CLUSTAL format seed alignment for MF_02015

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NOC_BACHD       MKQPFSRLFGFGDKQDQ----------EMETGKQEEVHQLPIKEIVPNRFQPRTIFDDER
NOC_BACSK       MKQSFSRLFGLNDKND-----------DAELTANEEVQQLAIKDIVPNRFQPRTLFDEDR
NOC_BACSU       MKHSFSRFFGLGEKEQ-------EPEIAEHDTNKEEILEIPVNAIVPNRFQPRTIFSDEK
NOC_BACVZ       MKHSFSRFFGFGEKEE-------EPEIAEHDTNKEEILEIPVHAIVPNRFQPRTIFSDEK
NOC_BACLD       MKHSFSRLFGLGDKEE-------EAEIAEHDTNKEEIQEIPVGDIIPNRFQPRTIFSEEK
NOC_BACP2       MKHSLSRFFGLGDKEHPERETEIEAEIAEHDTLKEEIQELPVDTIMPNRFQPRTIFSEEK
NOC_OCEIH       MVHPFNRIFGKSDKEN--------IDTDEVEYSTDEVIQIKVDNIHPNRYQPRTIFQEEK
NOC_BACAH       MKNTFSRLFGFGDKES-EFELQDESHEEIDKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACAN       MKNTFSRLFGFGDKES-EFELQDESHEEIDKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACHK       MKNTFSRLFGFGDKES-EFELQDESHEEIDKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACCZ       MKNTFSRLFGFGDKES-EFELQDESHEEIDKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACC1       MKNTFSRLFGFGDKES-EFELQDESHEEIDKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACCR       MKNTFSRLFGFGDKES-EFELQDESHEEIDKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACMK       MKNTFSRLFGFGDKES-EFELQDESHEEIAKKVYEEIQEIPIVNITPNRYQPRTVFDDAR
NOC_BACCN       MKNTFSRLFGFGDKMS-ELEIQNESHEDINKKIHEEIHEIPIANIIPNRYQPRTVFDDAR
NOC_GEOKA       MKHPFSRLFSFGEK---------EQEEMEEKQEREEVRHIPVKSIIPNRFQPRTMFDEEK
NOC_GEOTN       MKHPFSRLFSFGEK---------EQEEAGGKQEREEVRNIPVASIIPNRFQPRTVFDEEK
NOC_LYSSC       MKSPFSRFFGGGSKTE--PIVKNEVEQAEAVHTAEEVIKLPIDQIVPNRFQPRTIFDDEK
NOC_LISMF       --MPFSRLFGKKEKNQ---------MDDIVEEGVQRVQELPMDKIFPNQFQPRTVFDQDK
NOC_LISMO       --MPFSRLFGKKEKNQ---------MDDIVEEGVQRVQELPMDKIFPNQFQPRTVFDQDK
NOC_LISIN       --MPFSRLFGKKDKNQ---------MDDIVEEGVQRVLELPMDKIFPNQFQPRTVFDQDK
NOC_LISW6       --MPFSRLFGKKEKNQ---------MDDIVEEGVQRVLELPMDKIFPNQFQPRTVFDQDK
                   .:.*:*.  .*                    :.: .: :  * **::****:*.: :

NOC_BACHD       IEELAQTIRTHGIIQPIVVRQRE--GKYEIIAGERRFRAVTLLGWETIPAIIKEFNDSQT
NOC_BACSK       IAELAQTIRTHGVIQPIVVRVRD--DKYEIIAGERRWRAVTSLQWETIPAIVKEFNDSQT
NOC_BACSU       IKELAMTIHTHGIIQPIVVRHTEEEGQYELIAGERRWRAVQSLEWEKIPAIIKDFSDTET
NOC_BACVZ       IKELAMTIHTHGIIQPIVVRHTEDEGQYELIAGERRWRAVQTLEWEKIPAIIKDFSDTET
NOC_BACLD       IKELAATIHTHGIIQPIVVRKTEREGQYELIAGERRWRAVQTLDWEKVPAIIKDFSDTET
NOC_BACP2       IHELATTIHTHGIIQPIVVRPTEEEGKYELIAGERRWRAVQTLQWEKIPAIIKDFTDTET
NOC_OCEIH       IKELAQTIHTHGMIQPIVVRKLEDEDTYELIAGERRWRAVQHLGWEQVSAIIRDMTDTET
NOC_BACAH       IEELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACAN       IEELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACHK       IEELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACCZ       IEELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACC1       IEELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACCR       IDELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACMK       IEELALTIRTHGLIQPIVVRQYE-DDKYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_BACCN       IDELALTIRTHGLIQPIVVRQYE-EDCYEIIAGERRFRAATKLGWEKVPAIIKNLNDTET
NOC_GEOKA       IDELALTIRTHGIIQPIVVRECG-NGRFEIIAGERRWRAVQKLGWTEIPAIIKNLNDKET
NOC_GEOTN       IAELALTIRTHGIIQPIVVRECD-NGQFEIIAGERRWRAVQKLGWTEIPAIIKNLNDKET
NOC_LYSSC       IEELSRTIHTHGVIQPIVVRKTS-ENQYEIIAGERRYRAMKKLQWTEVPAIVRNLTDKET
NOC_LISMF       IDELARTIRIHGVIQPIVVREME-PDYYEIIAGERRFRAVLSLEMEKIPAIIQNLDDEEV
NOC_LISMO       IDELARTIRIHGVIQPIVVREME-PDYYEIIAGERRFRAVLSLEMEKIPAIIQNLDDEEV
NOC_LISIN       IDELARTIRIHGVIQPIVVREME-PDYYEIIAGERRFRAVLSLKLEKIPAIIQNLDDEEV
NOC_LISW6       IDELARTIRIHGVIQPIVVREME-PDYYEIIAGERRFRAVLSLELEKIPAIIQNLDDEEV
                * **: **: **:*******     . :*:******:**   *    :.**:::: * :.

