CLUSTAL format seed alignment for MF_02022

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0H2V972_ECOL6      MTRGEAVASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
A0A454A633_ECOL5      ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
Q32DM2_SHIDS          ---------------MGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
Q3YZP7_SHISS          ---------------MGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
DEDD_ECOLI            ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
C8UDR5_ECO1A          ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
B6I4W6_ECOSE          ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKAGDRDEPD
A0A0K0HCV6_SALBC      -------------------MLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
Q8ZNC1_SALTY          ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
A9MJ61_SALAR          ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
A8ADR5_CITK8          ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
A6TC00_KLEP7          ------MASKFQNRLVGTIVLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
B5XNS3_KLEP3          ------MASKFQNRLVGTIVLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
E3GAD6_ENTLS          ------MASKFQNRLVGTIALVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDKDEPD
K8CDT8_CROSK          -------------------MLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
K8CSK9_CROSK          -------------------MLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
A7MH54_CROS8          ------MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
A0A0H3CRP4_ENTCC      -------------------MLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
A4WCU8_ENT38          ------MASKFQNRLTGTIVLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPD
I2B732_SHIBC          ------MASKFQNRLVGTIVLVALGVIILPGLLDGQKKHYQDEFAAIPLVPRPGDTDEPD
C5B8M4_EDWI9          ------MASKFQNRLVGTVILVALGVIILPGLLDGQKKHYQDEFAAIPLVPRPGEDDPTD
Q2NSI5_SODGM          ------MASKFQNRLVGTIILVALGVIILPGLLDGKKKHYQDEFAAIPLVPKPGDSDELD
A0A0H3B0G1_YERPY      ------MASQFQNRLVGTIILVALGVIVLPGLLDGKKKHYEDEFAAIPLVPKPGDSQEID
A0A380PET5_YERPE      ------MASQFQNRLVGTIILVALGVIVLPGLLDGKKKHYEDEFAAIPLVPKPGDSQEID
A8GH38_SERP5          ------MASKFQNRLVGTVILVALGVIILPGLLDGKKKHYEDEFAAIPLVPKAGDVEEND
H8NMU9_RAHAQ          ------MASKFQNRLVGTVILVALGVIILPGLLDGKKKHYEDEFASIPLVPKPGDVEEQD
H2IP07_RAHAC          ------MASKFQNRLVGTVILVALGVIILPGLLDGKKKHYEDEFASIPLVPKPGDVEEQD
D8MUY1_ERWBE          ------MASKFQNRLVGTVIIVALGVIILPGLLDGKKKHYKEEFAAIPLVPKPGDQQEND
B2VIW1_ERWT9          ------MASKFQNRLVGTVIIVALGVIVLPGVLDGQKKHYKEEFAAIPLVPKADEQPETE
E6W8J4_PANSA          ------MASKFQNRLVGTVILVAVGVIVLPGLLDGKKKHYKEEFAAIPLVPKPDDQQDSE
D4GJ83_PANAM          MKRRKDVASKFQNRLVGTVILVAVGVIVLPGLLDGKKNIIKKNLPRSRWCPNPMTSRTAK
Q6D2P1_PECAS          ------MASKFQNRLVGTVILVALGVIVLPGLLDGKKKHYEDEFASIPLIPKPGDSNEME
C6DA70_PECCP          ------MASKFQNRLVGTVILVALGVIILPGLLDGKKKHYEDEFASIPLIPKPGDSNEME
E0SL87_DICD3          ------MASKFQNRLVGTVVLVALGVIVLPGLLDGKKKHYEDDFAAIPLVPKPGDTLEAE
D3V8C3_XENBS          ------MASKFQNRLVGTLVLVALGIIVLPVLFDGDKKHNESQFASIPLALKPGDEEDID
D3VKV6_XENNA          ------MASKFQNRLVGTVVLIALGVIVLPMIFDGDKKYNENQFASIPLVPKLGDEENID
B4EZF3_PROMH          ------MASKFQNRLVGAVVLVAVGVIFLPTLFDGDKKYNEDQFASIPLVPKPGDEQDIE
A0A140NID6_PROSM      ------MASKFQNRLVGAIVLIAAGVIVLPALLDGDKKYNENEFAAIPIIPKPGDEQDIE
Q7N2B7_PHOLL          ------MASKFQNRLVGTIVLVALGVIVLPALLDGNKKYNEDKFASIPLVPKPGDEQEID
M1SB56_MORMO          ------MASKFQNRLVGTIILVAVGVIVLPVLLDGDKKYNEDQFAAIPLIPKEGEQDEID
                                          ::* *:*.** ::**.*:  :..:.      .       .

