYY_NITMU       -----------RQDAEAALADFESRFRR----GGIPDDLPENILQAGKEG----LPIAQL
SYY_BORBR       -----------PQAAEAALAAFEARFRD----GAIPEDMPEVTVGG--AP----QGILRI
SYY_BORPE       -----------PQAAEAALAAFEARFRD----GAIPEDMPEVTVGG--AP----QGILRI
SYY_BORPA       -----------PQAAEAALAAFEARFRD----GAIPEDMPEVTVGG--AP----QGILRI
SYY_BORA1       -----------AKDAEQALANFEARFRD----GAIPDDIPEVNLAG--AP----MGILHV
SYY_BURP1       -----------QADAERALEDFNHRAK-----GGVPDDIPAVTLAG--AP----LAIGQL
SYY_BURPS       -----------QADAERALEDFNHRAK-----GGVPDDIPAVTLAG--AP----LAIGQL
SYY_BURMA       -----------QADAERALEDFNHRAK-----GGVPDDIPAVTLAG--AP----LAIGQL
SYY_BURTA       -----------QADAERALEDFNHRAK-----GGVPDDIPTVTLAG--AP----LAIGQL
SYY_BURL3       -----------QADAERALEDFNHRAK-----GGVPDDIPSVTLAG--AP----LAIGQL
SYY_CUPPJ       -----------QADAEKALEDFNHRAR-----GGVPDDIPAVSLSG--AP----LGIAQL
SYY_RALSO       -----------QADAERALEDFNHRAR-----GGVPDDIPQIELSG--AP----IGIAQL
SYY_ACIAD       -----------ADAAANAHKGAGNIITE----GEIPEGTPEVTISRGEFGG--EIFIASI
SYY_PSYA2       -----------ADAAANAHKSAGNVLAD----GELPVDLPEVTLEL-EGQD--ALFITQI
SYY_PSE14       -----------EEAAANAHRSAGNRMKE----GELPDDLPEISVAAIED-----MPISAV
SYY_PSEU2       -----------EEAAANAHRSAGNRMKE----GELPDDLPELSVAAAED-----MPISAV
SYY_PSESM       -----------EEAAATAHRSAGNRMKE----GELPDDLPEISVAAIED-----MPISAV
SYY_PSEF5       -----------EEAAANAHRAAGNRMKD----GELPDDLPEIELVAAED-----MPIAAV
SYY_PSEPF       -----------EEAAANAHRGAGNRMKD----GELPDDLPEVELTAAED-----MPIAAV
SYY_PSEPK       -----------EEAAANAHRAAGNRMKE----GELPEDLPEIEVAAAED-----LPIAAV
SYY2_PSEAE      -----------EEAAASAHKSAGNRLKE----GELPEDLPEIELSSPED-----MPVASV
SYY_HAHCH       -----------GEAAQSAHKSAGNQVKL----GEIPENVPVVHLEESDDQT--EFSISYI
SYY_XANAC       -----------AATAEQAIAGWHAVVTG----QGDTGLLPLQEVVVPAEG----LRLAGL
SYY_XANC5       -----------AATAEQAIAGWHAVVTG----QGDTSLLPLQEVVVPDEG----LRLAGL
SYY_XANOM       -----------AATAEQAIAGWHAVVTG----QGDTSLLPLQEVVVPAEG----LRIASL
SYY_XANOR       -----------AATAEQAIAGWHAVVTG----QGDTSLLPLQEVVVPAEG----LRIASL
SYY_XANC8       -----------AATAEQAIAGWHAVVTG----QGDTSVLPLQQVSVPAEG----LRIASL
SYY_XANCP       -----------AATAEQAIAGWHAVVTG----QGDTSVLPLQQVSVPAEG----LRIASL
SYY_XYLFA       -----------NAAAEKAIAGWQAVVTG----QGNNNLLPLQKINVPADG----VRLVAL
SYY_XYLFT       -----------NAAAEKAIAGWQAVVTG----QGNNNLLPLQKINVPADG----VRLVAL
SYY_DESAG       -----------SDKAAEARQGFNAVFAQ----GCVPDDMPEFSCSCGEDS-----TPPAF
