CLUSTAL format seed alignment for MF_02027

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

WECD_ECOLI            -------------MPVRA--------SIEPLTWENAFFGVNSAIVRITS-EAPLLTPDAL
A0A0E1LEL9_ECOLX      --------------------------------------------MRITS-EAPLLTPDAL
WECD_ECOL6            -------------MPVRA--------SIEPLTWENAFFGVNSAIVRITS-EAPLLTPDAL
D3H3Z9_ECO44          --------------------------------------------MRITS-EAPLLTPDAL
B7MGK0_ECO45          ------------------------------------------------------------
B2TU03_SHIB3          ------------------------------------------------------------
E3PNY0_ECOH1          ------------------------------------------------------------
A8ACU2_CITK8          -------------MPVRA--------SIEPLTWENTFFGVNSAIVRVNP-AAPVLTPEAL
D2TH55_CITRI          -------------MRVHA--------SIEPLEWENAFFGVNSAIVRIDP-AAAPLTAERL
E8XIN4_SALT4          ----MANIYWSCSVPVRA--------SIEPLLWENTFFGVNSGIVRIDA-SAPELTPEAL
Q9L6R1_SALTY          ------------------------------------------------------------
B5RFR4_SALG2          ------------------------------------------------------------
A9MJ20_SALAR          ---------------------------------------MNSAIVRIDA-SAPELTPEAL
A6TGH8_KLEP7          -------------MPVRA--------SIDPLEWENRFFAVNSAIVRFDE-HAPRLTPEAL
E3G3Z2_ENTLS          -------------MHIHA--------TIEPLSWENQFFAINSSILRFAE-HAPAVTPEAL
A4WG23_ENT38          --------------------------MLEPLEWESQFFGIPSGVVRFRD-NAPALSVADF
A7MQH5_CROS8          -------------MHVHA--------TLDPLEWESHFFGIDSAIVRFSD-TAPQLDVAQL
I2BE76_SHIBC          -------------MPVHA--------SIEPLEWESHFFGIESGILRFDP-QARPLEKALL
A0A1X7LXM3_9ENTR      ------------MSPIHG--------TLAPLDWENRFFDVNSCAVRFSE-EAPALLEDQL
Q6CZE7_PECAS          -MSNSISAGK---GEIRA--------TVEPLGWESEFFQIDSGKLNFSP-SSPVLTPDVL
G7LUD8_9GAMM          MTEITLSAGEPSPARIHA--------NIEPLSWESRFFNLNSGKLDFSP-SAPLLTADAL
E6WHE8_PANSA          -------------MSIHV--------SINPLAWESGFFGLNTARLEIDG-D-TPLAQALQ
D4GGL9_PANAM          ------------------------------------------------------------
E1SK75_PANVC          -------------MPVHV--------SINPLSWESAFFGVETVRLEPEG-D-IPLEQALR
A0A2S5K7H4_9GAMM      -------------MPVRV--------SIDPLEWESDFFHQPTARLTLQG-E-LTLPQALQ
B2VG67_ERWT9          -------------MSIHA--------SIKPLEWESAFFGRRCALLELKG-D-SMLDAARL
E3DD08_ERWSE          -------------MSVLA--------SIKPLEWESAFFGRRCALLELTG-D-SVLDAARL
D4HUJ6_ERWAC          -------------MSVLA--------SIKPLAWESAFFGRRCALLELQG-D-SVLDVARL