A0A0H2V972_ECOL6      MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPATIAA------------
A0A454A633_ECOL5      MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPATIAA------------
Q32DM2_SHIDS          IMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPATIAA------------
Q3YZP7_SHISS          MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPATIAA------------
DEDD_ECOLI            MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPATIAA------------
C8UDR5_ECO1A          MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPTTIAA------------
B6I4W6_ECOSE          MMPAATQALPTQPP-EGAAEEVQAGDA---------AAPSLDPTTIAA------------
A0A0K0HCV6_SALBC      MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPSRMTA------------
Q8ZNC1_SALTY          MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPSRMAS------------
A9MJ61_SALAR          MMPAATQALPTQPP-EGAAEEVQAGDA---------AAPSLDPSRMAS------------
A8ADR5_CITK8          MMPAATQALPTQPP-EGAAEEVRAGDA---------AAPSLDPSRFAAE-----------
A6TC00_KLEP7          MLPAATQALPSQPP-EGAAEEVRAGDA---------AAPSLDPSRIPVNS----------
B5XNS3_KLEP3          MLPAATQALPSQPP-EGAAEEVRAGDA---------AAPSLDPSRIPVNS----------
E3GAD6_ENTLS          MLPAATQALPSQPP-EGAAEEVRAGDA---------AAPSLDASRMAVNS----------
K8CDT8_CROSK          MLPAATQALPSQPP-EGAAEEVRAGNA---------AATSIDTTRLPAD-----------
K8CSK9_CROSK          MLPAATQALPSQPP-EGAAEEVRAGNA---------AATSIDTTRLPAD-----------
A7MH54_CROS8          MLPAATQALPSQPP-EGAAEEVRAGNA---------AATSIDTTRLPAD-----------
A0A0H3CRP4_ENTCC      MLPAATQALPAQPP-EGAAEEVRAGDA---------AAPSLDPSRLAAN-----------
A4WCU8_ENT38          MLPAATQALPAQPP-EGAAEEVRAGDA---------AAPSLDATRLTGN-----------
I2B732_SHIBC          MLPVATQALPAQPP-EGAAEEVRASTA---------GNPALRASALPVDS-------G-A
C5B8M4_EDWI9          AIPPVTQPLGETPL-PSASAGAAPVSA---------ATPSASAPAVAPAH-------TRG
Q2NSI5_SODGM          ATPPASQQLPSKPP-EGAGEAVEQSSR---------AAGSGTR-----------------
A0A0H3B0G1_YERPY      VVPPLNQPLPITPP-EGAAQAVGAELN--------DDSVSQAA----NDA-------GNL
A0A380PET5_YERPE      VVPPLNQPLPITPP-EGAAQAVGAELN--------DDSVSQAA----NDA-------GNL
A8GH38_SERP5          VVPPVSQPLPAQPP-EGAGALVEQQAA--------NEAAAQQAVRQPTQQ-------PTL
H8NMU9_RAHAQ          SVPPVTQSLPAQPP-EGADQMMNGEQD--------DTSPANNT--NAANH-------GNV
H2IP07_RAHAC          SVPPVTQSLPAQPP-EGADQAMNGEPD--------MESSANNT--NAANQ-------GNV
D8MUY1_ERWBE          LVPPVTQSLPSQPP-EGAATAVEGKTP---------GNTSQAE--SGSTA-------PKS
B2VIW1_ERWT9          MVPSVTQPLPAQAP-HDGQVTAAGND-----------NPSQAE--SGSTV-------PAS