SYY_DESVH       -----------EDKAAEAQQGFNAVFAG----GGVPDDAPVHACDHGDDS-----TPPAF
SYY_GEOMG       -----------AVAADNAEESFVRRFRD----NQTPEEMPECILSAEEG----KVLLGRL
SYY_GEOSL       -----------AAAATDAEEHFVKRFRD----NQTPDEMPELTLAATDE----KVALCRL
SYY_PELCD       -----------QAAALRAEEEFVQQFKQ----KEVPDDIPEVLIDAGE-----PVWICRL
SYY_DESPS       -----------EEAAIAAEQNFENVFKK----GGIPEDLPEYQVSLDE-----PIWLPKL
SYY_HELPY       -----------NDQAIKAKEQFSKVFSA----NLLPEILSESDFDEG-------VGILDV
SYY_HELPJ       -----------NDQAFKAKEQFSKVFSA----NLLPEILLESDFDEG-------VGVLDV
SYY_CAMJE       -----------KEEANNAKSEFDRIHSQ----NALPSDMAEFEIQGK-------IWLAKA
SYY_CAMJR       -----------KEEANNAKSEFDRIHSQ----NALPSDMAEFEIQGK-------IWLAKA
SYY_SULDN       -----------SESAQNAKDEFDRVHSN----NQIPTEMDEFSSSEA-------ISITKA
SYY_HELHP       -----------IDLAKQAKIAFDNVFSK----DEIPTDLAVFTCNEG-------EWIARV
SYY_WOLSU       -----------EQDALQAKEEFDKVFAR----DEIPSEMPELGVTGE-------IWICKA
SYY_ACIFR       -----------TAAAQEAHIAFLARFQR----HETPEDLPLQAIKLSEAP-----RLSQL
SYY_BDEBA       -----------QAEAQAAEDEFNRIFVE----KGLPDEVPDFEVEAETQ-----MGLAAL
SYY_LEPIC       -----------PSENEEAIQEWKKIHNPK--SRAVPDDVKEIKLGEEFFAETPEPLLVWV
SYY_LEPIN       -----------PSENEEAIQEWKKIHNPK--SRAVPDDVKEIKLGEEFFAETPEPLLVWV
SYY2_BACSU      -----------EKAAEAAEHSFKTVFQE----NSLPEDIPAVNWKGEKT-----IAMIDL
SYY2_BACLD      -----------SKAAEAAEQQFKKVFQQ----NSAPDNITAVHWQGGGT-----VPVTDL
SYY_BACHD       -----------EKEAEEAVNYFKTVFQK----RDLPTDIPEVKWDGESP-----VWIVDL
SYY_BACSK       -----------KEAADEAEQYFKTVFQK----RALPEDIPVFSWEGDKE-----VPLIDL
SYY2_CLOAB      -----------EAEALNAEIYFKNLFQD----KEIPEDIPIFKVRSEN-------NLIEA
SYY_CARHZ       -----------REAADEAEREFIKIFRE----KELPDEIPEYKVPGELIDGG-VVLLPKV
SYY_MOOTA       -----------PEAALEAEREFRQVFQQ----HDLPDDMPELTIKEDR------VWLPRL
SYY_DEHM1       -----------AAAAEEADAQFTRVVQR----GEIPEDMPECRLENGES-----ICVIDF
SYY_DEHMC       -----------ATAAQEADARFTRVVQR----GEIPEDMPECRLENGQN-----TGVIDF
SYY2_PHOLL      -----------DISAKEATEHFERVVQK-----RTPEEADHDVLILPKGS---YITLLDL
SYY_CHLCH       -----------PEAASAAEEHFDKLFVH----KQAPDNLELLELEA------TSMPIIDL
SYY_PELLD       -----------AGEAGAAEEHFDRLFVH----KQAPTEIELTRFSE------PELPLVDL
SYY_CHLTE       -----------AEEAAKAQEHFDRVIVN----KQAPTDLPTVEFEE------ATMPVVEL
SYY_SALRD       -----------EEAADRAEEHFEQTVVE----GGVPDDLPEYTPTPEDG---AEVGLLNL