D8MKS5_ERWBE          -------------MSASSQPALMPSVALNPLSWENTFFGVNSGLLSFEA-NGSPLTDALF
D3V6K5_XENBS          -------------MSIHA--------NIEPLAWDSQFFGLSTARLNFSP-QASVLTTAQL
D3VHX8_XENNA          -------------MSIHA--------NLEPLAWDSQFFGLSTARLNLSP-GAAVITAAHL
Q0WAF0_YERPE          --------------------------------------------MIFSD-SAPPLNPAEL
A0A6B3T6R0_YERPE      -------------MPVHA--------SIEPLGWESEFFQRQSAKLIFSD-SAPPLNPAEL
A1JI76_YERE8          -----------------------------------------------------------M
Q7MYM1_PHOLL          ------------------------------------------------------------
W0LDR9_9GAMM          -------------MSVHA--------NIEPLGWESEFFQLSSAKLHFDD-ASPLVSKAEL
A8G837_SERP5          -------------MHAHA--------SIEPLAWETEFFALNSAKLNFST-AAPMLTEAEL
J7SL75_MORMO          -------------MSVRA--------SIEHLAWESDFFALKTAKLAFSP-DAAPLSAADF
K8WLY1_9GAMM          -------------MSVRA--------SIDNLPWESEFFGLSTAKLNFSAADAENIIANQL
B4F1W3_PROMH          -------------MSVLA--------NINYLEWESDFFSLNTGRLEFSA-QAPVLTQDRL
H2IWR8_RAHAC          -MDCGYQRRMAINRSLRG--------VLEPLVWESDFFQLNSARLTPDA-SAGKITPQIL
C5BBC1_EDWI9          -------------MSVHA--------SIEPLAWESAFFALRSGRLMFDD-RAPPLLASAC
A0A097QXN4_HAFAL      -------------MCVHA--------SIEPLAWESEYFHLRTAKLAFST-AAPILTTADF
E0SKQ3_DICD3          --------------------------------------------MSFQE-TAPPLTLADL
Q2NQC1_SODGM          ----MDNICWICSMSVHA--------NTDLLTWESDFFGRRLGRVAFDD-AAPCLTSGGL
W0HT62_9GAMM          -------------MSARA--------SIDLLAWESEFFGRRLGRVVFDD-AAPRLTPSAL
A0A088MY04_9GAMM      -------------MPALA--------HINVLSWDSYFFGRPLGRLRFDA-TANALTQSVL
                                                                                  

WECD_ECOLI            APWSRVQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN----ASD-SGAVV------
A0A0E1LEL9_ECOLX      APWSRVQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN----ASD-SGAVV------
WECD_ECOL6            APWSRVQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN----VSD-SGAVV------
D3H3Z9_ECO44          APWSRVQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN----VGD-SGAEV------
B7MGK0_ECO45          -----MQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN----VSD-SGAVV------
B2TU03_SHIB3          -----MQAKIVASNTGELDALQQLGFSLVEGEVDLALPVNN----VSD-SGAVV------
E3PNY0_ECOH1          -----MQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN----ASD-SGAVV------