NOC_BACHD       ASVALIENLQREGLTAVEEAVAYQKLIELHGLTQESLAQRLGKGQSTIANKLRLLHLSEP
NOC_BACSK       ASIALIENLQREGLTAIEEATAYAKLIEIHNLTQESLAQRLGKGQSTIANKLRLLHLPQA
NOC_BACSU       ASVALIENLQREELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPQP
NOC_BACVZ       ASVALIENLQREELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPEP
NOC_BACLD       ASVALIENLQREELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACP2       ASVALIENLQREELSAIEEAHAYARLLELHDLTQEALAQRLGKGQSTVANKLRLLKLPEE
NOC_OCEIH       ASVALIENLQREELTVIEEAIAYSKLLELHSLTQEALAQRLGKNQSTVANKLRLLKLPEE
NOC_BACAH       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACAN       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACHK       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACCZ       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACC1       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACCR       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPEE
NOC_BACMK       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTVANKLRLLKLPEE
NOC_BACCN       ASVALIENLQREELTAIEEAVAYQKLIELHNLTQEALAQRLGKGQSTIANKLRLLKLPED
NOC_GEOKA       ASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQE
NOC_GEOTN       ASVALIENLQREELTPIEEAMAYARLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQE
NOC_LYSSC       ASIALIENLQREELTAIEEAVAYQKLLELHELTQEALAQRLGKGQSTVANKLRLLRLPDE
NOC_LISMF       AAIALIENLQREELTPIEEAKAYRSLLDMQDVTQEALAQRVGKSQSAIANKMRLLKLPET
NOC_LISMO       AAIALIENLQREELTPIEEAKAYRSLLDMQDVTQEALAQRVGKSQSAIANKMRLLKLPET
NOC_LISIN       AAIALIENLQREELTPIEEAKAYRSLLDMQDVTQEALAQRVGKSQSAIANKMRLLKLPET
NOC_LISW6       AAIALIENLQREELTPIEEAKAYRSLLDMQDVTQEALAQRVGKSQSAIANKLRLLKLPEA
                *::********* *: :*** **  *:::: :***:****:**.**::***:***:*.: 

NOC_BACHD       VQQAIMERKISERHARALLSLKDDALETKLLEEIVEQHLNVKQTEERVKELLEDAPASK-
NOC_BACSK       VQDAILNRDISERHARALIALKDAEAQEAVLKQIIEEQLNVKQTEERVKAYFKTAEEEA-
NOC_BACSU       VQEAIMEKKITERHARALIPLKQPELQVTLLTEIIEKSLNVKQTEDRVVKMLEQGQ----
NOC_BACVZ       VQDAIMEKKITERHARALIPLKQPEFQVTLLAEIIEKSLNVKQTEDRVVKMLEQNK----
NOC_BACLD       VQEAILKKEISERHARALIPLKQPDLQVKLLHEVIEKSLNVKQTEDRVVKMLEQDK----
NOC_BACP2       VQQAILEKKISERHARSLVPLKLPELQIALLQEIIEKQLNVKQTEERVVKMLEQKTD---
NOC_OCEIH       VQTALLDKAISERHARALIKLKQEDQQIAVLHEILEKGLNVKQTEDRIAQINEPKEK---
NOC_BACAH       IKSALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERITKLLEEAK----
NOC_BACAN       IKSALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERITKLLEEAK----
NOC_BACHK       IKSALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERITKLLEEAK----
NOC_BACCZ       IKNALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERITKLLEEAK----
NOC_BACC1       IKNALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERIAKLLEEAK----
NOC_BACCR       IKSALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERIAKLLEEAK----
NOC_BACMK       IKSALLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERIAKLLEEVK----
NOC_BACCN       IKRSLLEKSITERHARALIPLKNEELQLKVLQEIVEKQLNVKQTEERIAKLLEEVK----
NOC_GEOKA       VQEALLQRAITERHARALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGE----
NOC_GEOTN       VQEALLQRAITERHARALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKMLEAGE----
NOC_LYSSC       VQQAILQRKISERHARALIAIKDQPLQLEVLQQTVDNDWNVRQLEEQIQAILHPVTDEQE
NOC_LISMF       VQEAVLNKQISERHARSLLALETEEQQVAILAEIAENHWNVKQTEARIQEILGVKKPVA-
NOC_LISMO       VQEAVLIKQISERHARSLLALETEEQQVALLAEIAENHWNVKQTEARIQEILGVKKQVA-
NOC_LISIN       VQEAVLNKQISERHARSLLALETEEQQVSLLQEIEENHWNVKQTEARIQEILGVKKSVA-
NOC_LISW6       VQQAVLNKQISERHARSLLALETEATQVDLLAEIEENHWNVKQTEARIQEILGVKKPTT-
                :: ::: : *:*****:*: ::    :  :* :  ::  **:* * ::            

