CLUSTAL format seed alignment for MF_02028

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q31UJ8_SHIBS          -------------------------------MAPLVHALAKAPFFEAKVCVTAQHREMLD
B2TU06_SHIB3          ----------------MKVLTVFGTRPEAIKMAPLVHALAKAPFFEAKVCVTAQHREMLD
Q329W5_SHIDS          --MSAKALAAYSKRIDVKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLD
E3PNX6_ECOH1          ----------------MKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLD
WECB_ECOLI            ----------------MKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLD
B7MGJ6_ECO45          ----------------MKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLD
V7INY2_SALET          -------------------------------MAPLVHALEKDPHFEAKVCVTAQHREMLD
G4C8P1_SALIN          -------------------------------MAPLVHALEKDPHFEAKVCVTAQHREMLD
WECB_SALTY            ----------------MKVLTVFGTRPEAIKMAPLVHALEKDPHFEAKVCVTAQHREMLD
WECB_SALTI            ----------------MKVLTVFGTRPEAIKMAPLVHALEKDPHFEAKVCVTAQHREMLD
B5RFR8_SALG2          ----------------MKVLTVFGTRPEAIKMAPLVHALEKDPHFEAKVCVTAQHREMLD
D2TH59_CITRI          ----------------MKVLTVFGTRPEAIKMAPLVHALAKDPEFDAKVCVTAQHREMLD
A4WG25_ENT38          ----------------MKVLTVFGTRPEAIKMAPLVHALANDPWFEAKVCVTAQHREMLD
A7MQH7_CROS8          -------------------------------MAPLVHALAQDPAFDTRVCVTAQHRQMLD
A0A089PGC5_PLUGE      -------------------------------MAPLVHALAKDPHFEAKVCVTAQHREMLD
E3G3Z4_ENTLS          -------------------------------MAPLVHALAKDPHFEAKVCVTAQHREMLD
A6TGH4_KLEP7          -------------------------------MAPLVHALAKDPHFEAKVCVTAQHREMLD
I2BE80_SHIBC          ------------MRLVVKVLTVFGTRPEAIKMAPLVHALAQDPFFDARVCVTAQHREMLD
WECB_YERPE            ----------------MKVLTVFGTRPEAIKMAPLVHALAQDDAFESRVCVTAQHREMLD
A0A0B6FDC7_YERFR      ----------------MKVLTVFGTRPEAIKMAPLVHALAQDEAFESRVCVTAQHREMLD
A8G833_SERP5          ----------------MKVLTVFGTRPEAIKMAPLVHALAQDEAFESRVCVTAQHREMLD
A0A097QXS7_HAFAL      ----------------MKVLTVFGTRPEAIKMAPLVHALAKDSAFEARVCVTAQHREMLD
D3V6K9_XENBS          ----------------MKVLTVFGTRPEAIKMAPLVHALAKDAAFDAKVCVTAQHREMLD
D3VHX4_XENNA          ----------------MKVLTVFGTRPEAIKMAPLVHALSRDTAFDAKVCVTAQHREMLD
Q7MYL7_PHOLL          ----------------MKVLTVFGTRPEAIKMAPLVHALARDEAFEAKVCVTAQHREMLD
M1S433_MORMO          ----------------MKVLTVFGTRPEAIKMAPLVHALAADQAFEAKVCVTAQHREMLD
K8WW39_9GAMM          ----------------MKVLTVFGTRPEAIKMAPLVHALANDAGFDARVCVTAQHREMLD
B4F1V9_PROMH          ----------------MKVLTVFGTRPEAIKMAPLVHALANDDSFEAKVCVTAQHREMLD