E6W8J4_PANSA          MVPPVTQSLPAQPP-EGAGAAQSEANGKT------TTTTAPAE--NSSPQ-------PAE
D4GJ83_PANAM          WCRRVTQSLPAHPP-AGAGSAVSHSD---------TDDDAAAE--GSS-Q-------PEQ
Q6D2P1_PECAS          SLPALNPSLPSQPP-EGAEAAMQNSAETEPPENK-----VPETPTQTP----------AM
C6DA70_PECCP          SLPALNPSLPSQPP-EGAEAAMQNSPEAEAPDARSSAATAPETTTQTPPSSHSGANTPAM
E0SL87_DICD3          SMPPINQSLPAQPP-EGAEAAMQSKNESTAEEPDSTQSSARHGASQPSSS------RPAA
D3V8C3_XENBS          LIAPLTQDMPSTPP-EGAAEAMAKQA----------QELQPD--MLSSSL----------
D3VKV6_XENNA          AIPPLTQNMPSTPP-EGAAEAMQIQE----------QQQLPDVDMLSDAL----------
B4EZF3_PROMH          SIAPIEQTTTPSTPSEGASEAMISEA----------VTGVEQ------PQ----------
A0A140NID6_PROSM      AIAPLAQNPASGQASEAMLSEAISEQ----------KQEEQQR--QREQQ----------
Q7N2B7_PHOLL          SISPLNPPILSVPL-EDETEALQPET----------LEQPE----IPLVT----------
M1SB56_MORMO          AVNPINQTMPTMPS-EGASSAMITEAA---------QTGTEEAPAEASAG----------
                                                                                  

A0A0H2V972_ECOL6      NNTEFEPEPAPVAPPK--------------PKPVE----PLKPK----------------
A0A454A633_ECOL5      NNTEFEPEPAPVAPPK--------------PKPVE----PLKPK----------------
Q32DM2_SHIDS          NNTEFEPEPAPVAPPK--------------PKPVE----PPKPK----------------
Q3YZP7_SHISS          NNTEFEPEPAPVAPPK--------------PKPVE----PPKPK----------------
DEDD_ECOLI            NNTEFEPEPAPVAPPK--------------PKPVE----PPKPK----------------
C8UDR5_ECO1A          NNTEFEPEPAPVAPPK--------------PKPVE----PPKPK----------------
B6I4W6_ECOSE          NNTEFEPEPAPVAPPK--------------PKPVE----PPKPK----------------
A0A0K0HCV6_SALBC      NNVELDPMP--VEAPK--------------PKPVEKPQAQPKPQQ---------------
Q8ZNC1_SALTY          NNVELDPIP--VETPK--------------PKPVEKPKPQPKPQQ---------------
A9MJ61_SALAR          NNIELDPIP--VETPK--------------PK------SQPKPQQ---------------
A8ADR5_CITK8          NNASFDPVPAPVEPPK--------------PKPVEKPKPQPKPQQ---------------
A6TC00_KLEP7          --NSFDDVQEPVVAAK--------------PQPKPQPKPQPQ------------------
B5XNS3_KLEP3          --NSFDDVQEPVVAAK--------------PQPKPQPKPQPQPQPKP------QPQPQPQ
E3GAD6_ENTLS          GGSDIDQTPEPVAPPK--------------PKPVAQ-KPQPQPKP---------ARDTAS
K8CDT8_CROSK          TGADLDEVPVTPAKPK--------------ATEPAKTRTADKPQSKP------QRDKTDE
K8CSK9_CROSK          TGADLDEVPVTPAKPK--------------ATEPAKTRTADKPQSKP------QRDKTDE
A7MH54_CROS8          TGADLDEVPVTPAKPK--------------ATEPAKTRTADKPQSKP------QRDKTDE
A0A0H3CRP4_ENTCC      NNIEIDPV--PVEQPK--------------PVE--KPKPVEKTQPKP------QRDKAAE
