CLUSTAL format seed alignment for MF_02019

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B8E329_DICTD          --------MKLDLTVEDILEATNGVLIKGDI-----REKVDSISTDTRNINED----EVF
O67002_AQUAE          ----------MQITSQTLAKILKGSLVGSP------NIPVKTFSIDSRTIKQG----EVF
B5YFT9_THEYD          -----------MFTLDDLLIATGGKLVSKG------NEIFKEASIDTRTIGKN----DLF
Q6HPE7_BACHK          ---------MINRTLKQVEQMINGTGLAEQY----EGITIQGVSIDTRKIEKG----NLY
Q81IU0_BACCR          -------------MLKQVEQMVNGTELAEQY----EGITIQGVSIDTRKIEKG----NLY
MURF_BACSU            ---------MIKRTVKNIAEMVKGTLANPQY----EQTVIHGVATDTRKLEQH----QLF
Q8Y8P0_LISMO          ----------MKKTVGEVVAMLDSSIHVDAF----RDVVITGVCFDTRQIKSG----DLF
Q2FWH4_STAA8          ---------MINVTLKQIQSWIPCEI-EDQF----LNQEINGVTIDSRAISKN----MLF
Q837J3_ENTFA          ----------MKLTFWEVAQAVEASNDWQQW----PDFPLTGIEFDSRKIVKG----NLF
F9UKZ5_LACPL          ----------MKMQVAEIAKAVQAVNAEQAW----PDVNVTGVAFDSRKLQAG----DLF
Q9CIL4_LACLA          ----------MKLTIHEIAQVVGAKNDWSQL----ADLSVNKIEFDSRLIEKG----DIF
Q8DNV6_STRR6          ----------MKLTIHEIAQVVGAKNDISIF----EDTQLEKAEFDSRLIGTG----DLF
A5I1T7_CLOBH          ---------MENIKLEEIIKAVNGELVITGE----KD-EYNSVSTDTRKIEKG----DIF
Q97H85_CLOAB          ------------MTFNEIAKAVNGKVILRGS----KD-VFNDVSIDTRKLSKG----AIF
I7F9Q4_GEOSL          ----------MLFTLDDILGATG-GEIVAGG----ETIGASGVSTDSRTVEPG----ELF
Q728U4_DESVH          ----------MQLTPNEMRESLGAGAILGAQ----GDATFAAVRSDSRKVAPG----DLF
Q2RK83_MOOTA          ---------MLTATVREICDAIGGYLVAGD-----PAVVVKGLSTDSREIQPG----MAF
A9WG77_CHLAA          ---------MIRQAVT---------LPPSW-----ANAQIGPVVTDSREVTPG----SLF
Q1IKG6_KORVE          ----------MKLALWRIAEFIHG-TGDYR-----AGAEALGYSIDSRTIKPG----ELF
A0R020_MYCS2          ---------MIDMTIARIAEIVGGELADITPEQAAATHVTGTVEFDSRAVGPG----GLF
MURF_MYCTU            ---------MIELTVAQIAEIVGGAVADISPQDAAHRRVTGTVEFDSRAIGPG----GLF
Q9S2W8_STRCO          ---------MITLSLAEIAEVVGGRMHDIP---DASAEVTGPVVRDSREAGPG----SLF
Q8NNN1_CORGL          ---------MITMTLGEIADIVGGRLTGGA---QEDTLVSSSVEFDSRSLTPG----GLF
Q8G4Q8_BIFLO          ---------MVPMSVEEIAKAVDGRLIGDAG---SESRATNTVS-DSRQAGPG----SVF
Q8DIM9_THEEB          --------MQPHWRGKIVNTTLGAIAQALGLDTTHPNLPITGICTDSRQIAAG----NLF
MURF_SYNY3            --------MNSKLSLFDIRTFLESC--LLSVTNLSEDIRINNICTDTRSLVSG----DLF
Q7NHY6_GLOVI          ---------MFEIDTQTLQTLLGAE------AEGTLPMSVRGVGTDTRALAPG----ALF
Q7VBP1_PROMA          ----------MVLRLLNLNDIWGPP---YQNKLVNLDAPLGTVCTDSRNIKKG----NFF
F8KYA2_PARAV          -------MSVNRLTFHEICQILNSPVFP-----AEIDSFTPSVVVDSRLLQKN----DLF
Q6MBS2_PARUW          ---------MRIMTLKQIAKILNSSL-------PEVEGVVKGFCVDSRLTKKN----EVF
Q83F27_COXBU          -----------MMKLSEAAKIVNADLTGE-------DTVFENVSTDTRTIQPG----SLF
Q9HVZ7_PSEAE          --------MLEPLRLSQLTVALDARLIGE-------DAVFSAVSTDSRAIGPG----QLF
MURF_ECOLI            ---------MISVTLSQLTDILNGELQGA-------DITLDAVTTDTRKLTPG----CLF
Q32K06_SHIDS          ---------MISVTLSQLTDILNGELQGA-------DITLDAVTTDTRKLTPG----CLF
Q8ZRU6_SALTY          ---------MISVTLSKIADVLGAEHRGA-------DLTLDTVITDTRKVTPG----CLF
A0A0E1NRW9_YERPA      ---------MIKVSLRFLASLLNAEYIVAES--VSDDIEITEVTIDTRKVTAG----CLF
MURF_HAEIN            ---------MIKLSTVQLAQILQAKLIGDE------NVQVEKINTDTRKSVSN----SLF
Q5E2P6_ALIF1          ---------MITMLLSEIAKACDGRLVGA-------DCQISSVSTDSRHIDEE----GLF
Q9KPG3_VIBCH          ---------MIRVMLSQLSSVLNARLIGE-------DRAVSAVSTDSRAIPAE----ALF
Q8E9P4_SHEON          ---------MIPISLKALSQHLGAHRVGD-------DVTVQALSSDSRKIGPA----TLF
Q9K0Y8_NEIMB          ---------MKPLDLNFICQALKLPMPS-------ESKPVSRIVTDSRDIRAG----DVF
Q5F6L2_NEIG1          ---------MKPLDLNFICQALKLPMPS-------ENKPVSRIVTDSRDIREG----DVF
Q63QJ3_BURPS          ---------MTMLTLREAAAMIPGATVLGD-----ERASFERVSTDSRSAGPG----DLF
Q8PCK3_XANCP          ---------MKLTPLSLIAHFAGGELHG-------DDAMIDAVGNDTRALASG----SLY
MURF_BUCAI            ---------MISLSLKKIALITNGTLYGA-------DLLINEIVIDTKKIIPG----CLF
Q2RVU0_RHORT          MKTSPLPAERATPLVLWTAATAAAALGIAAS--GAWTA--TGVCIDSRAVVAG----DLF
Q3J4M9_RHOS4          ----------MTP--LWTSDEAAATTGGRAT--RAFAA--TGVSIDTRSLGPG----DLF
Q9A596_CAUVC          -----------MPDALWTADEIAEAVGGQVA--GDFAV--SGVSIDTRTVEPG----DLF
A9CIA7_AGRFC          ------------MSWLWTVADMIAITAGRPV--GNLPTGITGISIDSRTVKQG----EAF
MURF_RICPR            --------------MIWNSKTLSIALG-IEI--SNSVNCNE-VQFNSKDVKKG----DLF
A5CD82_ORITB          -----------MKCNIWSAADLTAALG-VPV--NVNVNVNGIVQFNSKDIQPG----DLF
Q8A1L7_BACTN          ------------MKLSALYQIF---------------LDCQLVTTDSRNCPEG----SLF
A6GZF0_FLAPJ          ------------MKIEEIYQCY---------------LQCTSVSTDTRKIENN----SLF
Q8KGD0_CHLTE          ---------MKMKGALMFSDFERAGTVVARDVGEGYRLDDPVVVIDSRKAVDG----AVF
Q5NHM7_FRATT          ----------MIKSLKQLAIQAGLEYLGE-------DVSIQTVAINSNEVRQD----CLF
Q9WY78_THEMA          ----------------------------------MKDLLTRRFVLNSKEVREG----DVF
I4BW64_ACEMN          ----------MNCKHASSITLTIGNLLGCTSVCGKDIGMPCRVETDSRKIKEG----DIF
D5EEG6_AMICL          -------MKWQLWKVSDLAESIGASWWGEDI------ILPDFFTADSREVRPG----AAF
Q83GN5_TROWT          ----------MLIRRADIQRVTGGILHNTSLS-ESLLPINGRLKIDSRNISQG----DIF
MURF_BORBU            ----------MRIKIKDILISSKDVKFVGNI--KNIERVVSFYSLDSREIKDDNINDSLY
                                                                   ::.           :

B8E329_DICTD          IALKGEK-FDGHDFVKDAILKGVKGIIISREI----------------------------
O67002_AQUAE          IPLKGQK-FDAHNFIPDAFKKGAVGVISEREV----------------------------
B5YFT9_THEYD          FALKGSK-KDGHEFVDEALIKASGAVVSKNEG----------------------------
Q6HPE7_BACHK          VPIQGER-FDGHAFVDKAVENGAVATLWVKDVA---------------------------
Q81IU0_BACCR          VPIQGER-FDGHAFVDKAVENGAVATLWMKDVA---------------------------
MURF_BACSU            IPLKGER-FDGHSFVEQAFEAGVAAVLWDRSVP---------------------------
Q8Y8P0_LISMO          VPFVGNV-RDGHEFVGQAREMGAVATFWQKNVP---------------------------
Q2FWH4_STAA8          IPFKGEN-VDGHRFVSKALQDGAGAAFYQRGTPI--------------------------
Q837J3_ENTFA          VPLQGE--NDGHRFIESAMANGCQAAFWGQDLVD--------------------------
F9UKZ5_LACPL          IPLMGA--NDGHQYIQSAIEHGAVATLWASDHAD--------------------------
Q9CIL4_LACLA          LPLKGA--RDGHDFIEIAFDNGAIISFS-----E--------------------------
Q8DNV6_STRR6          VPLKGA--RDGHDFIETAFENGAAVTLS-----E--------------------------
A5I1T7_CLOBH          IALKGEN-FNGNNFVEMAIEKGAALCIVSEINFSEG------------------------
Q97H85_CLOAB          IAINGEN-FNGNKFIHNAVQKGAALCIVDEIHFEKD------------------------
I7F9Q4_GEOSL          IPLRGER-FDGHDYLDAARARGVRLTLVERQWLAGRQLPADVT-----------------
Q728U4_DESVH          VCIRGER-FDGHDFAADVVRQGARVLIAERDPFNGECPSADVT-----------------
Q2RK83_MOOTA          VALKGER-FDGHDFIGAALSGGAAAAIG------TSFPGHQVVGLRPGQ-----------
A9WG77_CHLAA          VALTGER-TDGHRFLADVVTRGAAAALVSPEKL-TALASNLDTVARPWRLIEPAQAQTLA
Q1IKG6_KORVE          FAVKGER-LDGHDYVQAALDRGAVAAVVS-----REFPARFNGTR---------------
A0R020_MYCS2          LALPGAR-SDGHDFAAAAVQSGAVAVLAARPV---GVPAIVVRPDGGVDSASGALEHD--
MURF_MYCTU            LALPGAR-ADGHDHAASAVAAGAAVVLAARPV---GVPAIVVPPVAAPNVLAGVLEHD--
Q9S2W8_STRCO          VAFVGER-ADGHDFAARVVEAGAVAVLGSRPV---GVPAIVV------------------
Q8NNN1_CORGL          LALPGAR-VDGHDFAATAIEKGAVAVLAAREV---DVPAIVVPPVKIQESNADIYAHD--
Q8G4Q8_BIFLO          VAIRGER-VDGHDFVAKTAGQGATVAIVDHEVKSDGLPQIVVK-----------------
Q8DIM9_THEEB          VALRGET-FDGHQFVDQAAAAGAIALMVEAP----LSSDLPQL-----------------
MURF_SYNY3            LALRGES-FDGHSFIPQALTAGAIAVVTDRPVE-GLGETVAQF-----------------
Q7NHY6_GLOVI          VALRGER-FDGHDYARQAVAGGAALVIAERP------VAVPHL-----------------
Q7VBP1_PROMA          VPLIGNK-FDGHLFLEEVFEKGVQAAFISKDCNLAIPEELLYW-----------------
F8KYA2_PARAV          IALPGEK-TDGHHFLNEVEKKGAAAAIVSNDFLRQNKTNFHMP-----------------
Q6MBS2_PARUW          VALRGEH-VDGHAYLNEVKQKGALAAIVDQNYQG---PVFGMH-----------------