SYY_SYMTH       -----------EEEARLAEERWVAQFSR----GEVPEDIPDVVLPAAELP----MQAARV
SYY_THET2       WEAFGRDKEAGPEEVRRAEARYDEVAKG-----GIPEEIPEVTIPASELKE-GRIWVARL
SYY_THET8       WEAFGRDKEAGPEEVRRAEARYDEVAKG-----GIPEEIPEVTIPASELKE-GRIWVARL
SYY_DEIRA       ------------ADLDAAEARFRSVAKG-----GIPDNIPAVSVPASELNEQGHVSMAKL
SYY_SYNP6       -----------AEAAAAAQKAAQELV-Q--GSAVQAEAVPEFPLSQV----NFPAKAFYL
SYY_SYNE7       -----------AEAAAAAQKAAQELV-Q--GSAVQAEAVPEFPLSQV----NFPAKAFYL
SYY_SYNY3       -----------VAGAIAAQKTAEDIVTQ--GKAGNTDSVPEFSLAEI----TFPVKLAYL
SYY_THEEB       -----------QELALQTQAELAAIVTQ--GQTAQAGSIPEYSLGEF----QFPVKLTYV
SYY_NOSS1       -----------EQAANEAKEAAQSGG--------KEGAVPEFSLSNVS---QFPVKLAYL
SYY_TRIV2       -----------EQAAQEAKEAAQSGG--------KEGAVPEFSLAGVP---QFPVKLAYL
SYY_PROM9       -----------AEEASKAQSNCEKLFL---GHKEKVGEIPEISLKDI----VFPVKFFYL
SYY_PROMP       -----------KEEALRAQSNCEKLFL---GLKEKVGEIPIISLKEI----VFPVKFFYL
SYY_SYNPX       -----------MEAAQKAQLDAASLVG---GAGDAATEVPGASLAEV----NFPAKAFYL
SYY_SYNSC       -----------IEAAQKAQSDAATLVG---GSGDAGADVPEASLAEV----NFPAKAFYL
SYY_SYNS9       -----------TDAAAKAQLDAGNLVG---GAGDASADVPEASLLAV----NFPAKAFYL
SYY_PROMM       -----------IAAAEAAQNDAARLVS---GSQDDAASVPEAFLSDV----NFPAKAFYL
SYY_PROMA       -----------LSVAKIAQKDASKIVS---GLKETVEDVPVLSVSNV----NFPTKAFHL
SYY_PROMT       -----------IEAAKNAQFNSEKLVL---GTKDSLEEIPEASVSNV----NFPAKAFYL
SYY_SYNJA       -----------SEAAEEAQRTAQALVLQ--GNLVETGSIPTFAIQCL----SYPVKLSYI
SYY_SYNJB       -----------PAAAEEAQRTAQALVLD--GILAETGSIPTFAIDGL----SYPVKLSYI
SYY_GLOVI       -----------PEQALRAQEAAAAMVTGSGGTGADLEAVPEFSLTEI----AFPVRLANL
                                 .                                          

SYY_AQUAE       LVKIGAVKSKNEARRVIQGGGLKINGE-KVTDPNTEIEI---NGELKVKVGKK-KFYRVV
SYY_THEMA       LVEIGAASSKSEAKRLVSQGGVYIDGE-RIEDIKFTVEP---DGERVLRVGKR-KFYRIS
SYY_HAEIN       LKEAGLVPSTSEAIRSAQQGGVKINGE-KVDNVKDNAP----KGTNVYQVGKR-KFARVR
SYY_HAEI8       LKEAGLVPSTSEAIRSAQQGGVKINGE-KVDNVKDNAP----KGTNVYQVGKR-KFARVT
SYY_MANSM       LKEAGLVASTSEANRMVQQDGVKIDGE-KVEDAKTTIS----ASTHVYQVGKR-KFARVT
SYY_PASMU       LKEAGLVASTSEANRMVQQGGVKIDGE-KVEDAKLVIK----ASTAVYQVGKR-KFARVT
SYY_HAEDU       LKEAGLVASTSEAIRSAQQGGVKIDGQ-KIDDVRANAQ----LGTFVYQVGKR-KFARVT
SYY_PHOPR       LKDAGLVNSTSDAMRMIRQGGAKIDGN-KIEDTKLIPA----AGTAVYQVGKR-KFARIT