A4WCU8_ENT38          SSNELDPAAEPVVQPK--------------PVE--KAKPVEKPQPKP------QRDKASE
I2B732_SHIBC          GLDEVSPVAREMAKPQP-------------PQPKPQPKPKPQPQPVK------TPDQAAE
C5B8M4_EDWI9          ELVELKPVESRAPEPPR-------------TAPPPISTPSPQESRPKASEPPTRVAESRP
Q2NSI5_SODGM          QPKTLAPPDMKASPPAA-------------TKPEVKPTVWP-ESKP--------VPKPQT
A0A0H3B0G1_YERPY      AVEPTIVAPPPIQSKPV----EVKP---TVTKPVDV-KPTETKPTET---KPIETKPAEK
A0A380PET5_YERPE      AVEPTIVAPPPIQSKPV----EVKP---TVTKPVDV-KPTETKP--------IETKPAEK
A8GH38_SERP5          VTPPVESRPQPTPQPQV----KPKP---VETKPVEV-KPKPVPQP-----KPVETKPVVK
H8NMU9_RAHAQ          APGNTTIEAPPVTTLPE----QKK-----PVQPAPQ-KPKVIEPK-----PMVEAKPTVK
H2IP07_RAHAC          APGNTTIEAPPATTLPE----QKKPVQTAPVKPAPQ-KPKTIEPK-----PMVEAKPTVK
D8MUY1_ERWBE          ANKPSVISPPPMVES--------KPVQQ--PKPVEKPKPKPVEKT--------VEKP--K
B2VIW1_ERWT9          NNQPTVVTPPPVQQQVQPPGVVEKPKPQ--PKPQPKPQSRPVEKP--------LEKPVEK
E6W8J4_PANSA          HSEPTVVTPPPVHQTV-----KPKPVETPKPKPVEQPKPKPVE-----------PKPVEQ
D4GJ83_PANAM          SSEPSVVSPPPVHSSPATAAPKARPVEPTRPKQVEQAKPKSVEQT--------QSKPVEK
Q6D2P1_PECAS          TAPPVVVE-RPPVQTPVPATPKPQP------KPEVKPEVKPKP-----------------
C6DA70_PECCP          TAPPVVVE-RPPVQTP-----KPQP------KPEVKPEVKPKP-----------------
E0SL87_DICD3          TPAPVVTEPRPPVQQVAPPAMKAQPAKPEAKKPETKPETRPKPEVKA-------AESKTA
D3V8C3_XENBS          LSEPAPMAPPPVEITQAP-------------KATVKSEPNPQPKV--------------D
D3VKV6_XENNA          PSETASMTPPPVTLPPES-------------KETVKPEPPVQQKV--------------E
B4EZF3_PROMH          VSTPEVSEPQVAPSTPVV-------------EPPKVVNPPVEP-----------------
A0A140NID6_PROSM      AAANSASQPQEVPNIPA--------------EAPKQVEPKPEP-----------------
Q7N2B7_PHOLL          TPQLAPIVPPAVQPEVKP-------------QPQIKLEPKPDTK---------------P
M1SB56_MORMO          GSTTSNVPPGADPLPPVV-------------IPDKQPPPKQEPKP--------------E
                                                                                  

A0A0H2V972_ECOL6      --VEAPPAPKPEPKP--------------VVEEKA------APTGKAYVVQLGALKNADK
A0A454A633_ECOL5      --VEAPPAPKPEPKP--------------VVEEKA------APTGKAYVVQLGALKNADK
Q32DM2_SHIDS          --VEAPPAPKPEPQP--------------VVEEKA------APTGKAYVVQLGALKNADK
Q3YZP7_SHISS          --VEAPPAPKPEPKP--------------VVEEKA------APTGKAYVVQLGALKNADK
DEDD_ECOLI            --VEAPPAPKPEPKP--------------VVEEKA------APTGKAYVVQLGALKNADK
C8UDR5_ECO1A          --VEAPPAPKPEPKP--------------VVEEKA------APTGKAYVVQLGALKNADK
B6I4W6_ECOSE          --VEAPPAPKPEPKP--------------VVEEKA------APTGKAYVVQLGALKNADK