Q83F27_COXBU          IALRGPN-FDANDFIAKAEEQGAVGAVVNR-V----------------------------
Q9HVZ7_PSEAE          IALSGPR-FDGHDYLAEVAAKGAVAALVEREV----------------------------
MURF_ECOLI            VALKGER-FDAHDFADQAKAGGAGALLVSRP-----------------------------
Q32K06_SHIDS          VALKGER-FDAHDFADQAKAGGAGALLVSRP-----------------------------
Q8ZRU6_SALTY          VALKGER-FDAHDFADKAKANGAGALLVSRP-----------------------------
A0A0E1NRW9_YERPA      VALKGER-FDGHDFAEDAIAAGAGALLVSKR-----------------------------
MURF_HAEIN            FALKGEK-FDAHQYLDQAVSQGALALVVQQEN----------------------------
Q5E2P6_ALIF1          VALIGER-FDAHDFIPAVQEQGATALLVSKE-----------------------------
Q9KPG3_VIBCH          VALVGER-FDAHDFASQAVTGGAVALLVERE-----------------------------
Q8E9P4_SHEON          VALKGDR-FDGHDFAATAIENGAIALLVERE-----------------------------
Q9K0Y8_NEIMB          FALAGER-FDAHDFVEDVLAAGAAAVVVSRED----------------------------
Q5F6L2_NEIG1          FALAGGR-FDAHDFVGGVLSAGAAAVVVSRED----------------------------
Q63QJ3_BURPS          VALKGER-FDAHDFVGDVAARGASAAIVSRSP----------------------------
Q8PCK3_XANCP          VALRGER-FDGHDFAADAVARGASGLLVDRLL----------------------------
MURF_BUCAI            IALIGRK-FDAHIFIHDALKKKCAAFVTQKN-----------------------------
Q2RVU0_RHORT          IALAGERT-DGHAHVEAALTAGASAALVSRI----------------------------P
Q3J4M9_RHOS4          VALTDQR--DGHAFVAEALARGAAAALVSRR----------------------------P
Q9A596_CAUVC          VPLVGVR--DGHDFVPQAVANGAAGVLAAR------------------------------
A9CIA7_AGRFC          FAIKGDRV-DGHDYTSFAVANGASLLVVAEAKL--------------------------P
MURF_RICPR            IALQGNR--DGHDYIQDAIDKGATAVIVSKQ-----------------------------
A5CD82_ORITB          IALQSENGGDGHQFVNDALARGADAVIVSKL-----------------------------
Q8A1L7_BACTN          IALKGES-FNGNAFAGKALETGCAYAVIDESE----------------------------
A6GZF0_FLAPJ          IALKGDN-FDANTFAEEAISKGALFVIIDDKK----------------------------
Q8KGD0_CHLTE          VALPGER-TDGHRFVGEVFANGASWAVVSREWFVEKGAEHQ-------------------
Q5NHM7_FRATT          VAIVANR--DGHEFIPSAIANGAKAILVSKKQ----------------------------
Q9WY78_THEMA          VAVKGKR-FDGHDFIDEALRNGAYAIIAERKTVN--------------------------
I4BW64_ACEMN          VALKGER-LDGHDFILDAVRRGARGVILKQEEMPKYSELLQ-------------------
D5EEG6_AMICL          VAIRGNA-EDGHDYIKDALHQGASLIIAEKGR-------------------------IPQ
Q83GN5_TROWT          VAHTGTK-FDGHEFLYQAKQSGASLAIVTRVQ----------------------------
MURF_BORBU            FAYKGNK-VDGFSFVKYLIDLGVKCFACSREHESECIKYLN-------------------
                      .        :.  .                                              

B8E329_DICTD          -AVEGNIFVIRVQDTLKALQDIANYYRRKL--KTKVIGVTGSSGKTTTKNLIGKLLSIVG
O67002_AQUAE          -DVPPGKFLIKVRSTLESLREIAKFKRENF--KGKVIGVAGSAGKTTTKELLSHLLSIKG
B5YFT9_THEYD          -MDFKNKTVVIVDDTLKSLQNLAGYLRKKF--KGKIIAVVGSNGKTTTKELIASFLSKKY
Q6HPE7_BACHK          -NPPENLPVIFVEDTLSALQMLAKNYRDQL--DVKVIGVTGSNGKTSTKDIVTSLLATKF
Q81IU0_BACCR          -NPPENLPVIFVEDTLSALQMLAKNYRDQL--DVKVVGVTGSNGKTSTKDIVTSLLATKF
MURF_BACSU            -NPPENHAVILVDDTLTALQQLAKAYLQEL--GTRVIGVTGSNGKTTTKDMIHAVLGTQY
Q8Y8P0_LISMO          -NPPTDFPVILVEDTLLALQELAAKYIQQV--KPKVIAITGSNGKTTTKDIMAAIVETTY
Q2FWH4_STAA8          -DENVSGPIIWVEDTLTALQQLAQAYLRHV--NPKVIAVTGSNGKTTTKDMIESVLHTEF
Q837J3_ENTFA          --APQQLPVLHVTDPLVAMQKLATYYLNKM--QPNVIAVTGSNGKTTTKDLIAAVLSEKF
F9UKZ5_LACPL          -DVPEDLPVIMVADTLTALQQLGQYYLQKI--NPKVVAVTGSNGKTTTKDMIASVLSTQF
Q9CIL4_LACLA          -KEV-EQAHLLVDDNLLAFQKLAKYYLEKT--KVPVIAVTGSNGKTTTKDMIAAVLSKKF
Q8DNV6_STRR6          -KEVSNHPYILVDDVLTAFQSLASYYLEKT--TVDVFAVTGSNGKTTTKDMLAHLLSTRY
A5I1T7_CLOBH          -KVSKSSYVIKVENTNKALLDLAKYYRSKL--DIKVVAITGSTGKTSTKDLVAAVLSEKY
Q97H85_CLOAB          -SFKEDISILLVEDTKKALLDLAEFYRSTL--NIKVVAITGSTGKTSTKDITASVLRSKF
I7F9Q4_GEOSL          --------CIVVDDTLRALGDLAACHRR-RF-DIPVVAVTGSNGKTTTKEMLAAILARTG
Q728U4_DESVH          --------IMVVDDSVKALGRLANLHRM-RS-KARVVGVTGTAGKTTVKELLAQVLGVRG
Q2RK83_MOOTA          -------ALIQVDDTLLALQKLAAYHRQKVL-KGPLIGVTGSSGKTTTKNLIAAVLSPVL
A9WG77_CHLAA          TVPPDACLLIAVDDPLFALQRVAVYHRQ-MF-TPTVIGITGSVGKTSTKEVVAAVCSRRL
Q1IKG6_KORVE          -------NLLVADDPLLALHRLAEMVRS-LW-HHPVVGVTGSAGKTTTKECIAHVLASKL
A0R020_MYCS2          ----TDGSGAAVLAALARLAAAVANELAAD--GLKIIGVTGSSGKTSTKDLLAAVLAPLG
MURF_MYCTU            ----NDGSGAAVLAALAKLATAVAAQLVAG--GLTIIGITGSSGKTSTKDLMAAVLAPLG
Q9S2W8_STRCO          ---------DDVQAALGALARHVVRRL-----GTTLVALTGSAGKTSTKDLIAQVLRRKA
Q8NNN1_CORGL          ----PDGHGAAVVEALSRLARHVVDICVAGH-QLNVVAITGSAGKTSTKDFIATVLDQDG
Q8G4Q8_BIFLO          ---------DTVDALGELARYNIVRRRELDG-DFDIIGLTGSVGKTTTKDLLSSLLATVG
Q8DIM9_THEEB          ----------QVANTLSAYQRLGQWWRQ-QC-PAKVIAVTGSVGKTTTKEMIAAVLSHYG
MURF_SYNY3            ----------LVEDTLVAYQHIAAGWRQ-RF-TIPIIGVTGSVGKTTTKELIAAVLSQFG
Q7NHY6_GLOVI          ----------RVADTLEAYQTLARWWRD-RC-TLPVVAVTGSAGKTTTRELIRAVLATAG
Q7VBP1_PROMA          ----------QVDDTQEAYQKLAFLHRR-LF-SIPVVAVTGSAGKTTTRELIHSSLVPLG
F8KYA2_PARAV          --------ILGVDDVLEALQKLAQEYLK-QR-QVKIVAITGSVGKTTTKHLLFQLLQKHF
Q6MBS2_PARUW          --------LFRTENPLLALQMLAQKCL--EK-TSRVVAVTGSIGKTTTKEFIKTLLEQRY
Q83F27_COXBU          --VKTTLPLIFVSDTLEALGRLARYQREQI--PIPAIVVTGSCGKTTTRALLASVFR---
Q9HVZ7_PSEAE          --ADAPLPQLLVRDTRAALGRLGALNRRKF--TGPLAAMTGSSGKTTVKEMLASILRTQA
MURF_ECOLI            --LDIDLPQLIVKDTRLAFGELAAWVRQQV--PARVVALTGSSGKTSVKEMTAAILSQCG
Q32K06_SHIDS          --LDIDLPQLIVKDTRLAFGELAAWVRQQV--PARVVALTGSSGKTSVKEMTAAILSQCG
Q8ZRU6_SALTY          --LDIDLPQVIVKDTRQAFGQLAAWVRMQV--PARVVALTGSSGKTSVKEMTAAILSQCG
A0A0E1NRW9_YERPA      --LLVGGPQLVVKDTRLALGQFAAWVRQQV--PARIVALTGSSGKTSVKEMAAAILRQCG
MURF_HAEIN            --SSISVPQLVVKDTRIALGELAKWLREKI--NPRTVAMTGSSGKTTVKEMTASILQHTA
Q5E2P6_ALIF1          --VDTTLPQVIVSDTQKALGLVAKHVHQVC--HTFTFALTGSCGKTTVKEMLASILTRSG
Q9KPG3_VIBCH          --LDAECSQLVVADTKQALGQLGSWVHAQC--QTPTVAITGSCGKTTVKEMVASILSQKG
Q8E9P4_SHEON          --LAFDIPQLIVADCQKAMGAIGAYVRDQV--NPICVALTGSNGKTSVKEMIATILSAKH
Q9K0Y8_NEIMB          --CAAMDGALKVDDTLAALQTLAKAWRENV--NPFVFGITGSGGKTTVKEMLAAVLRRRF
Q5F6L2_NEIG1          --CAALGGALKVDDTLAALQTLAKAWRDNV--NPFVFGITGSGGKTTVKEMLAAVLRRRF
Q63QJ3_BURPS          --AEWNLPALKVADTRAALGALAHGWRMRF--SMPLVAVTGSNGKTTVKEMIASIFAAAV
Q8PCK3_XANCP          --PALHVPQVVVANTELALARIAAGMQRDR--ATRVIALTGSNGKTSVKALLLAILAEAG
MURF_BUCAI            --IKPHVPYIIVENTSIALGQIAGWVRKKT--KAKILAITGSCGKTSVKEMTASILRKNG
Q2RVU0_RHORT          AGIATDR-LLVVEDTLEGLWALARASRARF--AGKLVGVTGSLGKTGTKEMLTQALGRFG
Q3J4M9_RHOS4          EGLPEDAPLLLVPDVLEGLRALGRAARART--RARVVGVTGSVGKTSTKEMLRATLGGQG
Q9A596_CAUVC          ---AVDAPAVMVADTFKALEALGVAARERAP-QCKRGAVTGSVGKTSVTRAIEAGLRLAG
A9CIA7_AGRFC          ALGRLTVPMIVVEDVLAALGKLALAARERT--SARIIAVTGSVGKTTTKEMLRQALAPSG
MURF_RICPR            VEINDKDKIILVNNSFEALQKMALYKRENSK--AKFIAITGSVGKTSTKEALKILLQHDF
A5CD82_ORITB          IDNNANDKIILVNNTMSALSQLANYRRQQLK-NTTFIGITGSVGKTSTKEIMFKVFSTYY
Q8A1L7_BACTN          YAIEGDQRYILVDDCLQTLQQLANYHRRQL--GTRVIGITGTNGKTTTKELISAVLSQSH
A6GZF0_FLAPJ          HHTNKD-KMILVLDSLQTLQELAKYHRQQL--GLPIIALTGSNGKTTTKELINVVLSKKY
Q8KGD0_CHLTE          ---GDDRRFLVADDPVKAFQQLAAAYRERF--DIPVIGIGGSNGKTTTKEMLAAVLSTSF
Q5NHM7_FRATT          ---GLDIPQVVCGNTIKGLRALAKEYRKSL--TMPIISLTGSCGKTSVKEMIVTLLGERK
Q9WY78_THEMA          -----SDRIFLVESSVDTLAKLAREKLGNF--SGTVVGVTGSSGKTTTKEILYNLLKNKR
I4BW64_ACEMN          ---GKDVTLFGVQSPERAIVDAAVRYLSSFSSLKDIIAITGSVGKTTTKDAIGRILQGKY
D5EEG6_AMICL          GLSIRDRAVIEVNDSVVDLARMASAYLSACL-PDEVIAITGSVGKTTTREVLKKCFEGMP
Q83GN5_TROWT          ---EIDLPQLLVGNVTEAMHAIAGFKLCLSRDTITVIGITGSNGKTTTKSVLAYVLSKFG
MURF_BORBU            --DNEGLVFLLTSNVIKLLQALASFLIEKT--SFKRIAITGSNGKTTTKEMLYSILSKKY
                                                            : *: *** .            