SYY2_VIBCH      LKEAGLVASTSDALRMIKQGAVKLDGE-KLEDAKLIPA----CGTSVYQVGKR-KFARVT
SYY2_VIBVU      LKEAELCSSTSEAMRMVKQGAAKMDGE-KVEDAKAEPA----VGTYVFQVGKR-KFARIT
SYY2_VIBVY      LKEAELCSSTSEAMRMVKQGAAKMDGE-KVEDAKAEPA----VGTYVFQVGKR-KFARIT
SYY2_VIBPA      LKDAGLCASTSEAMRMVKQGAAKVEGE-KVADAKFAPE----AGTYVFQVGKR-KFARIT
SYY_SHEON       LKDADLVGSTSDALRMIKQGAVKMDGE-KIDDSRMTLSA---GTVAVFQVGKR-KFAKVT
SYY_FRATT       LKEAGLVASTSEANRMIQQGAVKIDGE-KLSDAKIIFAK---GTNNVFQVGKR-KFAKII
SYY_COLP3       LKDAGLVGSTSDAFRMIKQGAAKIDSE-KVTDRSLVISA---GTTAVYQVGKR-KFARIT
SYY2_PSET1      LKEANLVASTSEAMRMIKQGAVKLNGEDKITDTKLEIAK---GSTAIYQVGKR-KFANIT
SYY_IDILO       LKEAGLVESTSEALRMIKQNAVKVDGE-KFSDSRYLCTE---KDSGVYQVGKR-RFAKIN
SYY_HYDCU       LKEAGLVSSTSDGHRMVKQGAVKLNGE-KVTDSRAPVEN---CEQQVYQVGKR-KFARIT
SYY_LEGPH       LKQIDLTASTSESIRMVKQGAVKVDGD-KISDPSLKLPI---GKSYIIQVGKR-RIAKLS
SYY_LEGPL       LKQIDLTASTSESIRMVKQGAVKVDGD-KISDPSLKLPI---GKSYIIQVGKR-RIAKLS
SYY_LEGPA       LKQIDLTASTSESIRMVKQGAVKVDGD-KISDPSLKLPI---GKSYIIQVGKR-RIAKLS
SYY_COXBU       LQRAGLVNTTSEGLRMIAQGAVRIDGE-RVEDIKLAIPR---GESHLFQVGKR-RFAKVK
SYY_METCA       VHDLALTASTSEALRLIKQGGIKIDGE-RLEDPKCRMTA---GGTHIIQVGKR-KFAKIR
SYY_NITOC       LKESALTASTSESLRLIKQGAVKIDGQ-RLGNQSLQILP---GITHVVQVGKR-RFARVS
SYY_AROAE       VKQAGLTGSTSEALRMIEQGAVRLNGE-RVEDKGLVLQR---DQTVVLQVGKR-KFASVV
SYY_THIDA       LKQAGLVSSTSDAIRQIAGGGVRLDGE-RVTDKGQSVPA---GATVVAQVGKR-KFARVT
SYY_NITEU       LKLAGLTASTSEALRMIEQGGVKLNGD-KVSDKTRIIPS---NVTVIAQIGKR-KFAKVT
SYY_NITMU       LKQTGLTASTTEALRMIEQGGVKLNGE-KVSDKTFRLSC---GQMVIVQVGKR-KFARVT
SYY_BORBR       LREAGLVASGSEAQRNVEQGGVRVNGD-RVEDKSLQLSA---G-TYVVQVGKR-KFARVK
SYY_BORPE       LREAGLVASGSEAQRNVEQGGVRVNGD-RVEDKSLQLSA---G-TYVVQVGKR-KFARVK
SYY_BORPA       LREAGLVASGSEAQRNVEQGGVRVNGD-RVEDKSLQLSA---G-TYVVQVGKR-KFARVK
SYY_BORA1       LRASSLCASSSEAQRAIEQGGVKIDGA-KIEDRSLQLNA---G-SYVLQVGKR-KFARVN
SYY_BURP1       LKQAGLVPSTSEALRNIEQGGVKIDGA-TVSDKALKVDA---G-EFVVQVGKR-RFARVT
SYY_BURPS       LKQAGLVPSTSEALRNIEQGGVKIDGA-TVSDKALKVDA---G-EFVVQVGKR-RFARVT
SYY_BURMA       LKQAGLVPSTSEALRNIEQGGVKIDGA-TVSDKALKVDA---G-EFVVQVGKR-RFARVT
SYY_BURTA       LKQAGLVPSTSEALRNIEQGGVKIDGA-TVSDKALKVDA---G-EFVVQVGKR-RFARVT
SYY_BURL3       LKQAGLVPSTSEALRNIEQGGVKIDGA-TVSDKGLKVEA---G-EFVVQVGKR-RFARVT
SYY_CUPPJ       LKQANLVPSTSEANRNIEQGGVKIDGA-TVSDKAVKVAA---G-TYVVQVGKR-RFARVT
SYY_RALSO       LKQAGLCPSTSEANRNIEQGGVKIDGT-VISDKGLKVEA---G-TFVMQVGKR-RFARVV