A8ACU2_CITK8          QPWSRVQAKISAARTDELDALQQLGFSLVEGEVDFSLPVAG----VERISGVEI------
D2TH55_CITRI          QAWSRVQAKIPAAETAWLDALQQLGFSLVEGEVDLALPVTP----TGEQAGAEI------
E8XIN4_SALT4          QAWQRVQVKVPAENIAWLSALQSLGFSLVEGEVDFALPVKG----HRDQHGAEI------
Q9L6R1_SALTY          -----MQVKVPAENIAWLSALQSLGFSLVEGEVDFALPVKG----HRDQHGAEI------
B5RFR4_SALG2          -----MQVKVPAENIAWLSALQSLGFSLVEGEVDFALPVKG----HRDQHGAEI------
A9MJ20_SALAR          QAWERVQVKVPAENTAWLSALQPLGFSLVEGEVDFALPVKG----HSYQHGAEI------
A6TGH8_KLEP7          AGWSRVQAKIAASDTVRLDALQRLGFQLVEGEVDLALPVGS----PAD-AGADV------
E3G3Z2_ENTLS          APWGRVQAKIAASQVALLDALQHLGFQLVEGEADLALPVRE----RGD-TRAEV------
A4WG23_ENT38          APWQRVQAKIPAADADCLDALQLVGFQLVEGEVDLKMAIAH----QAP-SAAER------
A7MQH5_CROS8          DAWSRVQAKVPAARCDLLDGLAQLGFQLVEGEVDFALTLTP----DAPARDAQII-----
I2BE76_SHIBC          DSWPRVQAKIATGRSDQLDALQQLGFQLVEGELDFCVPVGP----GQGEAPATV------
A0A1X7LXM3_9ENTR      NTWSRVQAKIPSHRTDWLDGLQQLGFQLVEGEVDLVLSVGT----QNANIPVDI------
Q6CZE7_PECAS          NVFALTQAKIAADNLVLADALADLGFRLVEGEVDLSLPLHP----TTVVTPLPRWR----
G7LUD8_9GAMM          NAYALTQAKIPADNMQLADALADCGFRLVEGEVDLCLDLEA----LPTAEELSRPR----
E6WHE8_PANSA          QPYKLWQIKVAADRHDVIDAISQHRFQLVEGEADLAINIKR----TERQTGVRI------
D4GGL9_PANAM          ---------MSAEQTDIIDALNQHQFHLVEGEVDLSLTIKR----TERQTGIRI------
E1SK75_PANVC          HPCALMQMKVAASETALIDTLQQHQFQLAEGEADLALAVNE----TERQAGIRI------
A0A2S5K7H4_9GAMM      QATGLLQIKVPAEQTAAIDAVCQHGFQLVEGEADLTLPLTQ----TARQPGVRI------
B2VG67_ERWT9          DDWDLVQVKVMAQQSAELDALNALGFRLVEGEADCVLGIAA----VERPAGIRI------
E3DD08_ERWSE          NDWDLVQVKVMAQQSAELDALSALGFRLVEGEAECVSGISA----GERPVGIRI------
D4HUJ6_ERWAC          NDWDLVQVKVMAQQSAELDALSALGFRLVEGEADCALGIAA----ADRPAGIRI------
D8MKS5_ERWBE          AGYDLVQAKVLSQQTAELDALSALGFKLVEGEADFVLGIAS----ASRPEGIRI------
D3V6K5_XENBS          DEYALVQAKVPARQTDIIDGLSALGFSLVEGEADFLLPVDS----GAMSYRNATGIQSEQ
D3VHX8_XENNA          DEYALVQAKIPAQQTAVLDALSALSFSLAEGEADLLLSLDA----GDQT-EIQTGQNAVP
Q0WAF0_YERPE          AAFTLVQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGTENATSEPNM-GAY
A0A6B3T6R0_YERPE      AAFTLVQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGTENATSEPNM-GAY
A1JI76_YERE8          DAFTLTQAKVPTHRLDLIDSLGQLGFKLVEGEVDLVLLVEEKDRVGTENASSAIDT-GTY
Q7MYM1_PHOLL          -----MQAKVPAQRLDLIDGLSALGFSLVEGEVDLSLMI------GIENAENAKDN-PES