B8E329_DICTD          K-----TYVSRENFNNEIGVPLSILDAEEDVD-FLVLEMAMRNKGEISLLSKIAEPDIGV
O67002_AQUAE          K-----VYKSPGNLNSQVGLPLAVANASLETD-FWVLEHGASKRGEIKNLIEITKPHVRL
B5YFT9_THEYD          K-----ILKTEGNFNNNIGVPLCISRIENNTE-IMVLELGTNRPGDIKELCDIVYPDYAL
Q6HPE7_BACHK          K-----VQKTEGNFNNHIGLPLTILNLEENTE-VAVLEMGMSSRGEIEFLSKLARPNAAI
Q81IU0_BACCR          K-----VQKTEGNFNNHIGLPLTILNLEENTE-VAVLEMGMSSRGEIEFLSKLARPNAAI
MURF_BACSU            R-----VHKTGGNFNNHIGLPLTVLAMPENTE-IAVLEMGMSAKGEIDLLSRLANPDAAV
Q8Y8P0_LISMO          K-----VHYTGGNFNNHIGLPYTILTMPEDTE-VAVLEMGMNHRHEIEVLSKIAKPDIAI
Q2FWH4_STAA8          K-----VKKTQGNYNNEIGLPLTILELDNDTE-ISILEMGMSGFHEIEFLSNLAQPDIAV
Q837J3_ENTFA          V-----TYKTQGNYNNQIGLPYTILHMPDETE-KLILEMGMDHAQEISFLSNLAQPEVAA
F9UKZ5_LACPL          N-----VTKTHANFNNQIGVPVTLLSMEPNTE-VVVVEMGMDHFGELDFLSRLVQPDVAV
Q9CIL4_LACLA          K-----TYKTQGNHNNEIGLPYTILHMPDDTE-KLVLEMGMDHPGDIDFLSELAKPELAV
Q8DNV6_STRR6          K-----TYKTQGNYNNEIGLPYTVLHMPEGTE-KLVLEMGQDHLGDIHLLSELARPKTAI
A5I1T7_CLOBH          K-----VFKTEGNFNNEIGLPLMIFKLDKSYD-IAVLEMGMNHFNEIHNMAEAAKPDIAI
Q97H85_CLOAB          R-----VFKTSGNFNNEIGLPLMIFKLDKSYE-VAVLEMGMNHFNEIHNMAKAARPDIAL
I7F9Q4_GEOSL          E-----GLKTEGNLNNLIGVPRMLFRLSGVHR-WAVLEIGMSEFGEIDRLAEIVRPDVGI
Q728U4_DESVH          D-----TARNPLNLNNQIGLPLSMLEATGNES-FWVMEAGISQPQDMDELGAVLRPDIGL
Q2RK83_MOOTA          K-----VLKTPGNFNNEIGLPMTLLRLAPWHQ-AAVVEMAMRGKGEIASLAAIARPTIGV
A9WG77_CHLAA          R-----TLKSQRSFNSEVTLPATLLGLTADHQ-VAVLEMGMWAAGEIRFLATLARPQIGI
Q1IKG6_KORVE          K-----VLKSEGNLNNHFGLPLQLLKVEPEHE-IAVIEMGMSHAGEIAALAKLAQPNTGV
A0R020_MYCS2          E-----VVAPPGSFNNELGHPWTVLRATRDTD-FLVLEMSARHPGNIAALAAIAPPSVAV
MURF_MYCTU            E-----VVAPPGSFNNELGHPWTVLRATRRTD-YLILEMAARHHGNIAALAEIAPPSIGV
Q9S2W8_STRCO          P-----TVFTPGSMNNEVGLPLTALTATDETK-FLVLEMGARGIGHIRYLTELTPPKIGA
Q8NNN1_CORGL          P-----TVAPPGSFNNELGLPHTALRCTTDTK-YLVAEMSARGIGHIKHLTEIAPPRIAA
Q8G4Q8_BIFLO          P-----TVAPVGSFNNEIGLPLTALRVDEHTR-FFVAEMGASHIGEIARLTRIAPPNTAI
Q8DIM9_THEEB          A-----VLKTEANFNNEIGVPKTLLQLEPHHQ-FAVIEMGMRARGEIALLSQIAQPDVAV
MURF_SYNY3            N-----VHKTRANYNNEIGVPKTLLELSPDHD-FAIVEMAMRGRGQIALLADIAKPTIGL
Q7NHY6_GLOVI          P-----VLAPPGNENNDVGVPKLLLQLTGAHR-YCVVEMGMRGPGEIARLARCAAPNVGV
Q7VBP1_PROMA          E-----VLATSNNNNNDIGVPFTLLKANVNHS-AIVLEMAMRGLGQIERLSKCACPDIAV
F8KYA2_PARAV          S-----VAFSPGNQNSQIGLPLSILNHYHGHEDVLILEMGMTAQGHIQKLIEIAPPDIAI
Q6MBS2_PARUW          V-----TAASQGNSNSQVGLPLTVLNHTTGTEDILVLEMGMTEPGQLSTLVNIAHPEVSV
Q83F27_COXBU          -QCGNVLASE-KSFNNNIGVPLTLLRLRPDHH-YAVLELGANHPGEITYLTGLAKPSVAI
Q9HVZ7_PSEAE          GDAESVLATR-GNLNNDLGVPLTLLQLAPQHR-SAVIELGASRIGEIAYTVELTRPHVAI
MURF_ECOLI            N----TLYTA-GNLNNDIGVPMTLLRLTPEYD-YAVIELGANHQGEIAWTVSLTRPEAAL
Q32K06_SHIDS          N----TLYTA-GNLNNDIGVPMTLLRLTPEYD-YAVIELGANHQGEIAWTVSLTRPEAAL
Q8ZRU6_SALTY          N----TLYTA-GNFNNDIGVPITLLRLNHDYD-YAVIELGANHQGEIAWTVSLTRPEAAL
A0A0E1NRW9_YERPA      N----VLYTA-GNFNNDIGVPLTLLRLTAEHD-FAVIELGANHVGEIAYTTDLSRPESAL
MURF_HAEIN            ADSEAVLFTN-GNFNNDIGVPLTLLRLTEKHR-FAVIELGANHQNEINYTTKLVQPNAAL
Q5E2P6_ALIF1          E----VLATA-GNFNNEIGVPLTLLRSQPSND-FAVIELGANHQNEISYTTQLAQPNVAL
Q9KPG3_VIBCH          Q----VLYTQ-GNFNNDIGVPLTLLRSTTEDD-YAVIELGANHVGEIAYTTALVKPDVAL
Q8E9P4_SHEON          Q----VLYTA-GNFNNEIGVPLTLLRLTPEDK-YGVFELGANHKGEIDYTSGLVRPHVAL
Q9K0Y8_NEIMB          GDDAVLATA--GNFNNHIGLPLTLLKLNEKHR-YAVIEMGMNHFGELAVLTQIAKPNAAL
Q5F6L2_NEIG1          GDDAVSATA--GNFNNHIGLPLTLLKLNEKHR-YAVIEMGMNHFGELAVLTQIAKPDAAL
Q63QJ3_BURPS          GEHARLATA--GNFNNDVGLPLTLLRLNAAHR-LAVVELGMNHPGETEMLAKIAAPTVAL
Q8PCK3_XANCP          RVDGITAYANPGNRNNEIGLPLAVIAAPDDAD-LAVYEMGAGKPGDIAYLTDIARPDVAL
MURF_BUCAI            N-----TISTIDNLNNNIGVPMTLLQLKQEHK-YGVIELGASKPGEIAYTSNISQPDIIL
Q2RVU0_RHORT          R-----VHATEGNLNNHFGLPLTLARMPADTD-LAVIELGMNHPGELGPLARLARPHVAI
Q3J4M9_RHOS4          T-----VHAAEASYNNHWGVPLTLARMPADVD-FAVVEIGMNHPGEIAPLSRLARPHLAL
Q9A596_CAUVC          K-----AHASVKSYNNHIGVPLTLARMPRDTE-RAVFEVGMNHAGEIVPLSGFVRPHAVA
A9CIA7_AGRFC          R-----VHAAVASFNNHWGVPLTLARMPADTE-FGVFEIGMNHSGEIRPLVKMVRPHVAI
MURF_RICPR            I-----VFASRGNFNNYLGLLINLASMADDTE-YAIFELGMNHQGEISELVQILKPNIAM
A5CD82_ORITB          K-----TFASRKNFNNLLGMLLNLASVPINTE-YAIFELSTSSPGGLQKLVKILPLNIAV
Q8A1L7_BACTN          N-----ILYTLGNLNNHIGVPSTLLRLKAEHD-LAVIEMGANHPGEIKFLSEIAEPDCGI
A6GZF0_FLAPJ          N-----AKATIGNLNNHIGVPLTLLSFDEDTD-IGIVEMGANHQKEIELLCSIAEPNFGY
Q8KGD0_CHLTE          N-----VLVTQGNYNNHLGVPLTLLQMRRDTE-VAVIEMGINHPGEMEFLSSLAKPTHGL
Q5NHM7_FRATT          V------HFTQGNLNNYLGVPMTILETPHDVD-FAVIEAGTNVGGEIKAAADIIQPNIAM
Q9WY78_THEMA          S-----VFKTPGNMNTEYGLPLSILNDYKGEE-ILVLEMAASRPGDIAHLCKIAPPDVAV
I4BW64_ACEMN          K-----AHVSAGNHNTLLGCSLTVLSAPSDTE-YLVLEMGANAKGEIAEIADHFPPSMAV
D5EEG6_AMICL          L-----VFGAEKSFNTLIGCSLTILAMPAGTN-VLILEMGTNKPGEIEEMVQYFPPTRCI
Q83GN5_TROWT          N-----TVATHGNQNNEIGFPITVSRIEPLTK-YLVLEYGAFKPGDIDCLKKIAVPDIAV
MURF_BORBU            K-----TYKTWGNLNSDIGLPLSILRVEGNEE-YAVFEVGVSYVGEMDLLSQILKPEIVI
                                  . *.                   : * .                    