C5BBB7_EDWI9          ----------------MKVLTVFGTRPEAIKMAPLVHALAADAAFDARVCVTAQHREMLD
A0A2S5K7H2_9GAMM      ----------------MKVLTVFGTRPEAIKMAPLVQALAQDAAFESRLCVTAQHREMLD
U3U0A1_9ENTR          ----------------MKVLTVFGTRPEAIKMAPLVQALAQDAAFESRLCVTAQHREMLD
E6WHE6_PANSA          ----------------MKVLTVFGTRPEAIKMAPLVQALAQDAAFESRLCVTAQHREMLD
E1SK73_PANVC          ----------MIERNSVKVLTVFGTRPEAIKMAPLVQALSQDPAFESRLCVTAQHREMLD
B2VG63_ERWT9          ----------------MKVLTVFGTRPEAIKMAPLVHALAQDDTIESRLCVTAQHREMLD
D8MKS3_ERWBE          ----------------MKVLTVFGTRPEAIKMAPLVHALAQDSEIDARLCVTAQHREMLD
H2IWS0_RAHAC          ----------------MKVLTIFGTRPEAIKMAPLVLALSQDAAFESKVCVTAQHREMLD
Q2NQB7_SODGM          ----------------MKVLIVFGTRPEAIKMAPLVLALANDLAFETRVCVTAQHREMLD
W0HNF6_9GAMM          MYSKPLPALLRIKGTVVKVLVVFGTRPEAIKMAPLVLALAADPAFETRVCVTAQHREMLD
Q6CZE4_PECAS          ----------------MKVLTVFGTRPEAIKMAPLVHALAQDGAFESRICVTAQHREMLD
G7LUD5_9GAMM          ----------------MKVLTVFGTRPEAIKMAPLVHALAQDEAFESRICVTAQHREMLD
C6CGI2_DICC1          ----------------MKVLTVFGTRPEAIKMAPIIRAMSQDTFFESRVCVTAQHRDMLD
E0SKQ5_DICD3          ----------------MKVLTVFGTRPEAIKMAPVIRAMAQDAFFESKVCVTAQHRDMLD
                                                     ***:: *:     :::::*******:***

Q31UJ8_SHIBS          QVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
B2TU06_SHIB3          QVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
Q329W5_SHIDS          QVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
E3PNX6_ECOH1          QVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
WECB_ECOLI            QVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
B7MGJ6_ECO45          QVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
V7INY2_SALET          QVLTLFSIVPDFDLNIMQPGQGLTEITCRILEGLKPILADFKPDVVLVHGDTTTTIATSL
G4C8P1_SALIN          QVLTLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILADFKPDVVLVHGDTTTTIATSL
WECB_SALTY            QVLTLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILADFKPDVVLVHGDTTTTIATSL
WECB_SALTI            QVLTLFSIVPDYDLNIMQPGQGLTEITCRILERLKPILADFKPDVVLVHGDTTTTIATSL
B5RFR8_SALG2          QVLTLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILADFKPDVVLVHGDTTTTIATSL
D2TH59_CITRI          QVLNLFSIVPDYDLNIMRPGQGLTEITCRILEGLKPVLADFKPDVVLVHGDTTTTIATSL
A4WG25_ENT38          QVLNLFSIVPDYDLNIMKPGQGLTEITCRILEGLKPILESFKPDVVLVHGDTTTTIATSL