W0LDR9_9GAMM          DAFALVQAKIPAQRLDLADALAGLGFRLVEGEIDLALPV------GTKSASL-------S
A8G837_SERP5          DGYALVQAKIPAHQTALVDGLTRLGFQLVEGEVDLVLNI------GTECASLHTE--ATQ
J7SL75_MORMO          APYELVQAKISAGDNAALDGLSALGFSLAESEVDFALSLRS----GTENAMSDSTLCYAD
K8WLY1_9GAMM          AGYDVVQAKIAAHETANLDGLSALGFSLVEGEVDFTLMI------GTENAYLKECLSISE
B4F1W3_PROMH          EQFTVVHAKVASYDLLLIDNLTQLGFQFAEGEIDFKLPI------GTENACENIAE---I
H2IWR8_RAHAC          GQYALVQAKVDASQTHTLDALSALGFRLAEGETDICVAV-------TMQDNALTAG----
C5BBC1_EDWI9          DAYQLLQAKVDARDLARCDALQALGFRLAEGEADFILPISS----ASAS----GGQ----
A0A097QXN4_HAFAL      QPFDIVQAKIPADRVALADDLANLGFRLVEGEIDLSLPIEK----AQLGTEPANSQPMDS
E0SKQ3_DICD3          DRYELCQAKLAANDLATADALSALGFRLAEGEVDFSMPVVP---VARAMFAVGVRD----
Q2NQC1_SODGM          TAFALVQAKVAAQATAQMDALSALGFRPVEGEIDCCYTLPAS---SGGAPVA---ALPAA
W0HT62_9GAMM          TGFALVQAKVAAQATAQMDALSAIGFRPVEGEMDCCYTLPAC---AGGAPVAGAAALPAA
A0A088MY04_9GAMM      NVFALVQAKVATQDEAQIKALRAIGFESVEGEIDCCYILPPL---KSTEDRI---ALPTA
                               : :      . :    *  .*.* :    :                     

WECD_ECOLI            ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILR
A0A0E1LEL9_ECOLX      ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILR
WECD_ECOL6            ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASGRFYAQWIENAVRGTFDHQCLILR
D3H3Z9_ECO44          ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASGRFYAQWIENAVRGTFDHQCLILR
B7MGK0_ECO45          ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASGRFYAQWIENAVRGTFDHQCLILR
B2TU03_SHIB3          ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASGRFYAQWIENAVRGTFDHQCLILR
E3PNY0_ECOH1          ----AQETDIPALRQLASAAFAQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILR
A8ACU2_CITK8          ----AQIADIPALRQQASAAFAQSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLVIR
D2TH55_CITRI          ----AQPADIPALRQLAAVAFAQSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLLLR
E8XIN4_SALT4          ----AHLTDIPALRQLAGEAFTQSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLVLR
Q9L6R1_SALTY          ----AHLTDIPALRQLAGEAFTQSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLVLR
B5RFR4_SALG2          ----AHLTDIPALRQLAGEAFTQSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLVLR
A9MJ20_SALAR          ----AHLTDIPALRQLAGEAFALSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLVLR
A6TGH8_KLEP7          ----AVEADIAPLREQAAQAFAMSRFRAPWYAADASGRFYAQWIENAVRGTFDHQCLIYR
E3G3Z2_ENTLS          ----ATERDIPRLRELAARAFALSRFRAPWYADDASGRFYAQWIENAVRGTFDNECLVFR
A4WG23_ENT38          ----ATEQDIPVLRQMAARAFAQSRFRAPWYAADDSGRFYAQWIENAVKGTFDHECLVFR
A7MQH5_CROS8          ---TATSDDIPLLRDAAAEAFAMSRFRAPWYAPDASGRFYAQWVENAVKGAFDHECLILR
I2BE76_SHIBC          ---QAVAEDIAHLRERAAGVFTQSRFRAPWYGAQDSGRFYAQWIENAVRGTFDHCCLILP
A0A1X7LXM3_9ENTR      ----AQPNDIPALRLAASQVFTQSRFRTPWYKAGDSGRFYAQWIENAVLGTFDHQCLLLQ
Q6CZE7_PECAS          ---EATLDDIPALRDAASRVFALSRFRTPWYQPEDSGRFYAQWVENAVCGTFDHSCLMME
G7LUD8_9GAMM          ---VAESADIPALREAAAQVFALSRFRAPWYRPEDSGRFYAQWAENAVLGVFDHQCLLLE
E6WHE8_PANSA          ----AREAQIPQLRAAAASAFSLSRFRTPWYQADDSSRFYAQWIENAVRGTFDNQCLIAC
D4GGL9_PANAM          ----AREAQIPALREAASLAFRQSRFRTPWFAPDDSARFYAQWIENAVRGTFDHQCLVAS
E1SK75_PANVC          ----AREAQIPQLRDAASQLFSQSRFRTPWYAPDASGRFYAQWIENAVRGTFDDQCLVAS
A0A2S5K7H4_9GAMM      ----AREAQIPALRAAAAEAFSQSRFRAPWFDAADSGRFYAQWIENAVRGTFDHQCLIAC
B2VG67_ERWT9          ----ARVEHIPPLRHAAAELFIYSRFRFPWFAAGDSGRFYAQWIENAVRGTFDHQCLLAV
E3DD08_ERWSE          ----ARTEHIPLLRRAAEDAFTYSRFRTPWFAAGDSGRFYAQWIENAVRGTFDHQCLLAV
D4HUJ6_ERWAC          ----ARVEHIAQLRHAAEQAFTFSRFRTPWFAAGDSGRFYAQWIENAVRGTFDHQCLLAV
D8MKS5_ERWBE          ----ARKEHIPALREAASGAFAQSRFRAPWYQPGDSGRFYAQWIENAVLGTFDHQCLLAI
D3V6K5_XENBS          ALISATSQDIPVLTAAAASVFKASRFRVPWYQPDDSGRFYAAWVEKAVLGTFDHECLLVN
D3VHX8_XENNA          KFVIAKPQDIPALKAVAEQVFKVSRFRAPWYQPDDSGRFYAVWVENAVLGTFDHECLMIN
Q0WAF0_YERPE          SLRVATEADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCLLVL
A0A6B3T6R0_YERPE      SLRVATEADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCLLVL
A1JI76_YERE8          QQRLATTADIPLLRSVAAQAFALSRFRAPWYDPQDSGRFYALWAEKAVLGTFDHQCLLVM
Q7MYM1_PHOLL          NLLLAERRDIPMLKEVASNVFPLSRFRTPWYQPQDSGRFYATWVEKAVLGTFDHQCLLVN
W0LDR9_9GAMM          AMRVALPEDIPILRAAAASVFAASRFRMPWYGQHDSGRFYATWIEKAVLGAFDHQCLLVL
A8G837_SERP5          AIRPAVPADIPMLRAAAAGVFTASRFRAPWYHAQDSGRFYAEWIEKAVLGTFDHQCLLVL
J7SL75_MORMO          ------ETDIPVIKQAAAQVFSQSRFRAPWYRPDDSARFYAVWAEKAVRGTFDKDCLLIR
K8WLY1_9GAMM          TVELAVDKDIPFLRQAAEQVFSHSRFRAPWYKEGDSGRFYALWIEKAVLGTFDHTCLLVK
B4F1W3_PROMH          HFRTANETDIPLLMTTASAAFVQSRFRAPWYQEGDSSRFYALWVKKAVLGTFDDSCLLTM
H2IWR8_RAHAC          --RLAVPDNIADVTAIARQAFHLSRFRAPWYQPDDSARFYAMWAEKAVLGTFDHLCLWAD
C5BBC1_EDWI9          --RQAQAQDCLWLRALARDAFALSRFRAPWYRDGESARFYAEWVEKAVYGTFDHACLLAL