B8E329_DICTD          ITNIGWAHIGR-LGSREAIMEAKAEIFEHIKQDG---VAILNNDDPFSMRIYEKLKI---
O67002_AQUAE          ITTLGEEHLEG-FGSLEGVIWGNAEMFCRISDNF---YAVIPG------KFLDTLFF---
B5YFT9_THEYD          ITNIGYEHIEG-FGSIQGVREGELEILPYVKTVF---ANGDDK---FLMDGLKRYSG---
Q6HPE7_BACHK          ITNIGEAHLMD-LGSREAIAEAKLEIVTGLQEGG---VFVYNGDEPLLTNRVPEMNL---
Q81IU0_BACCR          ITNIGEAHLMD-LGSREAIAEAKLEIVTGLQEGG---VFVYNGDEPLLTNRVPGMNL---
MURF_BACSU            ITNIGESHMQD-LGSREGIAEAKLEIINGLKEDG---VLIYIGDEPLLQN-----AY---
Q8Y8P0_LISMO          ITNIGEAHIEY-LGSREEIAKAKLEITAGLNPSG---ILIYPHEETLLLGNI---NG---
Q2FWH4_STAA8          ITNIGESHMQD-LGSREGIAKAKSEITIGLKDNG---TFIYDGDEPLLKPHVKE-VE---
Q837J3_ENTFA          ITMIGEAHVEN-LGSRAGIAQAKMEIVDGLAKDG---SLFVPSDEPLLEPLVEK--V---
F9UKZ5_LACPL          ITMIGEAHIEF-FGTRDRIADAKMEIVHGLKEDG---TFIFNGDEPLLQERAKE--V---
Q9CIL4_LACLA          ITLIGEAHLEH-MGSRENIAKGKMGITAGLHGE-----LIAPAD-PIINAFIP---D---
Q8DNV6_STRR6          VTLVGEAHLAF-FKDRSEIAKGKMQIADGMASGS---LLLAPAD-PIVEDYLP---I---
A5I1T7_CLOBH          ITNIGISHIEN-LGSRENILKAKLEITDFFCKDS---ILIINGDDDLLSNFESD------
Q97H85_CLOAB          ITNIGISHIEN-LKSRENILKAKLEITDFFTKDN---LLIVNGDNDLLKKHEFK------
I7F9Q4_GEOSL          ITNAYPAHLET-LGSVEGVARAKGELFLRLEPG---SSAVYNADDP-LIARCPSPEG---
Q728U4_DESVH          VLNVGQGHVAG-LGD-RGVAYYKSRLLAHLAEG---GTGLVCADYD-DLVREARSVC---
Q2RK83_MOOTA          ITNIGTTHLGL-LGSIANIAAAKGELLAALPAE---GLAVLNGDNE-WCRRLAATCP---
A9WG77_CHLAA          VTNVGPSHLER-LGSIEAIANAKAELPESLPAD---GWCILNADDH-RVAAMASRTA---
Q1IKG6_KORVE          VTNVAPVHLEN-FDSIAGIARAKYELIAALPRG---GCAVLNADDE-FVSQFGRDFH---
A0R020_MYCS2          VLNVGTAHLGE-FGSREAIAKTKAELPQAVGPS---GVVILNADDI-AVAAMAEQTD---
MURF_MYCTU            VLNVGTAHLGE-FGSREVIAQTKAELPQAVPHS---GAVVLNADDP-AVAAMAKLTA---
Q9S2W8_STRCO          VLNVGSAHIGE-FGGREQIAQAKGELVEALPPAEEGGAAILNADDP-LVRAMASRTK---
Q8NNN1_CORGL          VLNVGHAHLGE-FGSRENIAQAKGEIIEALPSKKTGGVAVLNADDP-FVARMAPRTK---
Q8G4Q8_BIFLO          VLKVGVAHLGE-FGSRERIAQAKSEIVQGLLPG---GTAVLNADDE-HVVPMAGLAN---
Q8DIM9_THEEB          ITNVGTAHIGR-LGSREAIAQAKCELLAEMPPG---GTAVLNADSPLLLPTVAQVWS---
MURF_SYNY3            ITNVGTAHIGL-LGSELAIAEAKCELLAHQPPE---STAILNRDNALLMETAQRFWQ---
Q7NHY6_GLOVI          ITNVGSAHIGR-LGSHAAIADAKCELLAELPCS---GIAVLNGEDERLLSTARRHWA---
Q7VBP1_PROMA          ITNIGSSHIGL-LGSKQNIASAKCEIAAHMNPN---GFVIIPAGDQLLEKTLQEVWK---
F8KYA2_PARAV          VTALELVHVAG-VHSLENIAHAKREILTHPKTM----LGLIPSEIP-FYALLHETGT---
Q6MBS2_PARUW          LTTAALVHACR-FETLKDIALTKAEIFSHSHTR----LGVVDREIE-AYETIAQIGE---
Q83F27_COXBU          ITNAGPVHLEG-FGSLEGVAKAKGEIFEGLSSD---GTAVINNDDHFAEFWRRLAH----
Q9HVZ7_PSEAE          ITNAGTAHVGE-FGGPEKIVEAKGEILEGLAAD---GTAVLNLDDKAFDTWKARAS----
MURF_ECOLI            VNNLAAAHLEG-FGSLAGVAKAKGEIFSGLPEN---GIAIMNADNNDWLNWQSVIG----
Q32K06_SHIDS          VNNLAAAHLEG-FGSLAGVAKAKGEIFSGLPEN---GIAIMNADNNDWLNWQSVIG----
Q8ZRU6_SALTY          VNNLAAAHLEG-FGSLAGVAKAKGEIYTGLPEN---GIAIMNADNNDWLNWQSIIG----
A0A0E1NRW9_YERPA      VNNLAAAHLEG-FGSLAGVAQAKGEIFAGLPAN---GTAIINADSNDWPHWQETLH----
MURF_HAEIN            INNIAPAHLEG-FGSLAGVVQAKGEIYRGLTKN---GVAIINAEHNHLDIWQKEIS----
Q5E2P6_ALIF1          VNNIAAAHLEG-FGSIEGVAKAKGEIFEGLQEN---GIAIYNLDSNGLPKWSSLFE----
Q9KPG3_VIBCH          VNNVAAAHLEG-FGSMDGVKRAKGEIYQGLQAG---AVAIVNLDSNGGDYWKAVLA----
Q8E9P4_SHEON          VNNVGSAHLEG-FGSQAGVAQAKSEIYNHLQED---GTAIINADDAFADVMRVKAK----
Q9K0Y8_NEIMB          VNNAMRAHVGCGFDGVGDIAKAKSEIYQGLCSD---GIALIPQEDANMAVFKTATL----
Q5F6L2_NEIG1          VNNALRAHVGCGFDGVGDIAKAKSEIYAGLCSD---GMALIPQEDANMAVFKTATF----
Q63QJ3_BURPS          VNNAQREHQEF-MATVEAVALEHAAVIHALGPD---GVAVFPADDAYAGIWRVAAT----
Q8PCK3_XANCP          VNNIAPAHLER-MGSLLGVAQTKGAIYTALPAD---GVAVINADDAFGAWFEQQLLAQPL
MURF_BUCAI            INNIHCAHLQG-FKSLLGVSKAKSEIFSGLKPN---STVIINLDSHHFSQWKKDIK----
Q2RVU0_RHORT          ITNVAAVHLEFF-DSVEAIADAKAEILEGVEPG---GTVVLNRDNRFFERLRRAAAA--R
Q3J4M9_RHOS4          ITTVAAAHLEAF-DSLSAIAEEKAAILEGLEPA---GRAILPAGLEVSPVLAARAAA--L
Q9A596_CAUVC          ITTVGPVHIENFSDGEAGVARAKAEILAGLQPG---GIAVLNADNHWFDFLKGEAEK--V
A9CIA7_AGRFC          ITTIAPAHLGNF-KNIEEIAAAKAEIFEGVEEG---GSVILNRDNAQFEQLEEAAQE--A
MURF_RICPR            INNISEAHLEFF-HSLEEIAEAKCEIFKNFSKN---DIAIINASNNCYNKILSILKN--L
A5CD82_ORITB          LTNINSAHTEFF-NSLEHLTEAKCEIFNGLVNK---GIAVINSDSMFYTKQLEYINK--L
Q8A1L7_BACTN          ITNVGKAHLEG-FGSFEGVIKTKGELYDFLRKKEG-STVFIHHDNAYLMNIAEGLNL---
A6GZF0_FLAPJ          ITNFGKAHLEG-FGGIDGVIKAKSELYNYLEENK--QTAFVNLDDEIQNQKTMQIMR---
Q8KGD0_CHLTE          LTNIGHEHLEF-FGSLDGVADAEAALFRYLEAHG--GTAFVNLDDHRLAAAGASLSR---
Q5NHM7_FRATT          ITNVGACHLEN-LKTLDGVMIEKGELLKALPRD---GFCIVNLDDERIPNYAKLLEC---
Q9WY78_THEMA          LLNVGSAHLEF-FGTRERIMETKMEIIKHSKEN---AIAVTLFDDPDLRKEVPRYRN---
I4BW64_ACEMN          ITSVEPVHLEG-FGDIRGVLEAKLEIVTPHCEV-----LFINGDCSLLAEGVAALTD---
D5EEG6_AMICL          ITEVSSAHLEG-LVTLEGVIAAKMEITRSPHLK----TLIFNADNENLANAAGQVYG---
Q83GN5_TROWT          LLSAGHAHVEK-SGSLESVCSMKAELARDLPEGS---KVLLNYDDPRIARLSVGNRY---
MURF_BORBU            ITNISYAHMQA-FKELQAIAFEKSKIIGKNIEIF--VVNEMNDYCVYLEKRAKIANP---
                      :      *          :   .  :                                  

B8E329_DICTD          ---KKYTFGFDERSD---------LRGEIVEKNEENYLLKINFPDGKDIKLSLPIYPLNI
O67002_AQUAE          ---LPKKISFGERGE---------LQAQNVEVSEKGVSFEVEGE-----KFFISVPSLGL
B5YFT9_THEYD          ---QILTFGMSKECD---------FRAENINFYNDHVEFDFYSDIA-AFAVKTPLVGIYN
Q6HPE7_BACHK          -IAETVTFGDARANDYY--------PTTVTLQATGTHFKMNREENI---SFYLPVLGKHN
Q81IU0_BACCR          -AAETVTFGDARANDYY--------PTTVTLQATGTHFKMNRDENI---SFYLPVLGKHN
MURF_BACSU            -SCQTKTYGTGTHNDYQ--------LQDVSQSEEGTHFTIKGIEN----TFFIPILGKHN
Q8Y8P0_LISMO          -DFRQLTFGKSEAAEIY--------PLEIRAEAEGTSFITNWEPEL---EIFVPIIGEHN
Q2FWH4_STAA8          -NAKCISIGVATDNALV--------CSVDDRDTTGISFTIN--NKE---HYDLPILGKHN
Q837J3_ENTFA          -TQQVITFGFSQESQLQ--------GIVTNEAKEQTSFKISD-TQM---TFTIPVPGTYN
F9UKZ5_LACPL          -SQHQRTFGLDDTNTLA--------GSDITTSRAQTQFKTSLWPDN---TYTIPMMGAYN
Q9CIL4_LACLA          -NQKIIRFGLP-GEDLF--------ITKLVEHKEKLTFETNF-LDE---SITIPVPGKYN
Q8DNV6_STRR6          -DKKVVRFGQ--GAELE--------ITDLVERKDSLTFKANF-LEQ---ALDLPVTGKYN
A5I1T7_CLOBH          -KFKVYKIGTDKKFDFN--------GDNLNLEAESIKFDILERGKTAYRCFSVNVPGKHN
Q97H85_CLOAB          -SINVLKTSLNKEGNLN--------AENLCLHEGNSEFEVQGEK------LVLNMPGKHN
I7F9Q4_GEOSL          --VKRVSFGLRG---------GDVTAEDVENLGKKGQRFTLRLPNGR-VTVTLHAFGSHN
Q728U4_DESVH          --RRLQFFSASGRGVGYRAAYDGPVADAAGSDGGVRGRYRVWLDGSV-HEVVAPFRGAFG
Q2RK83_MOOTA          --CRVVFFSTR--------GQGEIYARDIGDRGLEGTFFTAVFPGKE-VRVQLPVPGRHN
A9WG77_CHLAA          --ARVLTYGYA--------PNADVRLLDVVSHGLYGIELTVGYEGQS-HRLTTPLIGRHH
