CLUSTAL format seed alignment for MF_02011

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GPSB_BACSU      MLADKVK-------LSAKEILEKEF--KTGVRGYKQEDVDKFLDMIIKDYE---TFHQEI
GPSB_BACVZ      MLADKVK-------LSAKDILEKEF--KTGVRGYRQEDVDKFLDMIIKDYE---TFHQEI
GPSB_BACLD      MLADKVK-------LSAKEILEKEF--KTGVRGYKQEDVDKFLDMVIKDYE---AFHQEI
GPSB_BACP2      MLADKVK-------LSAKEILEKEF--KTGVRGYKQEEVDKFLDMVIKDYE---TFNQEI
GPSB_LISIN      MTSEQFEY-----HLTGKEILEKEF--KTGLRGYNPEDVDEFLDMVIKDYS---TFTQEI
GPSB_LISW6      MTSEQFEY-----HLTGKEILEKEF--KTGLRGYNPEDVDEFLDMVIKDYS---TFTQEI
GPSB_LISMF      MTSEQFEY-----HLTGKEILEKEF--KTGLRGYSPEDVDEFLDMVIKDYS---TFTQEI
GPSB_LISMO      MTSEQFEY-----HLTGKEILEKEF--KTGLRGYSPEDVDEFLDMVIKDYS---TFTQEI
GPSB_BACAH      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---AFHKEF
GPSB_BACAN      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---AFHKEF
GPSB_BACHK      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---AFHKEF
GPSB_BACCZ      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---AFHKEF
GPSB_BACC1      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---AFHKEF
GPSB_BACCR      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---AFHKEF
GPSB_BACCN      MISDKIK-------LTAKDILEKEF--KTGMRGYQQEEVDKFLDMIIKDYE---VFHKEL
GPSB_BACHD      MYNQEVK-------LTTKEILEKEF--KTSMRGYSQDEVDKFLDVVIQDYE---VFQKKI
GPSB_BACSK      MSQMEIK-------LTAKEILDKDF--KQSMRGYNQDEVDKFLDTVIQDYE---AFQKKI
GPSB_GEOKA      MSAHQVK-------LTPKDILEKEF--KVSIRGYNQDEVDQFLDLIIKDYE---AFQQEI
GPSB_GEOTN      MSANQVK-------LTPKDILEKEF--KVSMRGYNQDEVDQFLDIVIKDYE---AFQQEL
GPSB_STAAT      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAW      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAS      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAR      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAN      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAM      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAE      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAC      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAAB      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAA9      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAA8      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAA3      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAA2      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAA1      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIIADYQKMADMNNEV
GPSB_STAEQ      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIITDYQKMADMNNEV
GPSB_STAES      MSDVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIITDYQKMADMNNEV
GPSB_STAHJ      MADVSLK-------LSAKDIYEKDFE-KTMARGYRREEVDAFLDDIITDYQKMADMNNEV
GPSB_OCEIH      MSVNRIQ-------LSGKDILEKDF--KTGIRGYSQEEVDEFLDVIIQDYD---NFKQEI
GPSB_STRA1      --MASII-------YSPKDIFEQDF--KVSMRGYDKKEVDVFLDDVIKDYE---NYLEQI
GPSB_STRA3      --MASII-------YSPKDIFEQDF--KVSMRGYDKKEVDVFLDDVIKDYE---NYLEQI
GPSB_STRA5      --MASII-------YSPKDIFEQDF--KVSMRGYDKKEVDVFLDDVIKDYE---NYLEQI
GPSB_STRMU      --MASIM-------YTPKDIFEQEF--KSSMRGYDKKEVDEFLDDIIKDYE---TYISTI