A0A097QXN4_HAFAL      SCRIASAEDIPWLRTQAAQAFALSRFRVPWYQADDSARFYAEWVEKAVLGTFDHQCLLVL
E0SKQ3_DICD3          ----AEAGDIPALCAAATKSFVLSRFRAPWYGPDDCGRFYARWVEKAVYGTFDDACLVMG
Q2NQC1_SODGM          EMRVAEASDIPALRALAAQTLTLSRFRPPWFSDEERQRFYAQWVENAVRGSFDHLCLVAD
W0HT62_9GAMM          EMRLAGEADISALRALAAQTLVQSRFRAPWFSDEERQRFYAQWVANAVRGSFDHLCLVAQ
A0A088MY04_9GAMM      EIRPATLLDIPVLRALAADALVLSRIRPPWFSNNERRRFYAQWVENAVRGTFDDLCLLFE
                              .   :   *   :  **:* **:      **** *  :** * **. **   

WECD_ECOLI            AASGDIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
A0A0E1LEL9_ECOLX      AASGDIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
WECD_ECOL6            AASGDIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
D3H3Z9_ECO44          AASGAIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
B7MGK0_ECO45          AASGDIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
B2TU03_SHIB3          AASGDIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
E3PNY0_ECOH1          AASGDIRGYVSLRELNATDARIGLL------AGRGAGAELMQTALNWAYARGKTTLRVAT
A8ACU2_CITK8          AANNDIRGFVSLRELNDTDARIGLL------AGRGAGAELMQAALAWAQSRGKTTLRVAT
D2TH55_CITRI          AANGDIRGYVSLRELNDREARIGLL------AGRGAGAELMQAALGWAQARGKTTLRVAT
E8XIN4_SALT4          TETGAIRGYVSLRELNDTDARIGLL------AGRGAGAELMQAAICWAQSRGKATLRVAT
Q9L6R1_SALTY          TETGAIRGYVSLRELNDTDARIGLL------AGRGAGAELMQAAICWAQSRGKATLRVAT
B5RFR4_SALG2          TETGAIRGYVSLRELNDTDARIGLL------AGRGAGAELMQAAICWAQSRGKATLRVAT
A9MJ20_SALAR          TQTGAIRGYVSLRELNDTDARIGLL------AGRGAGAELMQAAICWAQRRGKATLRVAT
A6TGH8_KLEP7          HPEGDIRAFVSLRQITATEARIGLL------AGRGAGAQLMQAARYWAASRGLSTLRVAT
E3G3Z2_ENTLS          DATGDIAAFVSMRQLASGEARIGLL------AGRGAGEALMNAATGWAHRRGLSTLRVAT
A4WG23_ENT38          ATDGEIQAFVSLRQLNDSEARIGLL------AGRGMGDKLMHAAAHWAAARQLSTLRVAT
A7MQH5_CROS8          TPQGALRGFVTLRALNEQEARIGLL------AGRGAGEALMQAARHWCVTRGLYTLRVAT
I2BE76_SHIBC          GEPGELRGFVTLRQLNNQDARVGLL------AGKGCGGELMQAASHWCAGRGLTRLYIAT
A0A1X7LXM3_9ENTR      NGD-ECLGFVTLRQLNDAEARIGLL------AGRGLGEELMAAAQDWCRQRGLTTLRVAT
Q6CZE7_PECAS          DAAGHPQGWVTLRRLDDSDARIGLLGVWPGVTIRGIGSQLMALAEAWCRQQGLIRLRVAT
G7LUD8_9GAMM          NAAGEPQGWVTLRRLNAVEARIGLLAVWPGAAARGIGTQLMSAAETWCRRQEIQRLWVAT
E6WHE8_PANSA          DEQGALQGFVSIREQ-QGDARIGLLAVLPEAQGKGIGQRLLLAAADWGRVRQLNRLRVAT
D4GGL9_PANAM          DERGALQGFVSLREV-EGDARIGLLAVVPEAQGQSIGQRLMLAAADWGRARQLERLRVAT