Q1IKG6_KORVE          --GTVLMFGVK--------RAADFRAENVEMLGAAGSKFDLRFREKG-YPAEMPLIGEHN
A0R020_MYCS2          --ARVVRISRDPG------SDIDVWAGPVTLDELARPRFTLHTRDGE-VDVNLAVHGDHQ
MURF_MYCTU            --ARVVRVSRD--------NTGDVWAGPVSLDELARPRFTLHAHDAQ-AEVRLGVCGDHQ
Q9S2W8_STRCO          --AKVILFGES--------GEADVRAENVRLTDTGQPSFSLHTPSGA-SDVTMRLYGEHH
Q8NNN1_CORGL          --ARVVWFTTDAGQ----AKKSDYWATSISLDAVARASFTLNTKDGS-WPVTLQVFGEHQ
Q8G4Q8_BIFLO          --GDVLWFGLGSS------QEPEVRAIDVTADRSDHAEFTLVDADGNHTPVHLGIPGRHN
Q8DIM9_THEEB          --GRTITYGLEGG------------------TLRGIYQPP-QTLHVGGRTYTVPLAGAHH
MURF_SYNY3            --GKTITYGLEGG------------------DVHGTVDG--ENLILDGVSLPLPLAGVHN
Q7NHY6_GLOVI          --GPVLTYGLDAG------------------DVMGSFDG--VHLHVDGIAFIPPLPGRHN
Q7VBP1_PROMA          --GRIVRVDIESKSNPFFANEYDSHQTKKNVDYLGVLDSDNWQITYDGIIFQMPLQGRHN
F8KYA2_PARAV          --CRKQSFSTLSI------------QADYCLHEQDQHLQIRDSQGLSPLLPRLPFLGKHN
Q6MBS2_PARUW          --CKKISFSTVSS------------RADYHLETVNEEVRLK-TEGQSISLGKMCLPGKHN
Q83F27_COXBU          -SRRIISFGINQP---------ADVMAKNITLNSDGRPAFQLVLPTGQLEIQLPLIGVHN
Q9HVZ7_PSEAE          -GRPLLTFSLDRPQ--------ADFRAADLQRDARGCMGFRLQGVAGEAQVQLNLLGRHN
MURF_ECOLI            -SRKVWRFSPNAANS--------DFTATNIHVTSHG-TEFTLQTPTGSVDVLLPLPGRHN
Q32K06_SHIDS          -SRKVWRFSPNAANS--------DFTATNIHVTSHG-TEFTLQTPTGSVDVLLPLPGRHN
Q8ZRU6_SALTY          -DRLVWRFSPNAANS--------DFTAANIHVTSHG-TEFTLQTPMGSIDVLLPLPGRHN
A0A0E1NRW9_YERPA      -NKRVWRFSPHAAEHI-------DFYASDVRITPQL-TSFTLHSPFGTVAIELPLPGQHN
MURF_HAEIN            -NHAIQYFNGK------------DYSAKNIHHTSQG-STFTLISPQGEIEITLPYLGEHN
Q5E2P6_ALIF1          -GKQVVSFAMDDSSA--------DFYASNIEVNAIGEPSFQLNTPKGNIQVSLGIIGKHN
Q9KPG3_VIBCH          -DKTVKTFSATDHNA--------DFYPRDVRLNALGIASFTLVTPVGEVGVELGIMGQHN
Q8E9P4_SHEON          -HYKQLSFSQQEGAAKR----QIDVIATGHKANSDGCYRFMLNYAGESCEVVLPLAGRHQ
Q9K0Y8_NEIMB          -NLNTRTFGIDSG----------DVHAENIVLKPLSCEFDLVCG-DERAAVVLPVPGRHN
Q5F6L2_NEIG1          -NLNTCTFGVDSG----------DVRAENIVLKPLSCEFDLVCG-DERTAVVLPVPGRHN
Q63QJ3_BURPS          -GNRIVDFALHGA----------AGGAPAAVTGALDGSLLAIDTPGARIDVRLNALGEHN
Q8PCK3_XANCP          QGRRVLRYGLHAS----------AEITARQLRLHAAGAQFVLATPQGEAPVVLPLPGRHN
MURF_BUCAI            -NSNILFFSIKKKK--------YSNFFCSNIKIHIHGTSFTMHTPCGKINISLPFLGYQN
Q2RVU0_RHORT          GIDKTLSFGNHIGAD--------ARVLD--CAVDANGTAVFALIGDDPLAYRMAVEGRHW
Q3J4M9_RHOS4          GV-PAVTFGQTADAD--------WRLAD--IQITPEATVARASHAGGTFLFKVLTPGRHF
Q9A596_CAUVC          GA-TVWSFGEAAGAT--------ARLTG--FQVEGAGATVSVDLRGEALTFPIHQTGVHW
A9CIA7_AGRFC          GIEHILTFGQHAKAD--------FRLAD--FESTTTGSTIWAILNGETSELHINIPGRHI
MURF_RICPR            SITNIYSFGHSSKAS--------AKLI--LYKTLGEQVHLQYYINNKFIDITIPFIPRHF
A5CD82_ORITB          GINNVFTFGTHQEAN--------SNITNYYYDADNQKSVINISCNGYDWQFNTQILGYGQ
Q8A1L7_BACTN          -----IPYGTEDDLY---------VNGRITGNSPYLTFEWKAGKDGKSYQVQTQLIGEYN
A6GZF0_FLAPJ          -----YSFSIAKESD---------VKIDFVVANPMVEINYKKMK------IKSHLIGLYN
Q8KGD0_CHLTE          ----KTGYGAQPGAGRA------WWAEQIGADRVGRVSFTLCSESGVHQPVAMQFVGRHN
Q5NHM7_FRATT          ---KKISCSMTNPKA---------DILVLDYRATSNSYAFKIRIFSQEYDYQLPNIGKHN
Q9WY78_THEMA          ----TLFFGKEGGDS----------VLKDWWYYEGSTIAEFEAFDSLFTVKLSGYWNGGQ
I4BW64_ACEMN          RPSRVITIGRDPSCMFK------ILDTKLHQDGHQYLREVLIETPLGVAQLESKLWGEQH
D5EEG6_AMICL          -TCKKIGVGVRKGEVRI------CQSTFDLVENLPRLKTTIRWEDGVISDLYCGLWGTHN
Q83GN5_TROWT          ------YFGTDKRAH----------FRASHVETNIIKTRFIVTYQKGSVEVETKLIGKHQ
MURF_BORBU            -NVKIVYFDFENLSI---------------KSFSFLDGKFSFDFVYKGFEYSILLLGRHN
                                                                                  

B8E329_DICTD          YRNLLLSLLVLWVISPESVYSLEKDFYFDLPKQRLNLKRKENG------LVIIDDTYNAN
O67002_AQUAE          VENILACFCVLKVLGFTLKEFKEALKEFSPVEGRMKVFNLKN-------FILIDDTYNAN
B5YFT9_THEYD          IYNLTGAIAVATFLGISKCSIQQITESFTSVKMRGEIIKING-------VEIFFDAYNAN
Q6HPE7_BACHK          VYNTLASMAIAKYFGVTWEEMKEGLVTLQMTGMRMEIVKTDS------GLTIINDAYNAS
Q81IU0_BACCR          VYNTLASMAIAKHFGVTWEEMKEGLVTLQMTGMRMEIVKTNS------GLTIINDAYNAS
MURF_BACSU            VMNAMAAIAAGAYFGIAPEDAAKGLSGLKVTGMRLELIKTDS------GLSIINDAYNAS
Q8Y8P0_LISMO          VFNTMAAMLAAREIGIEGEKIQSALKNMERSKSRLEWITTKS------GARILNDAYNSS
Q2FWH4_STAA8          MKNATIAIAVGHELGLTYNTIYQNLKNVSLTGMRMEQHTLEN------DITVINDAYNAS
Q837J3_ENTFA          VTNALIAIGIGRYFQLTDSEIQKGLATAELTKNRTEWLKAAN------GAEILSDVYNAN
F9UKZ5_LACPL          VNNALAALLVADTFHIRPAAAQQAIASFVPTENRTEWLTGYR------GEAILSDVYNSN
Q9CIL4_LACLA          ATNAMLAAFVGLHYGLSEAEIKKALKEVELTRNRTEWKKAKN------GADLLSDVYNAN
Q8DNV6_STRR6          ATNAMIASYVALQEGVSEEQIRLAFQHLELTRNRTEWKKAAN------GADILSDVYNAN
A5I1T7_CLOBH          VLNSLTAIACGRVLDINYRDIQTGIKNLKATSMRLDIVKEK-------GFTIINDCYNAS
Q97H85_CLOAB          IENAMLSIAAALKLGLTFEEIRKGLKDLELTAMRLDIVNGE-------NIVIVDDSYNAS
I7F9Q4_GEOSL          VANALAAAAAARVLGVAPEEIARGLGEFMPYAR-RFNLEEV------GDVVLIDDSYNAN
Q728U4_DESVH          AENVAAVAAAAHLCGLSGEEIAAGLAEAVLPRQ-RFACATV------GGFVCIDDTYNAN
Q2RK83_MOOTA          VEDALAALAVGFSLGVEPETMARSLADWPAEDL-RQDLRPG-----PGGSLVFNDAYNAN
A9WG77_CHLAA          AYTALAAIAAGLVLGLDWDAIAEGLRE-PGEQL-RLRIVPG-----QHGTTIIDDTYNAA
Q1IKG6_KORVE          VYNALAAVAVGVHHGIAIESAIASLKTLKPADK-RGEVVE------IAGATVVNDCYNSN
A0R020_MYCS2          VSNALCAAAVALECGATPQQVADALAAAGPASRHRMQVSTR-----ADGVTVINDAYNAN
MURF_MYCTU            VTNALCAAAVALECGASVEQVAAALTAAPPVSRHRMQVTTR-----GDGVTVIDDAYNAN
Q9S2W8_STRCO          VSNALAAAAVAHELGMSADEIATALSEAGSLSRWRMEVTER-----PDGVTVVNDAYNAN
Q8NNN1_CORGL          VANALAAAAIAMEAGVAPELVVAGLEAHSAASAHRMDVKTR-----ADGVTIINDSYNAN
Q8G4Q8_BIFLO          VMNALAAATVAMRYGMAPETVARILASQHTISPHRMALSTVNR--EGTSFTLIDDSFNAN
Q8DIM9_THEEB          ALNFLAALGVLQALDVESDRLPVQLT-LELPSGRGGRYRLE------PDILLLDETYNAG
MURF_SYNY3            ASNYLAAIALAQCLGLDWQQLQSGLT-VELPKGRARRYQWG------QDVVLLDETYNDG
Q7NHY6_GLOVI          HLNFLAALAVARHLGLELLQVRERLKDLQLPTGRSRVIALE------GDVQLIDETYNSA
Q7VBP1_PROMA          AINFMFALAVAYELNVPLDSIRNLSV--NLPPGRN-HSLTF------GNINVLDETYNAS
F8KYA2_PARAV          QHNFLAAISACRALGMTWSDIQQVIPTLTLPERRLEQVIKK-------GILFINDSYNAA
Q6MBS2_PARUW          LHNLLAAIAVARYFELTWNEIKQAIPFLKLPERRLQFVQKE-------GVYFLNDSYNAS
Q83F27_COXBU          VANALAAAAAAYAQQLSTDAIKAGLESVVPVKGRLVEQ------KGYRGAIIIDDSYNAN
Q9HVZ7_PSEAE          VANALAAAAAAHALGVPLDGIVAGLQALQPVKGRAVAQ------LTASGLRVIDDSYNAN
MURF_ECOLI            IANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPI------QLAENQLLLDDSYNAN
Q32K06_SHIDS          IANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPI------QLAENQLLLDDSYNAN
Q8ZRU6_SALTY          IANALAAAALSMAVGATLTAIKAGLAALKAVPGRLFPI------QLSENQLVLDDAYNAN
A0A0E1NRW9_YERPA      IANALAAAALAMSVGADLAAVRQGLAQLQAVPGRLFPV------PLAEGQLLLDDSYNAN