GPSB_STRP3      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRP6      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRP8      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRPB      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRPC      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRPD      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRPF      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRPG      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRPM      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRP1      --MTSII-------YSPKDIFEQEF--KTSMRGFDKKEVDEFLDNVIKDYE---NFNAQI
GPSB_STRP2      --MASII-------FSAKDIFEQEF--GREVRGYNKVEVDEFLDDVIKDYE---TYAALV
GPSB_STRPN      --MASII-------FSAKDIFEQEF--GREVRGYNKVEVDEFLDDVIKDYE---TYAALV
GPSB_STRR6      --MASII-------FSAKDIFEQEF--GREVRGYNKVEVDEFLDDVIKDYE---TYAALV
GPSB_STRSV      --MASII-------FTAKDIFDQDF--KREVRGYSKSEVDEFLDDIIKDYE---TYAALV
GPSB_STRGC      --MASII-------FTPKDIFDQDF--KTAVRGYSKQEVDEFLDDVIKDYE---TYSALV
GPSB_STRS2      --MASIK-------FTTKDIFEQDF--KIGFRGYDQDEVNDFLDDIMKDYD---AYEAII
GPSB_STRSY      --MASIK-------FTTKDIFEQDF--KIGFRGYDQDEVNDFLDDIMKDYD---AYEAII
GPSB_STRT1      --MAKIN-------LTPKKIYEQEF--KTSIRGYDKTEVDEFLDDVIKDYT---VYIALV
GPSB_STRT2      --MAKIN-------LTPKKIYEQEF--KTSIRGYDKTEVDEFLDDVIKDYT---VYIALV
GPSB_STRTD      --MAKIN-------LTPKKIYEQEF--KTSMRGYDKTEVDEFLDDVIQDYT---VYIALV
GPSB_LACBA      --MEN-------VNFTPKEILQKQFRQK--MRGYDPDDVDSFLDNVIKDYD---AFVKEN
GPSB_LACPL      --MAK-------RNFTPKDILQKEFKPK--MRGYDPADVDGFLDNVIKDYE---SFTKDN
GPSB_PEDPA      --MDN-------INFTPKDILQKEFKPK--MRGYDPADVDTFLDSVIKDYE---NFGKEI
GPSB_LACRD      --MDN-------IKFTPQDILHKQFKERNIGKGYDEADVDAFLDDVIKDYD---TYNKEL
GPSB_LACS1      --MEN-------VNLTPKDIVNKHFKQK--MRGYDSIEVDEFLDDVIQDYE---TYAKEN
GPSB_LACP3      --MDSNKETKFSIQYGPKDILDKKFKNK--VRGYDPDEVDEFLDGIIRDYE---AFTNEI
GPSB_LACSS      --MDN----QLEIELNPTEILKKEFKSK--MRGYDPEEVDGYLDLVIKDYQ---TYQENI
                                  .* .:.*      :*:   :*: :** :: **          

GPSB_BACSU      EELQQENLQLKKQLEEAS---KKQPVQS-------------------NTTNFDILKRLSN
GPSB_BACVZ      EELQQENLQLKKQLEEAS---KKQPVQS-------------------NTTNFDILKRLSN
GPSB_BACLD      EELQQENLQLKKQLEEAN---KRQPAQS-------------------NTTNFDILKRLSN
GPSB_BACP2      EKLQQENLHLSKQLEEAVEQGKRQPAQS-------------------NTTNFDILKRLSN
GPSB_LISIN      EALQAENIRLVQELDNAPVRTTTQPAPTFQAAAQPA-----------GTTNFDILKRLSN
GPSB_LISW6      EALQAENIRLVQELDNAPVRTAPQPAPTFQAAAQPA-----------GTTNFDILKRLSN
GPSB_LISMF      EALQAENIRLVQELDNAPLRTSTQPAPTFQAAAQPA-----------GTTNFDILKRLSN
GPSB_LISMO      EALQAENIRLVQELDNAPLRTSTQPAPTFQAAAQPA-----------GTTNFDILKRLSN
GPSB_BACAH      EQLKQQNARLKRELEEQKLAATQVPQQPVVQTPVAQPVY--------NNTNTDILKRLSN
GPSB_BACAN      EQLKQQNARLKRELEEQKLAATQVPQQPVVQTPVAQPVY--------NNTNTDILKRLSN
GPSB_BACHK      EQLKQQNARLKRELEEQKLAATQVPQQPVVQTPVAQPVY--------NNTNTDILKRLSN
GPSB_BACCZ      EQLKQQNARLKRELEEQKLVATQVPQQPVVQTPVAQPVY--------NNTNTDILKRLSN
GPSB_BACC1      EQLKQQNARLKRELEEQKLAATQVPQQP-VQTPVAQPVY--------NNTNTDILKRLSN
GPSB_BACCR      EQLKQQNARLKRELEEQKLAVTQVPQQP-VQTPVAQPVY--------NNTNTDILKRLSN
GPSB_BACCN      EQLQQQNARLKRELEEQKLAAAQAPQQT-IPTPAAQPVY--------SNTNTDILKRLSN
GPSB_BACHD      ERLEQEIHQLRTEAKRAASERQ-TRHQTSPSV---------------GSTNYDILQRLSN
GPSB_BACSK      EQLERENELLKQDLKKQTERPQRSQTVTTPSA---------------GSTNYDILQRLSN
GPSB_GEOKA      DELRQEN----ARLKRQVEELQ---KRPAMSA---------------GTTNYDILQRLSN
GPSB_GEOTN      DELRQEN----ARLKRQVEELQ---KRPTTPT---------------GTTNYDILQRLSN