A7MQH7_CROS8          QVLHLFSIVPDYDLNIMKPGQGLTEITCRILEGLKPILTEFRPDVVLVHGDTTTTIATSL
A0A089PGC5_PLUGE      QVLRLFSIVPDYDLNIMKPGQGLTEITCRILEGLKPVLESFKPDVVLVHGDTTTTLAASL
E3G3Z4_ENTLS          QVLKLFAIVPDYDLNIMSPGQGLTEITCKILQGLKPVLESFQPDVVLVHGDTTTTMAASL
A6TGH4_KLEP7          QVLKLFSIVPDYDLNIMKPGQGLTEITCRILEGLKPVLESFKPDVVLVHGDTTTTMAASL
I2BE80_SHIBC          QVLNLFAIQPDFDLNIMKPGQGLTEITSRILGGMQPILESFRPDIVLVHGDTTTTMAASL
WECB_YERPE            QVLRLFEIQPDYDLDIMRPGQGLTEITCRILEGLKPVLEEFKPDVILVHGDTTTTLSASL
A0A0B6FDC7_YERFR      QVLRLFEIQPDYDLNIMKPGQGLTEITCRILEGLKPVLEEFKPDVILVHGDTTTTLSTSL
A8G833_SERP5          QVLRLFEIVPDYDLNIMKPGQGLSEITCRILEGLKGVLEEFKPDVVLVHGDTTTTLATSL
A0A097QXS7_HAFAL      QVLHLFSIVPDYDLNIMKPGQGLSEITCRILEGLKPVLEEFKPDIVLVHGDTTTTMAASL
D3V6K9_XENBS          QVLHLFDITPDFDLNIMKKGQDLTDITCRILEGMKPVLEEFKPDVVLVHGDTATTMATSL
D3VHX4_XENNA          QVLHLFGITPDFDLNIMQKGQDLTDITCRILQGIKPVLEEFKPDVVLVHGDTTTTMATSL
Q7MYL7_PHOLL          QVLHLFEITPDFDLNIMKSGQDLTDITCRILAGLKPVLAEFKPDVVLVHGDTTTTMATSL
M1S433_MORMO          QVLHLFEITPDYDLNIMRPGQDLTDITCRILEGLKPVLADFKPDVVLVHGDTATTMATSL
K8WW39_9GAMM          QVLKLFEIKPDYDLNIMQPGQDLTDITCRILEGLKSVFADFQPDVVLVHGDTTTTMATSL
B4F1V9_PROMH          QVLNLFEIKPDYDLNIMKPGQDLTDITCRILEGLKPVLASFQPDVVLVHGDTTTTMAASL
C5BBB7_EDWI9          QVLGLFQIEPDYDLNIMRPGQDLSDITCRILEGLKPILAEFRPDVVLVHGDTTTTLAASL
A0A2S5K7H2_9GAMM      QVLHLFQLQPDYDLNIMRPEQGLTEITCRILQGMKTVLADFKPDVVLVHGDTTTTLAASL
U3U0A1_9ENTR          QVLRLFRLQPDYDLNIMRPEQGLTEITSRILQGMKTVLADFQPDVVLVHGDTTTTFAASL
E6WHE6_PANSA          QVLRLFNLQPDYDLNIMRPEQGLTEITCRILQGMKTVLADFRPDVVLVHGDTTTTLAASL
E1SK73_PANVC          QVLRLFKLEPDYDLNIMRPEQGLTEITCRILEGMKTVLLDFRPDIVLVHGDTTTTLAASL
B2VG63_ERWT9          QVLHLFSIVPDYDLNIMQPGQGLTEITSRILAGLKTVFADFTPDVVLVHGDTTTTLAASL
D8MKS3_ERWBE          QVLQLFAIIPDYDLNIMSPGQGLTEITSRILEGLKAVFDEFKPDVVLVHGDTTTTFAASL
H2IWS0_RAHAC          QVLRLFDITPDYDLNIMKPGQGLTEITSRILTGLKPVLDEFRPDIVLVHGDTTTTLSASL
Q2NQB7_SODGM          QVLRLFAIVPDYDLDIMRPAQGLSEITSRILTGMQPVLEDFRPDVVLVHGDTTTTLAASL
W0HNF6_9GAMM          QVLRLFAIVPDYDLDIMRPAQGLGEITSRILTGMQPVLDDFRPDVVLVHGDTTTTLAASL
Q6CZE4_PECAS          QVLHLFDITPDYDLNIMRPGQGLSEISCRILSGLEPVMAEFKPDLVLVHGDTTTTLATSL
G7LUD5_9GAMM          QVLRLFSITPDYDLDIMRPGQSLSEISCRILAGLEPVMAGFKPDLVLVHGDTTTTLTTSL
C6CGI2_DICC1          QVLRLFEITPDYDLNIMQPDQGLVDISSRILSGLGPVLTAFQPDLVLVHGDTTTTLMASL
E0SKQ5_DICD3          QVLRLFEIVPDYDLNVMQPDQGLVEISARILSGLGPVLTQFQPDLMLVHGDTTTTLMTSL
                      *** ** : **:**::*   *.* :*:.:**  :  ::  * **::******:**: :**