MURF_HAEIN            VKNALAATALAMNVGATLTDVKAGLEQRSQVKGRLFPI------QVTPNLLLLDDTYNAN
Q5E2P6_ALIF1          VANAVAAAALAIQAHASLNDIQQGLQELGSVKGRVAVE------TLASGLKVIDDTYNAS
Q9KPG3_VIBCH          VANALAAAALSLEMGASLAEIGQGLAHLSKVKGRVDMA------QLRDDITLIDDSYNAS
Q8E9P4_SHEON          VSNALAAASVCIALGLNLTEIAEGLSQLTPVKGRMQPT------QLGR-VRLIDDSYNAN
Q9K0Y8_NEIMB          VHNAAAAAALALAAGLSLNDVAEGLKGFSNIKGRLNVK------SGIKGATLIDDTYNAN
Q5F6L2_NEIG1          VHNAAAAAALALAAGLSLNDVAEGLQGFSNIKGRLNVK------AGIKGATLIDDTYNAN
Q63QJ3_BURPS          ARNALAATAAALAAGVPLAAIKAGLEAFAPVKGRLQVARAAA--GSLAGATVIDDTYNAN
Q8PCK3_XANCP          VLNALAATGLALGAGIALPIIAAGLAQATQVAGRQIAH------TLATGAVLIDDSYNAN
MURF_BUCAI            ISNALAASAFSFALKIPLKKIKIGLLDTPIVSKRLESI------ILEPNKILIDDTYNSN
Q2RVU0_RHORT          ALNSLGVLAVVRALGLDIHSAANGLANVVPPRGRGRRQSVSLG--GDGAIQVIDDAYNAS
Q3J4M9_RHOS4          ASNALATLAAAEALGLDLTIAACDLGLWTPPSGRGTRERIALDPVDEAGFDLIDDAFNAN
Q9A596_CAUVC          GPNSLCVLLMLEALDVPRETALAALAAFAPIEGRGAEKTIRIP---GGAFTLVDESYNAN
A9CIA7_AGRFC          ADNAMAVLGAVAVTGANLDRALEALGTLEAVKGRGQRHHLTIN---GGSFLLIDESYNAN
MURF_RICPR            ANNYTGVLLIIDILGKDIEISAKYLADIALTKGRGKIINIQ-------NSRVICDYYNAS
A5CD82_ORITB          AFNIAAVMLVSNICKINLNKVTEVINTLRNYEGRGKIYLLNFH---SNSSFIIDDCYNAN
Q8A1L7_BACTN          FPNALAAITIGRFFGVEDAKINEALAGYTPQNNRSQLKKTD-------DNTLIIDAYNAN
A6GZF0_FLAPJ          ANNISAAIAIGKYFNIADDDIKDAIQNYIPTNNRSQLIEKN-------SNNIILDAYNAN
Q8KGD0_CHLTE          VINAVAASAVGAHFGLAPAHIAEGLGTLLPAKGWKRMELFED-----GGIVVLNDTYNAN
Q5NHM7_FRATT          LFNSVLAIASVVAVGLEPKDFLQNTQNIKNYKGRFSTEKLSD------KLTLIDDTYNAS
Q9WY78_THEMA          LLNIAASLCVMRTLGETVDIFDLASLKTVPGRFNVREKK---------GVLIVDDTYNAS
I4BW64_ACEMN          AMVVAVATAVGYEIGLNFDDIASSLREMSSPKGRGALLKSDE------GIMFVDESYNAS
D5EEG6_AMICL          SLSLVYALTLYRELGYPLEEALRNLETMTSLPGRGRVFSTRA------GAVIIDDSYNAN
Q83GN5_TROWT          VSNVLAALSTLVLLGFDAEVCARYISEVNPIDGRMQYIPLG-------DFSIIHDAYNAS
MURF_BORBU            IFNAIGCINLALFLGMREKEIKEGLIETAFQKGRAEILTKN-------GYLILNDSYNGN
                                                                          . : :*  

B8E329_DICTD          PDSMRTAIEYLDLLKSSG---------RKIVLLGDMLELGD----HSIDGHREVIEEVFK
O67002_AQUAE          PVSLRNAIKSVGAFKRD-----------KVFILGDMLELGE----HSKELHEEVGRLLNT
B5YFT9_THEYD          PSSMKVALQELTRRKKGR---------RTVAVLGDMLELGE----FTDLAHEEVGKWVNE
Q6HPE7_BACHK          PTAMEAAFHLMNGLDGF--------SK-KIVVLGDMLELGD----QEVQFHYEVGKLIDP
Q81IU0_BACCR          PTAMEAAFHLMNGLDGF--------AK-KIVVLGDMLELGD----QEVQFHYEVGKLIDP
MURF_BACSU            PTSMKAAIQLTESLEGY--------GK-KMLVLGDMLELGD----LEETFHKECGAVISP
Q8Y8P0_LISMO          PTALKTVLKTFMHMDSS--------GKPKYLVLADMLELGD----LSTKLHQESAEVLEN
Q2FWH4_STAA8          PTSMRAAIDTLSTLTGR--------RI---LILGDVLELGE----NSKEMHIGVGNYLEE
Q837J3_ENTFA          PTAMGLVLDSFSKMSKV---------GKRIAVLGDMLELGP----DSAAMHQAMAQHLAP
F9UKZ5_LACPL          PTAARRVLAAFAAVPTK---------GQRIAVLGDMLELGD----QSDALHMSLASELDP
Q9CIL4_LACLA          PTAMRLILETFQAIPKNE-------NGRKIAVLADMLELGP----SAAQLHKDILKSIDF
Q8DNV6_STRR6          PTAMKLILETFSAIPANE-------GGKKIAVLADMKELGD----QSVQLHNQMILSLSP
A5I1T7_CLOBH          PDSMKAAIDVMKNIKGK----------RTIALLGSMRELGS----EGYRAHREVSEYARE
Q97H85_CLOAB          PDSMIAAIDVTKNLKGN----------RRIAVLGTMRELGE----KSYESHKEVGAYAKE
I7F9Q4_GEOSL          PASMAAALTTLREIKGS---------GRAVAVLGDMLELGI----GAEEAHRQLGRLAAT
Q728U4_DESVH          PLSSARMVEAVTEMAAG---------GPLVFVLGEMLELGE----EAADAHERLGRQLAT
Q2RK83_MOOTA          PESMEAALQALGALPG-----------RRVAVLGAMLELGP----AEVELHRRVGRFAAA
A9WG77_CHLAA          PLSTIAALQVLAETKG-----------RRIAVLGEMLELGA----ASVEGHQQVGA-AAA
Q1IKG6_KORVE          PKALNAMVDALAKMPAQ----------RRIVIAGEMLELGP----EGEHLHRDSGK-HMK
A0R020_MYCS2          PDSMRAGLKALAWMARQTAGGQPGGKRRSWAVLGEMAELGD----DAITEHDAIGRFAVR
MURF_MYCTU            PDSMRAGLQALAWIAHQ-----PEATRRSWAVLGEMAELGE----DAIAEHDRIGRLAVR
Q9S2W8_STRCO          PESTKAALRALVAMGKG---------RRTWAVLGKMAELGD----EALAEHDAVGRLAVR
Q8NNN1_CORGL          PDSMRAGIAALAYTASG------RSEATSWAVLGQMGELGD----DASEAHAELGAELAK
Q8G4Q8_BIFLO          PDSMKAGLNGLKAWNSN-----DGKEPFRVALLGAMLELGA----DETALHTSIGTYADE
Q8DIM9_THEEB          LESMVAALHLLRSLPGQ----------RHLAVLGPMRELGA----FSLSFHEQVGATVAQ
MURF_SYNY3            LESMLASLDLLANTPGK----------RRLAVLGAMKELGD----YGPTFHQRVGAKVKA
Q7NHY6_GLOVI          PESARAALAWLAGLPG-----------RRIAVLGQMRELGE----FSRELHRVLGEHCRR
Q7VBP1_PROMA          PESVIASLDLLATKPG-----------RHFAVLGNMYELGE----KTIDYHEQIVQHSIA
F8KYA2_PARAV          LTSVKAALDALPPPLQFS--------GKRIGVIGEMVELGT----FSEACHREVGILSLA
Q6MBS2_PARUW          ELSVKSALETLPNATGK---------GYKIAVLGSMMELGH----FSDECHQRVGEFALN
Q83F27_COXBU          PLSVSAAIAVLAKRPGH-----------SVLVLGDMLELGQ----GAEQFHQEIGKRAFE
Q9HVZ7_PSEAE          PASMLAAIDILSGFSGR-----------TVLVLGDMGELGS----WAEQAHREVGAYA-A
MURF_ECOLI            VGSMTAAVQVLAEMPGY-----------RVLVVGDMAELGA----ESEACHVQVGEAAKA
Q32K06_SHIDS          VGSMTAAVQVLAEMPGY-----------RVLVVGDMAELGA----ESEACHVQVGGAAKA
Q8ZRU6_SALTY          VGSMTAAVQVLSEMPGY-----------RVLVVGDMAELGA----ESEACHLQVGEAAKA
A0A0E1NRW9_YERPA      VGSMIAAAQVLAEMPGY-----------RVMVVGDMAELGE----TAADCHRQVGEAAKL
MURF_HAEIN            KDSLCAAIDVLKGYDAF-----------RILCVGDMKELGE----NSLAIHREVGQYINL
Q5E2P6_ALIF1          VPAMKAAVDLLGGFKGQ-----------RWLVLGNMAELGE----ESLALHREVGEYAAP
Q9KPG3_VIBCH          VPAMKAAVELLGSFSAV-----------RWLILGNMAELGD----ESLALHQQVGEHAAP
Q8E9P4_SHEON          PVSVGAAIAWLKEISEN-----------RCLVLGDLGELGD----NAPLLHAELGQLARQ
Q9K0Y8_NEIMB          PDSMKAAIDVLARMPAP-----------RIFVMGDMGELGELGEDEAAAMHAEVGAYARD
Q5F6L2_NEIG1          PDSMKAAVDVLARMPAP-----------RIFVMGDMGELGE---DEAAAMHAEVGAYARD
Q63QJ3_BURPS          PDSMRAAIDVLAAQSAP-----------RVLVIGEMGEVGD----EGPAFHREIGAYARE
Q8PCK3_XANCP          PGSLDAAIDALAAAPGE-----------GWLVLGDMRELGP----EAPALHAAAGRRARN
MURF_BUCAI            VSSMISAIKVLERMPGY-----------KILVTGDMAELGE----NSMMYHQMIGNTANS
Q2RVU0_RHORT          PESVIAALTTLSMTRPG-------PRGRRIAVLGDMLELGP----QAAKLHADLAKISVE
Q3J4M9_RHOS4          PASMAASLELLAAMAPTDGVG-RIAAGRRIAILGDMLELGP----TEAELHRAVADHPAL
Q9A596_CAUVC          PVSMQAALKTLGARKVA---------GRRVVALTDMLELGE----GSAQFHAELAEPIAA
A9CIA7_AGRFC          PASMRAAIAVLAETETQ-------GHGRRVAVLGDMLEMGE----FSAQLHEELAGPLLA
MURF_RICPR            PQSMKAALEYLKQVPAD----------NKTSIIGEMLELGW----NSQRLHEELVPYILD
A5CD82_ORITB          PASMKNALDLLGQIKAK----------RKVAILGDMLELGN----NTKEHHLNLVTYIKK
Q8A1L7_BACTN          PTSMMAALQNFRNMEVP----------HKMLILGDMRELGA----ESAAEHQKIADYLKE
A6GZF0_FLAPJ          PSSMEAAITNFIQLKAK----------DKIAILGDMFELGN----DSLIEHKKIIELFIN
Q8KGD0_CHLTE          PDSVRLALDTLAAIECRG---------RRIAVLGDMLELGD----NSAIEHESIGRYIRQ