GPSB_STAAT      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAW      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAS      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAR      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAN      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAM      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAE      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAC      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAAB      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAA9      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAA8      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAA3      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAA2      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAA1      VKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTT------NTSSNNVDILKRISN
GPSB_STAEQ      VKLSEENHKLKKELEELRLRVATSRPQDNKNFSSNNSS--------SASNNVDILKRISN
GPSB_STAES      VKLSEENHKLKKELEELRLRVATSRPQDNKNFSSNNSS--------SASNNVDILKRISN
GPSB_STAHJ      VKLSEENNKLKKEVEELRLRVATSRPSDNKSFSSNNSS--------SSNNNVDILKRISN
GPSB_OCEIH      DRLKAENEKLKKSTPAVEQ--SRSRSQQPP----------------TSQVNYDVLKRLSN
GPSB_STRA1      EKLQMENRRLQQALD--KKESEASNVRNSGTAMYNQKP------IAQSATNFDILKRISR
GPSB_STRA3      EKLQMENRRLQQALD--KKESEASNVRNSGTAMYNQKP------IAQSATNFDILKRISR
GPSB_STRA5      EKLQMENRRLQQALD--KKESEASNVRNSGTAMYNQKP------IAQSATNFDILKRISR
GPSB_STRMU      EELRQENTRLKEEVKQAKKRQEAAQTTVSPAASVSSSR------VATTATNFDILKRISR
GPSB_STRP3      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRP6      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRP8      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRPB      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRPC      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRPD      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRPF      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRPG      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRPM      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRP1      EALKAENEALKKAKFQARNTVSATVQQ----PVPQPTR------VAQSATNFDILKRISK
GPSB_STRP2      KSLRQEIADLKEELTRKP-KPSPVQ-AEPLEAAITS-----------SMTNFDILKRLNR
GPSB_STRPN      KSLRQEIADLKEELTRKP-KPSPVQ-AEPLEAAITS-----------SMTNFDILKRLNR
GPSB_STRR6      KSLRQEIADLKEELTRKP-KPSPVQ-AEPLEAAITS-----------SMTNFDILKRLNR
GPSB_STRSV      KELREENRRLKEELAAKPVEKAPVQPTQPVQSTQATQSTVESFSQMTSATNFDILKRLNR
GPSB_STRGC      KELREENSRLKQELSKRM-QEAPNSTASQVHQSFGDTTQ-------TTITNFDILKRLSR
GPSB_STRS2      KELKGEIARLKAQAANSPKTTLPTEESNDVLRTERP----------SSATNFDILRRLNR
GPSB_STRSY      KELKGEIARLKAQAANSPKTTLPTEESNDVLRTERP----------SSATNFDILRRLNR
GPSB_STRT1      KELQEENAKLKAKATSAPASRPAYASATSEPSHATTNI--------ASASNYDILKRISR
GPSB_STRT2      KELQEENAKLKAKATSAPASRPAYASATSEPSHATTNI--------ASASNYDILKRISR
GPSB_STRTD      KELQEENAKLKAKVTSASASRPAYASATSEPSHATGNI--------ASASNYDILKRISR
GPSB_LACBA      QRLQDENERLLAKVDELTRQVQVGASQPRAAATSPAS--------SNV-TNMDILKRLSN
GPSB_LACPL      QQLSDENERLRAKVDELTKQVAVGATSP----SSQPT--------STV-TNMDILKRLSN
GPSB_PEDPA      ERMKNENDRLTDKVDELNKQVSAGGTVE----ESAPV--------SGA-TNVDVLKRLSN
GPSB_LACRD      ERLNDENERLRAKVDELNRQVEVGSSMSNQTASRQPV--------SSA-TNMDILKRLSN
GPSB_LACS1      QRLQMENDRLLKKVDELTKQVAVGKTGT----TARPV--------SNASTNMDILKRLSN
GPSB_LACP3      DRLKEENTKLFSRVDELTKQLSVSKNVS---AQTPQT--------NAAATNYDILKRLSN
GPSB_LACSS      DRLTADNTRLFNKVEELNRQLSASDSVK---EVKPQQ--------ASAATNYDILKRLSN
                  :  :                                            * *:*:*:..