SYY_ACIAD       VRLAGLTKNAAQAKDAVSRGAVKVDWQ-VV-DANFSVKE---NKTYLIQAGKK-AIAQVT
SYY_PSYA2       LNQAALAKNSSSAKDMIKRGAVKVDGE-VV-DAGFSLTA---GQTVVIQAGKK-AYAKVT
SYY_PSE14       LNKAGLVKNAAVARDLLASGGVRIDGE-VV-DRGFVFKL---GATHVCQAGKK-AFGRVT
SYY_PSEU2       LNKAGLVKNAAVARDLLASGGVRIDGE-VV-DRSFVFKL---GTTHVCQAGKK-AFGRVT
SYY_PSESM       LNKAGLVKNAAVARDLLASGGVRIDGE-VV-DRSFIVKL---GATHVCQAGKK-AFGRIT
SYY_PSEF5       LNKAGLVKNAAMARDLLGSGGVRVDGE-VV-DRTYIYAV---GSTHVCQAGRK-AFARIT
SYY_PSEPF       LNKAGLVKNSAAARDLLASGGVRVDGE-VV-DRSFIYVL---GATHVCQAGKK-AFARIT
SYY_PSEPK       LNRAGLVKNSAQARDLLNSGAVKVDGA-VV-DKDFMFVL---GATHVCQAGKK-SFGRVT
SYY2_PSEAE      LNKAGLVKNAAAARDLLGAGSVKVDGQ-VV-DRTFMLAL---GETRVFQAGKK-AFARIT
SYY_HAHCH       LRRADLVKNGAAAKDVLGRGAVFVDGA-QV-DPSFMVQR---GSEHVIQAGKK-KIAQIF
SYY_XANAC       LTAAGLTPSNSEATRKLKERAVKIDGE-VVEDPGRVFTQ---GFEGVIQVGKR-NFARVS
SYY_XANC5       LTAAGLTPSNSEATRKLKERAVRIDGE-VVEDPSRVFTH---GFEGVIQVGKR-NFARVL
SYY_XANOM       LTAAGLTPSNSEATRKLKERAVKIDGE-VLEDATRVFTQ---GFEGVIQVGKR-NFARVS
SYY_XANOR       LTAAGLTPSNSEATRKLKERAVKIDGE-VLEDATRVFTQ---GFEGVIQVGKR-NFARVS
SYY_XANC8       LTAAGLTPSNSEATRKLKERAVKIDGE-VVDDLARQFGP---GFEGVIQVGKR-NFARVA
SYY_XANCP       LTAAGLTPSNSEATRKLKERAVKIDGE-VVDDLARQFGP---GFEGVIQVGKR-NFARVA
SYY_XYLFA       LTKSGLAPSNSEAMRKLKERAVRVDGI-VVDDAHLHFVP---GFEGLIQIGKR-NFAKVR
SYY_XYLFT       LTKSGLAPSNSEAMRKLKERAVRVDGI-VVDDAHLHFVP---GFEGLIQIGKR-NFIKVR
SYY_DESAG       LADSGLAGSRGEAKRLIKQGALSLDGE-KLDDPNTPLTA---G-EYVVRLGKK-RFLRLI
SYY_DESVH       LEAAGLVKSRGEAKRLIKEGALSVDGV-RCDDANSPLAS---G-EYVIKLGKK-RFLRLT
SYY_GEOMG       LAEAGLVKSNSEGRRAINQGGVKVNGE-KVTNDMLELPG---VGEYVLQFGKR-RFARIV
SYY_GEOSL       LAEAGLVKSNSEGRRAIQQGGVKVNGE-KVSDESLELAA---TGVYVIQFGKR-RFARIT
SYY_PELCD       LTDAGLTASNGEARRLVKQGAVKLGGE-KIADAGLEVAP---AGELILQAGKR-RFARIK
SYY_DESPS       LADAEMVKSTSEGRRMIKQGAVSLDGE-KAVDESMLISP---EGEVLIKVGKR-RFVKVI
SYY_HELPY       LKQIGFCPSTSQARRDIQGGGVKINQE-VIKNESYRFVK---G-NYVIQLGKK-RFMKLN
SYY_HELPJ       LKQIGFCPSTSQARRDIQGGGVKINQE-VVKDESYRFVK---G-NYVIQLGKK-RFMKLN
SYY_CAMJE       LVECGLESSTSAARRSISANAVSVNSQ-KVSDEQMYLEQ---G-EYILQIGKR-KFAKLK
SYY_CAMJR       LVECGLESSTSAARRSISANAVSVNSQ-KVSDEQMYLKQ---G-EYILQIGKR-KFAKLK
SYY_SULDN       LVDCNLTPSTSQARRDIKQGAVRINQE-KIDDETLSLES---G-EYILQVGKR-KFAKLK
SYY_HELHP       LVIAGLCESTSQARRDIRAGALKINKE-KIMNEELKLSV---G-EYIVQIGKR-RFAKVI