Q5NHM7_FRATT          AGAVQAAIEDLAEFDGK-----------KILAISSMRELGD----EAENYHRKMGQWLKK
Q9WY78_THEMA          PEAFQTSIEALLRFPGK-----------KFAVVGAMKELGE----RSKEFHEELGERLNV
I4BW64_ACEMN          PVTVKAALKNLLGIPSRG---------RRIAVLGGMRELGG----FEREFHREVFETAIS
D5EEG6_AMICL          PSSMKASLNTFSTVEVKG---------RKLAILGSMKELGK----EESVLHEEILRSTHF
Q83GN5_TROWT          FESVKCALDSLVVLGSLA--------KRRIAVLGRIHDMGE----LAQDVYRQLVKQFLD
MURF_BORBU            MGSFMALKNMILDLNIQN---------KKFIVLGSFKELGE----LAYKTHKDLIQEAIS
                        :                                . ::*          :         

B8E329_DICTD          -RNIDMAIFYGPEMRKALDTYQNLDKKRIYWSKD-------------------PEEIKSI
O67002_AQUAE          VKGIRLAIFYGDEMKYAYDSFNKSKK---FYAKT-------------------KEEMLQF
B5YFT9_THEYD          -MGIDIFIGVGKFIKNALRYVN------GYVFND-------------------PIQAAEF
Q6HPE7_BACHK          -AKISYVFTYGKLGAQIAEGAKINFPNERVKAYDNKEE--------------LVKELQAV
Q81IU0_BACCR          -AKISHVFTYGRLGAQIAEGAKINFPNERVKAYDNKEE--------------LVKDLQAV
MURF_BACSU            -DKIDRVFTYGKLGAFIAEGALKHFEKDRVSHYTEKKD--------------LLQAVKEN
Q8Y8P0_LISMO          -DTIQKVFLYGDAMKAFGEVAESKIGQGKVHHFDTKES--------------LETALLSE
Q2FWH4_STAA8          -KHIDVLYTFGNEAKYIYDSGQQHV--EKAQHFNSKDD--------------MIEVLIND
Q837J3_ENTFA          -DAIEEVFLYGSEMAYLADKLQETYAPANIHSFKKEEK------------NELIEAVKKV
F9UKZ5_LACPL          -ATIASVYLNGEHMRALAEVLQEKYPAGAVHYYQTDQQ------------PQLIADLTAT
Q9CIL4_LACLA          -NKIDKVYLYGEMMKNLAEISTD----------KAVSYFTD--------LDLLTESLSAD
Q8DNV6_STRR6          -DVLDIVIFYGEDIAQLAQLASQMFPIGHVYYFKKTEDQDQ--------FEDLVKQVKES
A5I1T7_CLOBH          -KGIDLLFSIGEFSEAYREGFEEIN-KENYKSFLNNEE--------------AAKYIKNI
Q97H85_CLOAB          -NNIDELLVVGEFSKAYLDGYKD---KENFSEFETNEE--------------LLKFVKTD
I7F9Q4_GEOSL          -CVDRLYVLGAMAGTVAAGALEGGLEERHVTI--------------AADHGEIVADLRRT
Q728U4_DESVH          -TGARAVFWKGGNAEAVAMGLRLGGYGGLFCA--------------VDDTASFVDRFASL
Q2RK83_MOOTA          -RGLYRLITVGELAGEIAAGALEAGMPADQVF-------------ACLTHEEAAGHL-RG
A9WG77_CHLAA          -TMADVLVAVGRQAHTMAEAARSAGMPAEQIL-------------VCDNNEAAINLLNRY
Q1IKG6_KORVE          -GIVDHLVGVRGLAQAMVEGAKSAGVEAEFV----------------ATPEEAGDWLAAN
A0R020_MYCS2          -LDVSRLLVVGSGRAMNAMHHGAVMEGSWGS-----------ESTMVADADAALTVLRDE
MURF_MYCTU            -LDVSRLVVVGTGRSISAMHHGAVLEGAWGSGEATADHGADRTAVNVADGDAALALLRAE
Q9S2W8_STRCO          -LNVSKLVAVG-GREARWLQLGAYNEGSWGE-----------ESVHVSDAQAAVDLLRSE
Q8NNN1_CORGL          -YNVQELVAVGENPNCAALAESAASLGVSTH--------------VVSDVDAALELLAGH
Q8G4Q8_BIFLO          -LGIDAIIAVGSAQDQHLDALAQALADGARQSQS-----ASVDCVHDIDAAEQLVIDLAR
Q8DIM9_THEEB          -LDLDGLFILDQGEEGAALAQGAGQIPTQQFG---------------SHEE-LVEYLLRE
MURF_SYNY3            -LGLDGLFLLANDPNTDAIAAGANGVETQSFS---------------DGPS-LVAALKTT
Q7NHY6_GLOVI          -LALDEVVVLEAGEDTEALLAGAGDLPAVQLA---------------DHRA-VAAYLADR
Q7VBP1_PROMA          -TGLTGLVICVNGPEAEAMLLAGQPLSYIEVV---------------STPEDAFLILKSW
F8KYA2_PARAV          -KLDLMICYGDGCLPIEEVWKKHNKPVHLTLT-----------------FEQVIAELKQH
Q6MBS2_PARUW          -YVDKMYCLGAECLPIVEVWKKANRPVELFME-----------------RSELISTLKKN
Q83F27_COXBU          -AGVKQLYCYGTLTKHTANAFGKN--ARHFDN----------------QEKLLT-ALKND
Q9HVZ7_PSEAE          -GKVSALYAVGPLMAHAVQAFGAT--GRHFAD----------------QASLIG-ALATE
MURF_ECOLI            -AGIDRVLSVGKQSHAISTASGV---GEHFAD----------------KTALIT-RLKLL
Q32K06_SHIDS          -AGIDRVLSVGKQSHAISTASGV---GEHFAD----------------KTALIT-RLKSL
Q8ZRU6_SALTY          -AGIDRVLSTGKLSQAISHASGV---GEHFAD----------------KAALIA-RLHAL
A0A0E1NRW9_YERPA      -AGVDKVLSVGTLSQILSSASGN---GEHFQD----------------QNTLST-RVNAL
MURF_HAEIN            -VNLDLVCSYGNESAVISEAVS----GKHFTD----------------KTEMVD-FLVPL
Q5E2P6_ALIF1          -YQFEQVVTFGDDTKVISELCN----GRHFET----------------RSDLNA-YLLKE
Q9KPG3_VIBCH          -FGFEFVLTYGKDAKVISDLCQ----GHHFAT----------------HQDMMT-FIEQH
Q8E9P4_SHEON          -QGIDALFCTGTLTQHTSHAFG----AEHHDS----------------VATLVE-KLIKH
Q9K0Y8_NEIMB          -QGIEAAYFVGDNSVEAAEKFGAD--GLWFAA----------------KDPLIQ-VLRHD
Q5F6L2_NEIG1          -QGIEAAYFVGDNSVEAAEKFGAD--GLWFAA----------------KDPLIQ-VLSHD
Q63QJ3_BURPS          -RGIDALFALGAATRPACDAYGAG--ARHFDD----------------AAALVAALLAAN
Q8PCK3_XANCP          -AKLARLYALGALSAAAAQAFGDG--GRVFAT----------------HAALAA-ALQAD
MURF_BUCAI            -SAINKIFSIGDMSSEITKIFNN---GKHFLN----------------KKKLSEYLKNVF
Q2RVU0_RHORT          -RGIDLVYTAGPLMAHLHDALPASRRGGHAPD----------------ADAL-TPLVLAA
Q3J4M9_RHOS4          -AEIALVHCVGPRMRALHEALPRRQRGEWVET----------------AAEL-VPRARLL
Q9A596_CAUVC          -ANVDAVFLAGVHMKSLWEALPPTRRGGYAEV----------------AEKL-TSVLAGA
A9CIA7_AGRFC          -AGIEHVWLAGEAMAALRDALPDSVTVIWFPT----------------TAEL-TDFALQW
MURF_RICPR            -AGCTKVYLVGAYTKYIYDLLPNKISKKFFKN----------------VEEL-ITHITDL
A5CD82_ORITB          -YN-IHVIAIGSLMKNVYELLPAELKLSHYNN----------------INELPVDQLLPL
Q8A1L7_BACTN          -CAFEKVWLVGDQFAAAEHSFQT---YPNVQE--------------------VIKELEAD
A6GZF0_FLAPJ          -GPEIETYFIGKDFYCNKIEMKNIHFFDTYES--------------------FSKSFKTR
Q8KGD0_CHLTE          -LPLDACLTLGDAAQLICEQAGGRCLRHFGTM------------------DELRGFLSEY
Q5NHM7_FRATT          -ANLDKIFLFGEKNLIDYVLAEYSNQNAKYYE----------------SKDELNNDLAKI
Q9WY78_THEMA          ---LDGVYVFLSEPEAEWIKSKKIILKSDDPE-------------------KIAKDLATR
I4BW64_ACEMN          --VADVTILYGKEWNNLSANGKEVLHLHDIEE--------------------IVNYLKGI
D5EEG6_AMICL          ---LDALFLVGEEWKVPLEKMPEHERSKIVIV---------------SKVQSFAVELAKM
Q83GN5_TROWT          TDINLLVIVSEKQMYLIAKELAKGVPNKEIVWFE--------------DLETAKHEIFDL
MURF_BORBU            -MNFDKIFLIGEEFLDVRDSENLVEKCLYYFS----------------EFDKFIDFFLKS
                                                                                  

B8E329_DICTD          LKNSL------------------------CAGDTILVKGSRAMYMENFVKFLEDEL----
O67002_AQUAE          IEENLKE----------------------FEGCAVLIKGSRGMKLEEVVDFLRGMSNAT-
B5YFT9_THEYD          LKKELK------------------------GSEIVLIKGSRAMKLEKILEILKEGR----
Q6HPE7_BACHK          VDTKD----------------------------VVLVKASRGMKLEEVITMLK-------
Q81IU0_BACCR          VDVKD----------------------------VVLIKASRGMKLEEVITMLK-------
MURF_BACSU            ASKGD----------------------------LILFKASRGMKLEEIVKDLIESPLS--
Q8Y8P0_LISMO          IKGNE----------------------------WILVKGSYGMGLKDVVENLIIK-----
Q2FWH4_STAA8          LKAHD----------------------------RVLVKGSRGMKLEEVVNALIS------
Q837J3_ENTFA          LQPED----------------------------MVVLKGSNGMGLREVIDALLEK-----
F9UKZ5_LACPL          VSADD----------------------------QVLLKGSHGIHLEKVLTALEAAPEK--
Q9CIL4_LACLA          LKPTD----------------------------QVLFKGSNSMKLSEVVEKL--------
