CLUSTAL format seed alignment for MF_02014

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YNEA_BACSU      ---MIMSKESIIFVGLFTVILSAVILMLSYTSSGQELNQYVKIEVQQGDTLWSIADQVAD
YNEA_BACVZ      -----MAKESIIFVGLFTAILSAAILLVSCAGNDQSLSQYVKIKVQDGDTLWSLADHVAE
YNEA_BACLD      -----MKKESLIFVSLFTAVISCCILFVSFAGKIEERKQYVKIEVQEGDTLWELADRIKG
YNEA_BACP2      ----MRLKESIIFIGVFSFIVGIFLSLIAVTSHNDP-NQYVKIEVQSGDTLWGLADQVND
YNEA_GEOTN      ---MKKTLLHYLIFSCLLALV--LVGFVYASSPIDK-KQYMTVTVASGDTLWGLAKQYEP
YNEA_GEOKA      ---MRKTLLHYVLFSFLFALV--LAGFVYASSPVDK-KEYVTITVAPGDTLWGLAKQYEQ
YNEA_BACMD      MQQFLHSMKHYAIFFAVIAALTYVLTLVLGADKVDL-DKYSTVTITKGDTLWELSNKYHN
YNEA_LISMO      --MTLKLIWDKFYVSIIFVLTCIVLGIILMCTVVGGGSDYSEVNVNEGDSLWALADQYAG
YNEA_LISMF      --MTMKLIWDKFYVSIIFVLTCIVLGIILMCTVVGGGNDYSEVNVSEGDSLWALADQYAG
YNEA_LISIN      --MTLKLIWDKFYVSIIFVITCLVLGIILMCTVIGSGSEYSEVDVNEGDSIWALADQYAA
YNEA_LISW6      --MTLKLIWDKFYVSIIFVITCLVLGIVLMCTVLGNSNNYSEVNINEGDSLWAIADEYAS
                             .  .         ::         ..*  : :  **::* ::..   

YNEA_BACSU      TKKINKNDFIEWVADKNQLQT---SDIQPGDELVIPLKKKHQDAYELATVR---
YNEA_BACVZ      KKHINKEDFIEWVTENNHLQT---ADIKPGDELILPVKKKHPAVYQLAIVN---
YNEA_BACLD      GKTADKHKFIEWVADKNNLPT---SVIKPGDVLILPVAKQHSDQYQLAVVE---
YNEA_BACP2      SKSIDKNAFIDWVTQHNDLAS---TEIQPGDILVIPVKKEHPFVYQLATVQ---
YNEA_GEOTN      AHGLSPDEFIRWVVDVNRLPS---SRLTAGEQIVIPVLKSKQDGSLAVKR----
YNEA_GEOKA      EHHMPPDEFIRWVVDVNHLPS---PRLAAGEQIVIPVLKSKQGGSVAVNQ----
YNEA_BACMD      HHHLTTNEFVKWVEDVNDLNSDTAQSLSPGDKLYIPVLKKELHNQVAIEQ----
YNEA_LISMO      KSDMAKADFVSWVEKENNLSD---GHVEAGDSVVIPVHKTKLLKSDSTIQLANQ
YNEA_LISMF      KSDMAKADFVSWVEKENNLAD---GHVEAGESVVIPVHKTKLIKSDSTIQLANQ
YNEA_LISIN      KSDMAKADFVSWVEKENNLTD---GHVKAGDYVVIPVHETKLQRSDSTIQLANQ
YNEA_LISW6      KSDMPKADFVAWVEKENNLTE---GHVKAGDSVVIPVHETKLQNSDSTIQLANQ
                        *: ** . * *       : .*: : :*: : .