E1SK75_PANVC          DATGQLQGFVSLRAV-DGDARIGLLGVLPDAQGQGLGQRLLLAAADWARVRQLAQLRVAT
A0A2S5K7H4_9GAMM      DEQGSLQGFVSLREV-NGDVRIGLLAVLPDARSQGIGQRLLLAAADWGRVRQLAQLRVAT
B2VG67_ERWT9          DEKGAMQGFVSLRELSDGTGRIGLLAVLPEYQGLGIGQRLMDAANDWCRARRLTRLHVAT
E3DD08_ERWSE          DETGVMQGFVSLRELPEGTGRIGLLAVLPEYQGLGIGQRLMNAANDWCRARRLTRLHVAT
D4HUJ6_ERWAC          DAAGAMQGFISLRELPDGTGRIGLLAVLPESQGLGIGQRLMNAANDWCLARRLSRLQVAT
D8MKS5_ERWBE          NEQGDLQGFISLRELSDGSARIGLLATLPEAQGLGVGQRMIEAASDWCRARRLTRLHVAT
D3V6K5_XENBS          DECGQIIGFVTLRDIGSHEARIGLLAALPGNYHRGIGKKLMSAAQRWCENHQIQRLRVAT
D3VHX8_XENNA          DEHGQMMGFVTLRDIGSHEARIGLLATVPGSHHQGIGKKLMSAAQQWCQQHQIQRLRIAT
Q0WAF0_YERPE          DPTDQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRLRVAT
A0A6B3T6R0_YERPE      DPTDQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRLRVAT
A1JI76_YERE8          DTFGQPAGFVTLRDLQDGSARIGLLAVFPDAQGKGIGSLLMSAAKQWCQSHGLHRLRVAT
Q7MYM1_PHOLL          GDNEQPAGFVTLRDIGAGEARIGLLAVFPGNIGCGIGSKLMLAAQQWCQHHQIHQLRIAT
W0LDR9_9GAMM          GGDGQPEGFVSLRDIGQQEARIGLLAVFPGAQGKGTGSRLMAAAIAWCQQRELLRLRIAT
A8G837_SERP5          DDTGQPEGFVSLRELGGSEARIGLLAAFPGAAGKGIGSRLMTAVIAECRQRSLQRLRVAT
J7SL75_MORMO          NKNNEIAGFVTLRQTDERSARIGLLAVLPGNQGQGIGLKLMSAAQQWCAEHHCRVLRVAT
K8WLY1_9GAMM          DESGNVLGFVSLRHLDNDIARIGLLAAIPGIGKRGIGRKLMSAAFSWCQQHNKKQLHVAT
B4F1W3_PROMH          DRENKVTGFVTLRRISESEARVGLLAVMPNRTGQGIGKQLMSVAKYWCQQQGLSTLYVAT
H2IWR8_RAHAC          DEQGNALGFVTLRRISQDEARIGLLAVRPEYQGQGVGKKLMAAAKKWCAEQGVSRMYVAT
C5BBC1_EDWI9          DNEGNPQGFVTLRRQVDGSARIGLLAVDGASFRGGVGRRLVTQAQAWCHAQRLSRLHVAT
A0A097QXN4_HAFAL      NAQMKPAGFVTLRALDNGEARIGLLAVAPESTGLGVGKQLMLLAQNWCRDKSLSRLHVAT
E0SKQ3_DICD3          GQGLPLQGFVTLRQTSPSTARIGVLSAWPGMTGQGIGQRLMQVARVWCQQRGIRRLTVAT
Q2NQC1_SODGM          GPT-GLEGLVTLRDIGEQTARIGLLAVSYAARGRGTGKLLCRAALGWCRSRGFSQLRVAT
W0HT62_9GAMM          GPD-GISGLVTLRDIGGQAARIGLLAVSPAARGRGTGKLLCRAALGWCRSRGFRQLWVAT
A0A088MY04_9GAMM      GHR-GIEGLVTLRQIGQYEARIGLLAVAPALRGRGTGRQLYLAAVAWCYQRNLRSLWMAT
                             . :::*       *:*:*         . *  :   .      :    : :**

WECD_ECOLI            QMGNTAALKRYIQSGANVESTAYWLYR------
A0A0E1LEL9_ECOLX      QMGNTAALKRYIQSGANVESTAYWLYR------
WECD_ECOL6            QMGNTAALKRYIQSGANVESTAYWLYR------
D3H3Z9_ECO44          QMGNTAALKRYIQSGANVESTAYWLYR------
B7MGK0_ECO45          QMGNTAALKRYIQSGANVESTAYWLYR------