NOC_BACHD       --PKKK-PTRKAYSKDMRIAMNTIRQSVDMVMKSGLKVDTAEEEHEDFYQFTIRIPKKK-
NOC_BACSK       --PKKKKPKRKSYPKDMRIAMNTIRQSVDMVMKSGLKVDTDEEDNEEFYQFTIRIPKKK-
NOC_BACSU       ---RKPKPRRKAFSRDTRIAMNTIRQSLSMVEDSGVKLNTEEEEFEEYIQLTIRIPK---
NOC_BACVZ       ---QKPKPRRKAFSRDTRIAMNTIRQSLSMVEDSGVRLNTEEEEFEEYIQLTIRIPK---
NOC_BACLD       ---RKPKPKRKAYSRDARIAMNTIRQSLSMVEDSGVKLNTEEEEFEEYIQFTIRIPK---
NOC_BACP2       ---RKPRPKRKAFSRDTRIAMNTIRQSLHMVEDSGLKINTEEEEFEEYIQLTIRIPK---
NOC_OCEIH       ---KKPKPKFKGVNKDIRIAMNTIRQSLNMVSDTGVEVESDEKELDDYYQITIKIPKKNQ
NOC_BACAH       ---PKRKAKQKAVSRDTRIAMNTIRQSLQMVADSGLNVNSEEEEFDEYYQITIQIPKKK-
NOC_BACAN       ---PKRKAKQKAVSRDTRIAMNTIRQSLQMVADSGLNVNSEEEEFDEYYQITIQIPKKK-
NOC_BACHK       ---PKRKAKQKAVSRDTRIAMNTIRQSLQMVADSGLNVNSEEEEFDEYYQITIQIPKKK-
NOC_BACCZ       ---PKRKAKQKAVSRDTRIAMNTIRQSLQMVADSGLNVNSEEEEFDEYYQITIQIPKKK-
NOC_BACC1       ---PKRKAKQKAVSRDTRIAMNTIRQSLQMVADSGLNVNSEEEEFDEYYQITIQIPKKK-
NOC_BACCR       ---PKRKAKQKAVSRDTRIAMNTIRQSLQMVTESGLNVNSEEEEFDEYYQITIKIPKKK-
NOC_BACMK       ---PKRKAKQKAVSRDARIAMNTIRQSLQMVANSGLNVNSAEEEFDEYYQITIKIPKKK-
NOC_BACCN       ---PKRKAKKKAVSRDMRIAMNTIRQSLQMVAKSGLNVNSEEEEFDEYYQITIKIPKKK-
NOC_GEOKA       ---RKPKPKRKAFSRDMRIAVNTIRQSLSMVESSGVSVQSEEEEFDDYYQITIRIAKK--
NOC_GEOTN       ---RKPKPKRKAFSRDMRIAVNTIRQSLSMVENSGVSVHSEEEEFDDYYQITIRIAKK--
NOC_LYSSC       SVPKKAKPKRKAISKDVRIALNTIKQSLTMVTKSGITVKTEEEDTEEYYQITVKIPKKKK
NOC_LISMF       --TKKTKPKRQAISRDVRIAMNTIKQSVTMVKDNGMDLDFTEEETDDFYQITIQIPKKK-
NOC_LISMO       --TKKTKPKRQAISRDVRIAMNTIKQSVTMVKDNGMDLDFTEEETDDFYQITIQIPKKK-
NOC_LISIN       --TKKTKPKRQAISRDVRIAMNTIKQSVTMVKDNGMDLDFTEEETDDFYQITIQIPKKK-
NOC_LISW6       --TKKTKPKRQAISRDVRIAMNTIKQSVTMVKDNGMDLDFKEEETDDFYQITIQIPKKK-
                    *  .  :.  :* ***:***:**: ** ..*: :.  *:: ::: *:*::*.*   

NOC_BACHD       -
NOC_BACSK       -
NOC_BACSU       -
NOC_BACVZ       -
NOC_BACLD       -
NOC_BACP2       -
NOC_OCEIH       -
NOC_BACAH       -
NOC_BACAN       -
NOC_BACHK       -
NOC_BACCZ       -
NOC_BACC1       -
NOC_BACCR       -
NOC_BACMK       -
NOC_BACCN       -
NOC_GEOKA       -
NOC_GEOTN       -
NOC_LYSSC       V
NOC_LISMF       -
NOC_LISMO       -
NOC_LISIN       -
NOC_LISW6       -