Q31UJ8_SHIBS          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADS
B2TU06_SHIB3          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADS
Q329W5_SHIDS          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADS
E3PNX6_ECOH1          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADS
WECB_ECOLI            AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADS
B7MGJ6_ECO45          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADS
V7INY2_SALET          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLRENIPDE
G4C8P1_SALIN          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLRENIPDE
WECB_SALTY            AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLRENIPDE
WECB_SALTI            AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLRENIPDE
B5RFR8_SALG2          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLRENIPDE
D2TH59_CITRI          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLRENIADN
A4WG25_ENT38          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTENSRQNLLCENIADN
A7MQH7_CROS8          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFAPTELSRQNLLRENIPDA
A0A089PGC5_PLUGE      AAFYQRIPIGHVEAGLRTGDLLSPWPEEANRTLTGHLANYHFAPTENSRQNLLTEHLSDS
E3G3Z4_ENTLS          AAFYQRIPVGHVEAGLRTGNLYSPWPEEANRTLTGHLAAWHFAPTTTSRDNLLRENIPEQ
A6TGH4_KLEP7          AAFYQRIPVGHVEAGLRTGDLSSPWPEEGNRTLTGHLATYHFAPTETSRQNLLRENIADS
I2BE80_SHIBC          AAFYQRIPVGHVEAGLRTGDIYSPWPEEGNRLVTGRLAQLHFAPTDISRQNLEKENIPAS
WECB_YERPE            AGFYHRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYHFAPTENSRQNLLREWVPEN
A0A0B6FDC7_YERFR      AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYHFAPTENSRQNLLREMVPDN
A8G833_SERP5          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRKLTGHLAMYHFAPTENSRQNLLRELLPDD
A0A097QXS7_HAFAL      AAFYQRIPVGHVEAGLRTGNLYSPWPEEANRTLTGHMAMFHFAPTETSKQNLIREAISDK
D3V6K9_XENBS          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRKIAGHLAMYHFAPTENSQNNLLKESISEN
D3VHX4_XENNA          AAFYQHIPVGHVEAGLRTGDLYSPWPEEANRKIAGHLAMYHFAPTVTSQNNLLKESIAEN
Q7MYL7_PHOLL          AAFYQRIPVGHIEAGLRTGDLYSPWPEEANRKIAGHLAMYHFAPTENSHNNLLKESIADN
M1S433_MORMO          AAFYQRIPVGHVEAGLRTGNLYSPWPEEANRKIAGHLAMYHFAPTQNSRENLLREGIRDN
K8WW39_9GAMM          AAFYHRIPVGHVEAGLRTGNLYSPWPEEANRKIAGHLAMYHFSPTENSRQNLLKESIPDN
B4F1V9_PROMH          AAFYQQIPVGHVEAGLRTGNLYSPWPEEANRTIAGHLAMYHFAPTETAKLNLVREAVADK