A0A0K0HCV6_SALBC      -PVVAASTPTPAPKP--------------VVDDKP------APTGKAYVVQLGALKNADK
Q8ZNC1_SALTY          -PVVAASTPTPAPQP--------------VADDKP------APTGKAYVVQLGALKNADK
A9MJ61_SALAR          -SVAAVSTP--AQKP--------------LADDKP------APTGKAYVVQLGALKNADK
A8ADR5_CITK8          -PVAATPTPAPEPKP--------------AAEEKP------APTGKAYVVQLGALKNADK
A6TC00_KLEP7          QQASTPTPPPAKPQQQQ---------PPQQQAALP------APTGKAYVVQLGALKNADK
B5XNS3_KLEP3          QQAATPTPPPAKPQQ-----------PPQQQAALP------APTGKAYVVQLGALKNADK
E3GAD6_ENTLS          EQLAVATESAPAPQK-------------PVADNMP------APVGKAYIVQLGALKNADK
K8CDT8_CROSK          QLAMVSEAEAPAPAKT-------------APPEKPQ----TPPAGKAYVVQLGALKNADK
K8CSK9_CROSK          QLAMVSEAEAPAPAKT-------------APPEKPQ----TPPAGKAYVVQLGALKNADK
A7MH54_CROS8          QLAMVSEAEAPAPAKT-------------APPEKPQ----TPPAGKAYVVQLGALKNADK
A0A0H3CRP4_ENTCC      QLAAASETP---PAAK-------------PAQQEA------APTGKAYVVQLGALKNADK
A4WCU8_ENT38          QIAAATEIP---PEKP-------------VQEEKP------APTGKAYVVQLGALKNADK
I2B732_SHIBC          RLAVASEQAAPPAAK--------------APQEQS-----SAPVGKAYVVQLGALKNADK
C5B8M4_EDWI9          KAVEAVKSVTPPPESRP---------LPVAKSDAGE----KAPVGQAYVVQLGALRNAGK
Q2NSI5_SODGM          PKVEASKPLAPKPD----------------TAPAAE----QAPKGEAWVVQLGALKNADK
A0A0H3B0G1_YERPY      KPLEVKPKPE---------------IKPPVEEKAP--------VGQAYVVQLGALKNAAK
A0A380PET5_YERPE      KPLEVKPKPE---------------IKPPVEEKAP--------VGQAYVVQLGALKNAAK
A8GH38_SERP5          PEPTPVPKPEPAP------------VQKPTEEKAP--------AGQAYVVQLGALKNAAK
H8NMU9_RAHAQ          PKPVEQPKPVEQPKAVAEQPKPVEQPKAAPAEKAP--------TGQSYVVQLGALKNAAK
H2IP07_RAHAC          PKPVEQPKPAEQPKAVAEQPKPVEQPKAAPEEKAP--------AGQSYVVQLGALKNAAK
D8MUY1_ERWBE          AQPKAEPK----PEPAPQAAE---------PESAP--------TGQAYVVQLGALKNASK
B2VIW1_ERWT9          AEPVEKPKPVNKPEAKPEATVD---NSPPPAETAP--------VGQAYVVQLGALKNAAK
E6W8J4_PANSA          PKPVETAKPVETPKQSE-------------AEAP---------SGQAYVVQLGALKNAAK
D4GJ83_PANAM          TKPVEQAKPVEKTKPAEQSQPA---EKTAPAEQPKE----TQPAGQAYVVQLGALKNASK
Q6D2P1_PECAS          -----EPKPEPKP--------------EVKPETQPT---QQAPVGQAYIVQLGALKNADK
C6DA70_PECCP          -----EPKPEPKP--------------EVKPETQPT---QQAPVGQAYIVQLGALKNADK
E0SL87_DICD3          ENKAADSKPAEKPADTRVAEAK---TENKAPESKPTPQEQQVPAGQAFVVQLGALKNADK
D3V8C3_XENBS          VKRETRAETKPEVKS--------------ESKTTPV----KAPQGVAYVVQLGALKNAGK
D3VKV6_XENNA          TKPLPKPEPHLENKP--------------ATKPKPVE---QAPQAVAYVVQLGALKNADK
B4EZF3_PROMH          -PTTPPPAV-------------------------SET---TAPKGEAWVVQLGALKNAAK