SYY_WOLSU       MVEGGISPSTSQARRDIQAGSVKINQT-KVEDINQQLGH---G-EHIIQVGKR-KFLRLI
SYY_ACIFR       LVQVHLAASTSEAMRKMKEGAVRVDWR-RVVDPATILAL---DAVYLLQFGKR-HFARVA
SYY_BDEBA       MVKAQLAASNSEAGRLIQGGGVQIDGE-KVSDPRLKIDLK-SGASFVLKAGKK-KFVKIV
SYY_LEPIC       LSKLSFIPSVSEGRRLIKAGGLYLSED-KITDEKFPIQK---GKEYLVRQGKKGKFLKII
SYY_LEPIN       LSKLSFIPSVSEGRRLIKAGGLYLSED-KITDEKFPIQK---GKEYLVRQGKKGKFLKII
SYY2_BACSU      LVKLKLLSSKSEARRMIQNGGVRIDGE-KVTDVHAKAEIR---ENMIIQVGKR-KFLKLQ
SYY2_BACLD      LVTLELLPSKSEARRMIQNGGVKINGA-KAESIHADIALE---HGMIIQVGKR-KFVKLQ
SYY_BACHD       LVTLDLLPSKGEARRMVQNGGVKLNGE-KVEDVQLQVEIE---DGLIVQVGKR-KFKKLV
SYY_BACSK       LVTLNMQSSKGEARRMIQGGGVKINEQ-KITDIHTVVSVE---DNMIVQVGKR-KFAKLS
SYY2_CLOAB      IVKINSNTSKSEARRLIAQGGVKLNGR-KVIDFN-DIILK---SNDVIQIGKK-KIVKLL
SYY_CARHZ       LFSAGTVKSISEAKRLISQGAVLVNQE-KINDINFVLKPSK--EPYTVKVGKR-RFLKII
SYY_MOOTA       MVQAGLAPSTSEARRLIRQGAVKIDGE-RVTDPDTEVEVR---EGQVLQAGKR-KFARLH
SYY_DEHM1       IIKADLAKSKSEARRLLEQGGVEINSA-KISDPGTTVKC-----GDIIKAGKR-RYSKAV
SYY_DEHMC       IILSGLAKSKSEARRLLEQGAVEINSE-KISDQNTPVKC-----GDIIKAGKR-RYSKAI
SYY2_PHOLL      CSVALPAISRSELRRLIRSGAVRVDKS-KEDDEIKNIEV---IPGTLIWIGKRYKFRIGS
SYY_CHLCH       LTLLGAAPSKSEARRMIQAKSVSIDDE-KIEDFNAVIAL-EGE-AKIVRAGKR-KFFKIR
SYY_PELLD       LTTLGAAASKTDARRMIQQNAVSIDEE-KITDVKTIITL-SDE-PKTLKAGKR-KFFRIA
SYY_CHLTE       LMALAAFPSKNEARRMIQQGAVQAGNE-KISDINAVIEL-TEN-PVIIRAGKR-KFFKVA
SYY_SALRD       MRHADLTDSNSEGRRMIEQGAVTIDEE-KVTDTGRYIDV-AEEAPFVLQVGKR-RFARIR
SYY_SYMTH       LFTAGLAPSLSEARRLIEQGGFTVDGE-KVTDPRAELALR---PGQVLKAGKR-KYGRVV
SYY_THET2       FTLAGLTPSNAEARRLIQNRGLRLDGE-VLTDP---MLQVDLSRPRILQRGKD-RFVRVR
SYY_THET8       FTLAGLTPSNAEARRLIQNRGLRLDGE-VLTDP---MLQVDLSRPRILQRGKD-RFVRVR
SYY_DEIRA       VVLAGLEPSNGAARKLIQNRGLKLGGE-TYSDPQGQLTREQLTEGVVIQKGKD-KFARLV
SYY_SYNP6       VSAVGLGLTSSEARRQIQGGAVRLDGQ-KLDDPNHIFEAPTALKGRVIQVGKK-KFVRLV
SYY_SYNE7       VSAVGLGLTSSEARRQIQGGAVRLDGQ-KLDDPNHIFEAPTALKGRVIQVGKK-KFVRLV
SYY_SYNY3       LSASGLCPSSSEGRRQIKGGAVRLDGD-RLEDVNQEYADPKMLINKVLQMGKK-KFIRLI
SYY_THEEB       LSHTKLCPSSSEARRQIQGGGVRLNGE-KITDVDFTLTAPEPYVNQVLQVGKK-KFLRFV
SYY_NOSS1       LGATGLCKSTGEGKRKIQEGGVRLDGD-RISDADTTFQQPDELQGRVLQVGKN-KFMRLV
SYY_TRIV2       LGATGLCKSTGEGKRKIQEGGVRLDGD-RISDADTIFQQPDELQGRVLQVGKN-KFVRLV
SYY_PROM9       LSSLKLFKSSSESKRSIKGGGVKIDSQ-KVINPDIVFDSKKDLEGKILQIGKK-IIKRFE
SYY_PROMP       LSSLNLFKSSSESKRSIKGGGVKIDSY-KLVNPDLVFDSKEDLSGKILQIGKK-IIKRFD