B2TU03_SHIB3          QMGNTAALKRYIQSGANVESTAYWLYR------
E3PNY0_ECOH1          QMGNTAALKRYIQSGANVESTAYWLYR------
A8ACU2_CITK8          QMGNTAALKRYIQSGGNVESTAYWLYR------
D2TH55_CITRI          QMGNTAALKRYIQSGANVAGTAYWLYR------
E8XIN4_SALT4          QLGNTAALKRYIQSGANIESTAYWLYR------
Q9L6R1_SALTY          QLGNTAALKRYIQSGANIESTAYWLYR------
B5RFR4_SALG2          QLGNTAALKRYIQSGANIESTAYWLYR------
A9MJ20_SALAR          QLGNTAALKRYIQSGANIESTAYWLYR------
A6TGH8_KLEP7          QMGNTAALKRYILSGANVESTAYWLYR------
E3G3Z2_ENTLS          QMGNTAALKRYIQSGANIVSTAYWLYR------
A4WG23_ENT38          QMGNTAALKRYIASGANVDTTAYWLYR------
A7MQH5_CROS8          QAGNRAALRRYIASGGNIENTAYWLYR------
I2BE76_SHIBC          QISNSAAIRRYIRSGGEVIGSAYWLYR------
A0A1X7LXM3_9ENTR      QVSNTAALRRYIKSGATIESTAFWLYR------
Q6CZE7_PECAS          QVGNVAALRLYLRRGATIESTAYWLYR------
G7LUD8_9GAMM          QTGNVAALRLYLRRGARIMSTAYWLYR------
E6WHE8_PANSA          QLSNLTAMRLYLRSGARLESTAWWFYRNAHDPI
D4GGL9_PANAM          QISNLTAMRLYLRSGARLESTAYWFYRRGHDSL
E1SK75_PANVC          QLSNLTAMRLYLRSGARLDSTAYWFYRKGHDSI
A0A2S5K7H4_9GAMM      QLSNLAAMRLYLRCGARLESTAYWFYRKAS---
B2VG67_ERWT9          QLGNLSALRLYLRCGGVIERTAYWLYREII---
E3DD08_ERWSE          QLGNLSALRLYLRCGGVFERTAYWLYREMT---
D4HUJ6_ERWAC          QLGNLSALRLYLRCGGIIERTAYWLYREII---
D8MKS5_ERWBE          QLGNLPALRLYHRCGGVIERTAYWLYR------
D3V6K5_XENBS          QISNITALRLYTRSGATIESTAYWLYRG-----
D3VHX8_XENNA          QISNIAALRLYTRRGAIIESTAYWLYRG-----
Q0WAF0_YERPE          QMSNIAALRLYIRSGASIESTAYWLCRG-----
A0A6B3T6R0_YERPE      QMSNIAALRLYIRSGASIESTAYWLCRG-----
A1JI76_YERE8          QMSNVAALRLYIRSGASIESTAYWLCRG-----
Q7MYM1_PHOLL          QTSNIAALRLYTRSGAFVESTAYWLYRG-----
W0LDR9_9GAMM          QISNIAALRLYQRHGAIIESTAYWFYRGLHDPI
A8G837_SERP5          QFGNIAALRLYQRQGAAIESTSYWLYRGRHDPI
J7SL75_MORMO          QLSNLAAMRLYTKSGGAVDSTAYWLYRGCNDSI
K8WLY1_9GAMM          QVSNLAALNLYSRSGASITSTAYWLYRGQYDSI
B4F1W3_PROMH          QISNIAASRLYTQSGALIDSTTYWLYRG-----
H2IWR8_RAHAC          QTGNIAALNLYLASGGKVMRSAYWLYR------
C5BBC1_EDWI9          QIGNLAAQRLYLGCGAQLTATAYWLYR------
A0A097QXN4_HAFAL      QTGNIPALRLYIRSGAVIESTAYWLYR------
E0SKQ3_DICD3          QTSNLAALRLYLRSGARVESTAYWFYR------
Q2NQC1_SODGM          QTANLPALRLYLASGAQIVHAAHWLYRGPHDSI
W0HT62_9GAMM          QTANLPALRLYLASGARVVHAAHWLYRGPHDSI
A0A088MY04_9GAMM      QSANLLALQFYLSNGAIVAYSSFWLYRENNDPI
                      * .*  * . *   *. .  :: *: *