A0A140NID6_PROSM      -KPTPKPEVKVEPKP--------------KPEPKPEV---QAPQGKAFVVQLGALKNAAK
Q7N2B7_PHOLL          SAPALKSKPDIKSES--------------KPEVKPIE---TAPQGQAYIVQLGALKNAGK
M1SB56_MORMO          PKPEPKPVPEPEPKP--------------EPKPEPKPE--KAPQGQAYVVQLGALSNVRK
                                                                  . :::****** *. *

A0A0H2V972_ECOL6      VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKEKLKGSLGELKQLSGLSGVVMG
A0A454A633_ECOL5      VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKEKLKGSLGELKQLSGLSGVVMG
Q32DM2_SHIDS          VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMG
Q3YZP7_SHISS          VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMG
DEDD_ECOLI            VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMG
C8UDR5_ECO1A          VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMG
B6I4W6_ECOSE          VNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMG
A0A0K0HCV6_SALBC      VNEIVGKLRAAGFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELRQISGLSGVVMG
Q8ZNC1_SALTY          VNEIVGKLRSAGFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMG
A9MJ61_SALAR          VNEIVGKLRSAGFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMG
A8ADR5_CITK8          VNEIVGKLRGAGFRVYTSPSTPVQGKITRILVGPDASRDKLKNSLGELQQISGLSGVVMG
A6TC00_KLEP7          VNEIVGKLRASGFKVYTSPSTPVQGKITRILVGPDASKDKLKGQLGDLQQISGLSGVVMG
B5XNS3_KLEP3          VNEIVGKLRASGFKVYTSPSTPVQGKITRILVGPDASKDKLKGQLGDLQQISGLSGVVMG
E3GAD6_ENTLS          VNEIVGKLRGAGFKVYTSPSTPTQGKITRILVGPDASKDKLKGSLGELNRLSGLNGVVMG
K8CDT8_CROSK          VNEIVGKLRSAGYRAYTSPSTPVQGKITRILVGPEASKEKLKSSLGELNSQSGLNGVIMN
K8CSK9_CROSK          VNEIVGKLRSAGYRAYTSPSTPVQGKITRILVGPEASKDKLKSSLGELNSLSGLNGVIMN
A7MH54_CROS8          VNEIVGKLRSAGYRAYTSPSTPVQGKITRILVGPEASKDKLKSSLGELNSLSGLNGVIMN
A0A0H3CRP4_ENTCC      VNEVVGKLRSAGYRVYTSPSTPVQGKITRILVGPEASKDKLKGSLGELKQISGLSGVVMN
A4WCU8_ENT38          VNEVVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQISGLSGVVMN
I2B732_SHIBC          VNEIVAKLRAAGFKAYTSPSTPVQGKITRILVGPEANKDKLKGSLGQLQQLSGLSGVVMS
C5B8M4_EDWI9          VNEIIAKLRLSGYRVYSVPATPVQGEINRLFVGPEASRAKLQSALPELNSLSGLNGQIHN
Q2NSI5_SODGM          VSEIVAKLRLSGYRVYTSPSAPVQGQITRIFVGPDASRDKLQSALGELNQLSGLNGQLRA
A0A0H3B0G1_YERPY      VNEIVAMLRLSGHRAFTVPATPVQGEITRLYVGPDASKQKLQSALPELNALSGLNGQVKP
A0A380PET5_YERPE      VNEIVAMLRLSGHRAFTVPATPVQGEITRLYVGPDASKQKLQSALPELNALSGLNGQVKP
A8GH38_SERP5          VNEVVASLRLSGYRAFTVPSTPVQGQITRIYVGPDASKQKLQSSLSALNSISGLSGQVKP