SYY_SYNPX       LSAVGICASSSEARRQIKGGAVRLEGE-KIGDPNQEFASAAELEGKVLQLGKK-TFRRLT
SYY_SYNSC       FSAVGICASSSEARRQIKGGAARLEGE-KITDPNQEFTSAAELEGKVLQLGKK-TFRRLV
SYY_SYNS9       MSAVGICASSSEARRQIKGGAARLDGE-KITDPNQEFASAAELDGRVLQLGKK-TFRRLT
SYY_PROMM       LSAIGLCASSSEARRQIKGGAVRLDGE-KITDPNLEFTDSSLLMGKVLQVGKK-TFRRLT
SYY_PROMA       LSSIGLCSSSSNARRQIQGGALRIDGK-KILDPNFEFVDQKDIVGKILQLGKK-TFRRIS
SYY_PROMT       FSKMEMCSSSSEARRQILGGGVRIDGK-KIMDPNLEFHTPDDLIGKILQVGKK-KFLRVS
SYY_SYNJA       LRESGLCKSAAEARRQIQGGAVRLDGQ-KVEDPDLEFAQASELDGRVLQVGKK-AFCRLV
SYY_SYNJB       LRECGLCKSAAEARRQIQGGAVRLDGQ-KVEDPDLEFAHASELAGRILQVGKK-AFRRLV
SYY_GLOVI       LKAAGLCPTVSEGMRQIKNGAVRLNQE-RITDPNCGFAEAAELTGAVLQVGKK-HFRRLV
                        .           .          .                  *:        

SYY_AQUAE       SG-----------------
SYY_THEMA       GGETKKL------------
SYY_HAEIN       LNKVDTVK-----------
SYY_HAEI8       VE-----------------
SYY_MANSM       VR-----------------
SYY_PASMU       VK-----------------
SYY_HAEDU       VK-----------------
SYY_PHOPR       LK-----------------
SYY2_VIBCH      IK-----------------
SYY2_VIBVU      IA-----------------
SYY2_VIBVY      IA-----------------
SYY2_VIBPA      IK-----------------
SYY_SHEON       LV-----------------
SYY_FRATT       IK-----------------
SYY_COLP3       VS-----------------
SYY2_PSET1      VA-----------------
SYY_IDILO       LTA----------------
SYY_HYDCU       VAA----------------
SYY_LEGPH       IQQAD--------------
SYY_LEGPL       IQQAH--------------
SYY_LEGPA       IQQAD--------------
SYY_COXBU       VI-----------------
SYY_METCA       LTP----------------
SYY_NITOC       IRLSEDQCRK---------
SYY_AROAE       LN-----------------
SYY_THIDA       VI-----------------
SYY_NITEU       LVTEQSGKQAN--------
SYY_NITMU       ICEEK--------------
SYY_BORBR       LVG----------------
SYY_BORPE       LVG----------------
SYY_BORPA       LVG----------------
SYY_BORA1       LAV----------------
SYY_BURP1       LTA----------------
SYY_BURPS       LTA----------------
SYY_BURMA       LTA----------------
SYY_BURTA       LTA----------------
SYY_BURL3       LTA----------------
SYY_CUPPJ       LA-----------------
SYY_RALSO       LS-----------------
SYY_ACIAD       FTD----------------
SYY_PSYA2       VD-----------------
SYY_PSE14       LVSEESSK-----------
SYY_PSEU2       LVSEESSN-----------
SYY_PSESM       LVSDESSK-----------