C5BBB7_EDWI9          AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLASLHFAPTLTARANLLREGIGEQ
A0A2S5K7H2_9GAMM      AAFYQQIPVGHVEAGLRTGNLMSPWPEEANRTLTGHLASYHFTPTTTSRQNLLRENLPDA
U3U0A1_9ENTR          AAFYHQIPVGHVEAGLRTGNLMSPWPEEANRTLTGHLASYHFTPTENSRQNLLRENLPDA
E6WHE6_PANSA          AAFYHQIPVGHVEAGLRTGNLMSPWPEEANRTLTGHLATYHFTPTQTSRENLLRENLPDS
E1SK73_PANVC          AAFYQQIPVGHVEAGLRTGDLASPWPEEGNRKLTGHLARLHFTPTTRSRQNLLQENLPDA
B2VG63_ERWT9          AAFYHRIPVGHVEAGLRTGDIWSPWPEEANRTLTGHLASYHFTPTAGSQQNLLRENLPAE
D8MKS3_ERWBE          AAFYHRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLATWHFTPTENARQNLLKENLRSD
H2IWS0_RAHAC          AAFYHQIPVGHVEAGLRTGDLSSPWPEEGNRLLTGHLAKWHFAPTENASANLQRENIAGE
Q2NQB7_SODGM          AAFYQHIPVGHVEAGLRTGDLLSPWPEEANRKLTGHLARWHFAPTENARANLLAEGLPAA
W0HNF6_9GAMM          AAFYQHIPVGHVEAGLRTGDLSSPWPEEANRKLTGHLARWHFAPTDNARANLLAEGLPAA
Q6CZE4_PECAS          AAFYQRIPVGHVEAGLRTGNLYSPWPEEANRKLTGHLAMYHFAPTEHSRQNLLREHLSDR
G7LUD5_9GAMM          AAFYQRIPVGHVEAGLRTGNLYSPWPEEANRRLTGHLAMLHFAPTENSRQNLLREHLSDR
C6CGI2_DICC1          AAFYHHVPVAHVEAGLRTGTLTSPWPEEANRLLTGRLAAYHFAPTTNARRNLRREQVPSS
E0SKQ5_DICD3          AAFYHRIPVAHIEAGLRTGNLASPWPEEANRLLTGRLATYHFAPTITARQNLRREQVPPS
                      *.**:::*:.*:******* : ******.** ::*::*  **:**  :  **  * :   

Q31UJ8_SHIBS          RIFITGNTVIDALLWVRDQVMSSDTLRSELVANYPFIDPNKKMILVTGHRRESFGRGFEE
B2TU06_SHIB3          RIFITGNTVIDALLWVRDQVMSSDTLRSELAANYPFIDPDKKMILVTGHRRESFGRGFEE
Q329W5_SHIDS          RIFITGNTVIDALLWVRDQVMSSDTLRSELAANYPFIDPDKKMILVTGHRRESFGRGFEE
E3PNX6_ECOH1          RIFITGNTVIDALLWVRDQVMSSDTLRSELAANYPFIDPDKKMILVTGHRRESFGRGFEE
WECB_ECOLI            RIFITGNTVIDALLWVRDQVMSSDKLRSELAANYPFIDPDKKMILVTGHRRESFGRGFEE
B7MGJ6_ECO45          RIFITGNTVIDALLWVRDQVMSSDTLRSELAANYPFIDPDKKMILVTGHRRESFGRGFEE
V7INY2_SALET          RIFVTGNTVIDALIWVRDRVLTSDTLQAELAEQYPFLNANKKMILVTGHRRESFGQGFEH
G4C8P1_SALIN          RIFVTGNTVIDALIWVRDRVLASDTLQAELAEQYPFLNVNKKMILVTGHRRESFGQGFEH
WECB_SALTY            RIFVTGNTVIDALIWVRDRVLTSDTLQAELAEQYPFLNANKKMILVTGHRRESFGQGFEH
WECB_SALTI            RIFVTGNTVIDALIWVRDRVLTSDTLQAELAEQYPFLNANKKMILVTGHRRESFGQGFEH
B5RFR8_SALG2          RIFVTGNTVIDALIWVRDRVLTSDTLQAELAEHYPFLNANKKMILVTGHRRESFGQGFEH
D2TH59_CITRI          RIFVTGNTVIDALIWVRDRVLASDTLRTELAVQYPFLNADKKMILVTGHRRESFGRGFEQ
A4WG25_ENT38          KIFVTGNTVIDALIWVRDRVLASETLRADLSERYPFLSPDKKMILVTGHRRESFGRGFEQ
A7MQH7_CROS8          RIFVTGNTVIDALIAVRDRVMADEPLRLRLETQYPFLDGDKKMILVTGHRRESFGEGFEQ