GPSB_BACSU      LEKHVFGSKLYD------------------
GPSB_BACVZ      LEKHVFGSKLYDE-----------------
GPSB_BACLD      LEKHVFGSKLYD------------------
GPSB_BACP2      LEKHVFGSKLYD------------------
GPSB_LISIN      LEKHVFGNKLDDNE----------------
GPSB_LISW6      LEKHVFGNKLDDND----------------
GPSB_LISMF      LEKHVFGNKLDDNE----------------
GPSB_LISMO      LEKHVFGNKLDDNE----------------
GPSB_BACAH      LEKAVFGSKLYE------------------
GPSB_BACAN      LEKAVFGSKLYE------------------
GPSB_BACHK      LEKAVFGSKLYE------------------
GPSB_BACCZ      LEKAVFGSKLYE------------------
GPSB_BACC1      LEKAVFGSKLYE------------------
GPSB_BACCR      LEKAVFGSKLYE------------------
GPSB_BACCN      LEKAVFGSKLYE------------------
GPSB_BACHD      LEKKVFGNKLYE------------------
GPSB_BACSK      LEKKVFGSKMYE------------------
GPSB_GEOKA      LEKHVFGRKLYE------------------
GPSB_GEOTN      LEKHVFGRKLYE------------------
GPSB_STAAT      LEKAVFGK----------------------
GPSB_STAAW      LEKAVFGK----------------------
GPSB_STAAS      LEKAVFGK----------------------
GPSB_STAAR      LEKAVFGK----------------------
GPSB_STAAN      LEKAVFGK----------------------
GPSB_STAAM      LEKAVFGK----------------------
GPSB_STAAE      LEKAVFGK----------------------
GPSB_STAAC      LEKAVFGK----------------------
GPSB_STAAB      LEKAVFGK----------------------
GPSB_STAA9      LEKAVFGK----------------------
GPSB_STAA8      LEKAVFGK----------------------
GPSB_STAA3      LEKAVFGK----------------------
GPSB_STAA2      LEKAVFGK----------------------
GPSB_STAA1      LEKAVFGK----------------------
GPSB_STAEQ      LEKAVFGK----------------------
GPSB_STAES      LEKAVFGK----------------------
GPSB_STAHJ      LEKAVFGK----------------------
GPSB_OCEIH      LEKAVFGKRYTEQEES--------------
GPSB_STRA1      LEKEVFGRQIRE------------------
GPSB_STRA3      LEKEVFGRQIRE------------------
GPSB_STRA5      LEKEVFGRQIRE------------------
GPSB_STRMU      LEKEVFGKQITE------------------
GPSB_STRP3      LEKEVFGKQIIE------------------
GPSB_STRP6      LEKEVFGKQIIE------------------
GPSB_STRP8      LEKEVFGKQIIE------------------
GPSB_STRPB      LEKEVFGKQIIE------------------
GPSB_STRPC      LEKEVFGKQIIE------------------
GPSB_STRPD      LEKEVFGKQIIE------------------
GPSB_STRPF      LEKEVFGKQIIE------------------
GPSB_STRPG      LEKEVFGKQIIE------------------
GPSB_STRPM      LEKEVFGKQIIE------------------
GPSB_STRP1      LEKEVFGKQIIE------------------
GPSB_STRP2      LEKEVFGKQILDNSDF--------------
GPSB_STRPN      LEKEVFGKQILDNSDF--------------
GPSB_STRR6      LEKEVFGKQILDNSDF--------------
GPSB_STRSV      LEKEVFGKQILDRE----------------
GPSB_STRGC      LEKEVFGKQIQASELNQL------------
GPSB_STRS2      LEKEVFGKQIVQDQE---------------
GPSB_STRSY      LEKEVFGKQIVQDQE---------------
GPSB_STRT1      LEKEVFGKQIVE------------------
GPSB_STRT2      LEKEVFGKQIVE------------------
GPSB_STRTD      LEKEVFGKQIVE------------------
GPSB_LACBA      LERHVFGSQLD-NDPNESHRL---------
GPSB_LACPL      LERHVFGAQLD-NNQNESHRL---------
GPSB_PEDPA      LERRVFGAQLE-DTDNSSHRI---------
GPSB_LACRD      LERRVFGSQLDGNDNNDSHLL---------
GPSB_LACS1      LERHVFGAQLN-DDVNRGNRF---------
GPSB_LACP3      LERHVFGSKLSDSS-VDNHDDGNHSDVDQY
GPSB_LACSS      LERHVFGAKLSDQNGAAQTRVQNHSQFD--
                **: ***