Q8DNV6_STRR6          LGAHD----------------------------QILLKGSNSMNLAKLVESLENEDK---
A5I1T7_CLOBH          IKDGD----------------------------IILIKASRAMKLEEIVKELRIKQEK--
Q97H85_CLOAB          IRKGD----------------------------IFLIKASRLMKFENIVTKLKELDKEI-
I7F9Q4_GEOSL          AATGE----------------------------MILVKGSRGMAMDRVAEGIREAFAASG
Q728U4_DESVH          GLASA----------------------------HVLFKGSRGNRLEVLRAAFGDAFATAE
Q2RK83_MOOTA          LGHGD----------------------------VVLFKGSRLTGMEKVLAIWEG-----S
A9WG77_CHLAA          IQPGD----------------------------HLLIKGSRGVQMETIVAALQA-----T
Q1IKG6_KORVE          IRPGD----------------------------AVLLKASRGVKLERALERWKE-----K
A0R020_MYCS2          LQPGD----------------------------VVLVKASNSVGLGALAEALVA-----G
MURF_MYCTU            LRPGD----------------------------VVLVKASNAAGLGAVADALVA-----D
Q9S2W8_STRCO          LRPGD----------------------------VVLVKASRSVGLESVATALLE-----T
Q8NNN1_CORGL          IKRDD----------------------------VVLVKASNADRLWRVAEALHGMVPGLK
Q8G4Q8_BIFLO          NHPDA----------------------------VVLLKGSHASGLSALAERWAKN-----
Q8DIM9_THEEB          LQAGD----------------------------RLLFKASHAVALDRVVNQLRQRWPKLQ
MURF_SYNY3            LQPGD----------------------------RLLFKASNSVGLGAVVSQLLAENPTSV
Q7NHY6_GLOVI          VRPGD----------------------------RLLFKASRAVGLERVLAEFQDLFRAGT
Q7VBP1_PROMA          LNSGD----------------------------YLLLKASRKVSLERILPLLKEAY----
F8KYA2_PARAV          VLPGD----------------------------VVLLKGSNKKQLWKVLEYF--------
Q6MBS2_PARUW          LKPAD----------------------------VVLLKGSRSKELWKILEEL--------
Q83F27_COXBU          L----------------------------NANAVVLVKGSLSMRMGNIAHALLEE-----
Q9HVZ7_PSEAE          -----------------------------QPTTTILIKGSRSAAMDKVVAALCGSSEESH
MURF_ECOLI            IAEQQ--------------------------VITILVKGSRSAAMEEVVRALQENGTC--
Q32K06_SHIDS          IAEQQ--------------------------VITILVKGSRSAAMEEVVRALQENGTC--
Q8ZRU6_SALTY          LQEQP--------------------------MMTILVKGSRSAAMEDVVHALQEKGSC--
A0A0E1NRW9_YERPA      LNEYP--------------------------VITVLIKGSRSAAMENVVRALQEKASC--
MURF_HAEIN            IENQLQQ----------------------NKKVVVLGKGSRSMKMEDVIYSLKDKIKC--
Q5E2P6_ALIF1          LQLIK------------------------HNEVTVLVKGANSSRMSEVVSALKECQ----
Q9KPG3_VIBCH          IEQQQ------------------------GRTQVLLVKGANSAGMSKIAAALKEKFA---
Q8E9P4_SHEON          INQLP-------------------------GQVTVLVKGSRSAAMERVVDGLTVAFGRGE
Q9K0Y8_NEIMB          LPERA----------------------------TVLVKGSRFMQMEEVVEALEDK-----
Q5F6L2_NEIG1          LPERA----------------------------TVLVKGSRFMQMEEVVEALEDK-----
Q63QJ3_BURPS          FGAHA----------------------------TLLVKGSRFMKMERVVDALANETASGA
Q8PCK3_XANCP          LAAAASQTQTQDSSLMHEHTGAVARAAASVAPPTLLVKGSRGSAMDRIVAALLAPSEDAS
MURF_BUCAI            LKKKK---------------------------ITILVKGSRSTKMEKVVEDLIKESKKKC
Q2RVU0_RHORT          LRPGD----------------------------VVMVKGSKGSLVSRTVTALLALDRRAE
Q3J4M9_RHOS4          VDAGD----------------------------IVLVKGSKGIKVSLVVDALRKLGQSSP
Q9A596_CAUVC          VQPGD----------------------------VVMVKGSNGSKAGVLAAALAALDLGEQ
A9CIA7_AGRFC          VQPGD----------------------------ALMVKSSLGLGFGKIVAALLDKYPAFP
MURF_RICPR            FEYSE----------------------------LILIKGSRGVKLDKIVDYYQ-------
A5CD82_ORITB          LHDKD----------------------------YVLIKGSNRMRLWQVIENLLESGMLKD
Q8A1L7_BACTN          KPKGY----------------------------TILIKGSNGIKLSSVVDYL--------
A6GZF0_FLAPJ          KTSKN----------------------------TILIKGSRGMSLERTLEIL--------
Q8KGD0_CHLTE          VQPGD----------------------------ALLFKGSRGMKLELAADDLIKQNQQHS
Q5NHM7_FRATT          LDEYKSQ------------------------STKLTVKGARSFKMEEVVKFVKENL----
Q9WY78_THEMA          VKKGD----------------------------VVLFKASRAVRIERVLEMFEKELEKR-
I4BW64_ACEMN          LRSGD----------------------------IVLVKGSRVYEMERIYEWWSLNEL---
D5EEG6_AMICL          IRSGD----------------------------GVLIKGSHSHHLEKVVLILMEGQES--
Q83GN5_TROWT          FSPGD----------------------------IVLFKASNAENFSSLVESVKHKAGKFA
MURF_BORBU            LEPSV----------------------------FIVIKGSRFNRLERILNIFR-------
                                                        .  *.:                    

B8E329_DICTD          -----------------
O67002_AQUAE          -----------------
B5YFT9_THEYD          -----------------
Q6HPE7_BACHK          -----------------
Q81IU0_BACCR          -----------------
MURF_BACSU            -----------------
Q8Y8P0_LISMO          -----------------
Q2FWH4_STAA8          -----------------
Q837J3_ENTFA          -----------------
F9UKZ5_LACPL          -----------------
Q9CIL4_LACLA          -----------------
Q8DNV6_STRR6          -----------------
A5I1T7_CLOBH          -----------------
Q97H85_CLOAB          -----------------
I7F9Q4_GEOSL          GKGGHV-----------
Q728U4_DESVH          VHDAL------------
Q2RK83_MOOTA          EHD--------------
A9WG77_CHLAA          TRNDTGEIA--------
Q1IKG6_KORVE          QGVRN------------
A0R020_MYCS2          EGHTEGRTPAR------
MURF_MYCTU            DTCGSVRP---------
Q9S2W8_STRCO          GAEGEVAAR--------
Q8NNN1_CORGL          NTGGSVNDDSRRNVEGQ
Q8G4Q8_BIFLO          -----------------
Q8DIM9_THEEB          SG---------------
MURF_SYNY3            -----------------
Q7NHY6_GLOVI          PSERAQ-----------
Q7VBP1_PROMA          -----------------
F8KYA2_PARAV          -----------------
Q6MBS2_PARUW          -----------------
Q83F27_COXBU          -----------------
Q9HVZ7_PSEAE          -----------------
MURF_ECOLI            -----------------
Q32K06_SHIDS          -----------------
Q8ZRU6_SALTY          -----------------
A0A0E1NRW9_YERPA      -----------------
MURF_HAEIN            -----------------
Q5E2P6_ALIF1          -----------------
Q9KPG3_VIBCH          -----------------
Q8E9P4_SHEON          LV---------------
Q9K0Y8_NEIMB          -----------------
Q5F6L2_NEIG1          -----------------
Q63QJ3_BURPS          APGAH------------
Q8PCK3_XANCP          HAA--------------
MURF_BUCAI            -----------------
Q2RVU0_RHORT          AGLSAADTP--------
Q3J4M9_RHOS4          SRT--------------
Q9A596_CAUVC          G----------------
A9CIA7_AGRFC          ETERQV-----------
MURF_RICPR            -----------------
A5CD82_ORITB          AI---------------
Q8A1L7_BACTN          -----------------
A6GZF0_FLAPJ          -----------------
Q8KGD0_CHLTE          I----------------
Q5NHM7_FRATT          -----------------
Q9WY78_THEMA          -----------------
I4BW64_ACEMN          -----------------
D5EEG6_AMICL          -----------------
Q83GN5_TROWT          G----------------
MURF_BORBU            -----------------