SYY_PSEF5       LKSE---------------
SYY_PSEPF       LKSE---------------
SYY_PSEPK       LKAE---------------
SYY2_PSEAE      LKAE---------------
SYY_HAHCH       VK-----------------
SYY_XANAC       LVTG---------------
SYY_XANC5       LVTA---------------
SYY_XANOM       LVIG---------------
SYY_XANOR       LVIG---------------
SYY_XANC8       LVTS---------------
SYY_XANCP       LVTS---------------
SYY_XYLFA       LVTSSESHDFPESNGIDKS
SYY_XYLFT       LVTSSESQEFPESNRIDKS
SYY_DESAG       VR-----------------
SYY_DESVH       VR-----------------
SYY_GEOMG       FK-----------------
SYY_GEOSL       FA-----------------
SYY_PELCD       FLEKK--------------
SYY_DESPS       FA-----------------
SYY_HELPY       IN-----------------
SYY_HELPJ       IN-----------------
SYY_CAMJE       VKE----------------
SYY_CAMJR       VKE----------------
SYY_SULDN       VN-----------------
SYY_HELHP       IS-----------------
SYY_WOLSU       VK-----------------
SYY_ACIFR       LQKGE--------------
SYY_BDEBA       VK-----------------
SYY_LEPIC       S------------------
SYY_LEPIN       S------------------
SYY2_BACSU      -------------------
SYY2_BACLD      MHQ----------------
SYY_BACHD       R------------------
SYY_BACSK       LT-----------------
SYY2_CLOAB      VE-----------------
SYY_CARHZ       FEK----------------
SYY_MOOTA       TF-----------------
SYY_DEHM1       -------------------
SYY_DEHMC       -------------------
SYY2_PHOLL      -------------------
SYY_CHLCH       SK-----------------
SYY_PELLD       TAGNS--------------
SYY_CHLTE       RAKKSF-------------
SYY_SALRD       PPENGTDV-----------
SYY_SYMTH       LK-----------------
SYY_THET2       LSD----------------
SYY_THET8       LSD----------------
SYY_DEIRA       LEG----------------
SYY_SYNP6       L------------------
SYY_SYNE7       L------------------
SYY_SYNY3       S------------------
SYY_THEEB       P------------------
SYY_NOSS1       P------------------
SYY_TRIV2       L------------------
SYY_PROM9       N------------------
SYY_PROMP       N------------------
SYY_SYNPX       A------------------
SYY_SYNSC       A------------------
SYY_SYNS9       A------------------
SYY_PROMM       R------------------
SYY_PROMA       N------------------
SYY_PROMT       T------------------
SYY_SYNJA       VGTN---------------
SYY_SYNJB       KGAD---------------
SYY_GLOVI       PS-----------------