A0A089PGC5_PLUGE      RIVVTGNTVIDALLWVRDSVLSEASLQSEMAARYPFLAGDKKTILVTGHRRESFGAGFEQ
E3G3Z4_ENTLS          RIVVTGNTVIDALFWVRDSVLSEASQRAEMAVRYPFLNNGKKTILVTGHRRESFGSGFEH
A6TGH4_KLEP7          RITVTGNTVIDALFWVRDRVLGDEALRETLLQRYPFISHGKKMILVTGHRRESFGLGFEQ
I2BE80_SHIBC          RIVVTGNTVIDALISIRDRVLGDDALRQELDQRYPFLHNGKRTILVTGHRRESFGEGFEH
WECB_YERPE            RIFVTGNTVIDALFWVRDRVMNTPDLRANLAQRYAFLDTNKKMILVTGHRRESFGGGFER
A0A0B6FDC7_YERFR      RIFVTGNTVIDALFWVRDRVMNNPELRDSLAERYPFIDTNKKMILVTGHRRESFGGGFER
A8G833_SERP5          HIFVTGNTVIDALFWVRDRVMGDAALHDSLAQRYPFLDADKKMILVTGHRRESFGGGFER
A0A097QXS7_HAFAL      NIFVTGNTVIDALIWVRDRVFSDDELRESLDQRYPFLDKNKKMILVTGHRRESFGGGFER
D3V6K9_XENBS          SIFVTGNTVIDALLWVRDRIVSDDALSGQLAKLYPFIDPNKKMILVTGHRRESFGGGFER
D3VHX4_XENNA          RIFVTGNTVIDALLSVRDRIMNDDALYGQLAELYPFIDPNKKLILVTGHRRESFGKGFER
Q7MYL7_PHOLL          RVFVTGNTVIDALLWVRDRIMNDEAMRSKLAKHYPFIDTNKKMILVTGHRRESFGGGFER
M1S433_MORMO          HIFVTGNTVIDALLAVRDRIMQDKALLAQLDAQYPFIDSSKKMILVTGHRRESFGGGFER
K8WW39_9GAMM          HIFVTGNSVIDALLWVRDKVLSDQDMVAKLAAHYPFIDPNKKIILVTGHRRESFGGGFER
B4F1V9_PROMH          NIFVTGNTVIDALFWVSERVMGNQTLLDELAVQYPFIQPERKMILVTGHRRESFGGGFER
C5BBB7_EDWI9          TIHLTGNSVVDALLWVRDRICADTALQAHLAAAYPFLDADKPLLLVTGHRRESFGGGFER
A0A2S5K7H2_9GAMM      RIFVTGNTVIDALLWVRDRVLTNADLNARLAAHYPFLESDKKLILVTGHRRESFGKGFER
U3U0A1_9ENTR          RIFVTGNTVIDALLWVRDRVLHDADLNARLAARYPFLEADKKLILVTGHRRESFGEGFER
E6WHE6_PANSA          RIFVTGNTVIDALLWVRDRVLDDADLNARLMARYPFLDADKKLILVTGHRRESFGDGFER
E1SK73_PANVC          RIVVTGNTVIDALLWVRDRVLDDSNLNAQLAARYPFLDPDKKLVLVTGHRRESFGGGFER
B2VG63_ERWT9          RIFVTGNTVIDALFWVRDRVLSDDGLRNGLVARYPFLSSDKKMILVTGHRRESFGEGFER
D8MKS3_ERWBE          RMFVTGNSVIDALFWVRDRVLGDTGLREGLASRYPFLDSDKKMILVTGHRRESFGGGFER
H2IWS0_RAHAC          RIFVTGNTVIDALLWVRDRFNRDASLAQQLADNYPFLDANKKLILVTGHRRESFGEGFER
Q2NQB7_SODGM          RIAVTGNTVIDALFWVRDRVMSDAALRASLERRYAFLDGVQKMILVTGHRRESFGDGFKR
W0HNF6_9GAMM          RIAVTGNTVIDALFWVRDRVISNAGLRASLDERYAFLDGVQKMILVTGHRRESFGDGFKR
Q6CZE4_PECAS          HIVVTGNTVIDALFWVRDRILGDASLRRSLDEKYAFLDSSKKLILVTGHRRESFGSGFER
G7LUD5_9GAMM          QIFVTGNTVIDALFWVRDCIVNNEDLRRRLDEKYAFLDADKKLILVTGHRRESFGGGFER
C6CGI2_DICC1          RIWVTGNTVIDALFWVRDRITDDKALHAQLQERYRFLDPARKMILVTSHRRESFGEGMER
E0SKQ5_DICD3          RIWVTGNSVIDALFWVRDLIARDAALRDQLQEKYAFLEPERKMILVTSHRRESFGEGMER
                       : :***:*:***: : : .         :   * *:   :  :***.******* *::.