H8NMU9_RAHAQ          ANEIVANLRLSGFRAYTVPATPVQGQITRLYVGPDASKQKLEASLPQLQQLSGLGGQVRA
H2IP07_RAHAC          ANEIVANLRLSGFRAYTVPATPVQGQITRLYVGPDASKQKLEASLPQLQQLSGLGGQVRA
D8MUY1_ERWBE          VNQVVAQLRLSGYRAFTVPSTPVQGEITRIYVGPDASKAKMQASISELKGISGLGGVVKP
B2VIW1_ERWT9          VNEIVAQLRLSGYRAFTVPATPVQGQITRIYVGPDASKAKMQAAIGALQGISGLGGVVKP
E6W8J4_PANSA          VNEIVAQLRLSGYRAFTVPSTPVQGQITRIYVGPDASKAKMQAALGELKNLSGLGGVVKP
D4GJ83_PANAM          VNEIVAKLRLSGYRAYTVPSTPVQGQITRIYVGPDASKAKMQAAVGELKNVSGLSGVVKS
Q6D2P1_PECAS          VNEIVAKLRLSGYRAYTVPSTPVSGQITRIYIGPDASKQKLESSLGELQQLSGLSGQVRA
C6DA70_PECCP          VNEIVAKLRLSGYRAYTVPSTPVSGQITRIYVGPDASKQKLESSLGELQQLSGLSGQVRA
E0SL87_DICD3          VNEIVAKLRLSGYRAYTVPSAPVAGQITRIYVGPDASKQKLQSALGELQQLSGLSGQVRS
D3V8C3_XENBS          VDEIVAKLRLSGHQVYVIPSSPVQGELTRIYVGPNASRQTLESTLPELKELTGLQGQIKN
D3VKV6_XENNA          VNEIVARLRLSGHQVYTIPFSPVQGQLTRIYVGPNASKQVLESVLSELRELTGLQGQVKN
B4EZF3_PROMH          VEEIIAKMHLSGYPVYTVPARPVSGKVTRIYIGPNASKAELQAMLPRLKELTGLQGEVRA
A0A140NID6_PROSM      VEEIVAKLRLSGYQVYTVPSRPVNGQLTRIFVGPEASRQLLEGALPELRSITGLQGEIRA
Q7N2B7_PHOLL          VDEIVARLRLSGYQVYTVPSSPVQGQLTRIYVGPNASKQQLDSALSELKSLTGLQGQVRS
M1SB56_MORMO          VEEIVATLRLSGYQVYTVP----RGKLTLIMVGPSASQAELKSSLGELRQLTGLDGRVQS
                      ..:::. :: :*. .:  *     *::. : :**.*.:  :.  :  *.  :** * :  

A0A0H2V972_ECOL6      YTPN-
A0A454A633_ECOL5      YTPN-
Q32DM2_SHIDS          YTPN-
Q3YZP7_SHISS          YTPN-
DEDD_ECOLI            YTPN-
C8UDR5_ECO1A          YTPN-
B6I4W6_ECOSE          YTPN-
A0A0K0HCV6_SALBC      YTPN-
Q8ZNC1_SALTY          YSPN-
A9MJ61_SALAR          YSPN-
A8ADR5_CITK8          YSPN-
A6TC00_KLEP7          FTPN-
B5XNS3_KLEP3          FTPN-
E3GAD6_ENTLS          YTPN-
K8CDT8_CROSK          YSVN-
K8CSK9_CROSK          YSVN-
A7MH54_CROS8          YSVN-
A0A0H3CRP4_ENTCC      YSAN-
A4WCU8_ENT38          YSAN-
I2B732_SHIBC          YSVR-
C5B8M4_EDWI9          YSVR-
Q2NSI5_SODGM          YSVR-
A0A0H3B0G1_YERPY      YTTSR
A0A380PET5_YERPE      YTTSR
A8GH38_SERP5          YGVR-
H8NMU9_RAHAQ          YSAH-
H2IP07_RAHAC          YSAH-
D8MUY1_ERWBE          YSAR-
B2VIW1_ERWT9          YGTH-
E6W8J4_PANSA          YSTR-
D4GJ83_PANAM          YSAR-
Q6D2P1_PECAS          HSVR-
C6DA70_PECCP          HSVR-
E0SL87_DICD3          YSAR-
D3V8C3_XENBS          YSP--
D3VKV6_XENNA          YKP--
B4EZF3_PROMH          YKP--
A0A140NID6_PROSM      FKP--
Q7N2B7_PHOLL          YRP--
M1SB56_MORMO          YKP--
                      .