Q31UJ8_SHIBS          ICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAW
B2TU06_SHIB3          ICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAW
Q329W5_SHIDS          ICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAW
E3PNX6_ECOH1          ICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAW
WECB_ECOLI            ICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAW
B7MGJ6_ECO45          ICQALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAW
V7INY2_SALET          ICQALAEIAAANQNVQIVYPVHLNPNVSEPVNRILGHVENVVLIEPQDYLPFVWLMNHAW
G4C8P1_SALIN          ICQALAEIAAANQNVQIVYPVHLNPNVSEPVNRILGHVENVVLIEPQDYLPFVWLMNHAW
WECB_SALTY            ICQALAEIAAANQNVQIVYPVHLNPNVSEPVNRILGHVENVVLIEPQDYLPFVWLMNHAW
WECB_SALTI            ICQALAEIAAANQNVQIVYPVHLNPNVSEPVNRILGHVENVVLIEPQDYLPFVWLMNHAW
B5RFR8_SALG2          ICQALAEIAAANQNVQIVYPVHLNPNVSEPVNRILGHVENVVLIEPQDYLPFVWLMNHAW
D2TH59_CITRI          ICHALAQIAAANQDVQIVYPVHLNPNVSEPVNRILGHVENVMLIEPQDYLPFVWLMNHAW
A4WG25_ENT38          ICHALAEIAAQNSDVQIVYPVHLNPNVSEPVNRILGHIDNIILIEPQDYLPFVWLMNHAW
A7MQH7_CROS8          ICRALADIAAQNRDVQIVYPVHLNPNVTEPVNRILGHIDNIVLIEPQEYLPFVWLMNHAW
A0A089PGC5_PLUGE      ICHALADIAAANADVQIVYPVHMNPQVREPVNRILGHIDNVRLIEPQDYLPFVWLMDQSW
E3G3Z4_ENTLS          ICQALATLATTHPDVQVVYPVHLNPNVSEPVNRILGHVDNVILIEPQDYLPFVWLMNHAW
A6TGH4_KLEP7          ICQALAEIAHTHPEVQIVYPVHLNPNVSEPVNRILGHIDNVMLIEPQDYLPFVWLMDRAW
I2BE80_SHIBC          ICQALATIAAQHDDVQIVYPVHLNPHVSEPVNRILGQVDNIILIEPQDYLPFVWLMNHAY
WECB_YERPE            ICSALAEIARKHPEVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPFVYLMNHAY
A0A0B6FDC7_YERFR      ICSALAEIALKHPEVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPFVYLMNHAY
A8G833_SERP5          ICSALAEIARTHPDVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPFVYLMANAY
A0A097QXS7_HAFAL      ICSALAEIARTHPEVQVVYPVHLNPNVSEPVNRILRGIDNVILIDPQDYLPFVYLMNHAY
D3V6K9_XENBS          ICEALAQVARAHPEVQVVYPVHLNPNVSEPVKRILHDMDNVILINPQDYLPFVYLMNHAY
D3VHX4_XENNA          ICEALAQIARAHPEVQVVYPVHLNPNVCEPVKRILHDIDNVILIKPQDYLPFVYLMNHAY
Q7MYL7_PHOLL          ICEALAQIARAHPDVQVVYPVHLNPNVSEPVKRILHDIDNVILIKPQDYLPFVYLMNHAY
M1S433_MORMO          ICHALAEIATTHPEVQIVYPVHLNPNVSEPVKRILHDISNIVLISPQDYLPFVYLMNHAY
K8WW39_9GAMM          ICHALAEIAQTHPDVQVVYPVHLNPNVSEPVKRILHDISNIILITPQEYLPFVYLMNHAY
B4F1V9_PROMH          ICQALAEIALAHPDVEVVYPVHLNPNVSEPVKRILHGINNIKLIQPQDYLPFVYLMNHAY
C5BBB7_EDWI9          ICGALAQIARSHPQVQVVYPVHLNPNVSEPVNRILRDIENVFLIPPQDYLPFVYLMGRAQ
A0A2S5K7H2_9GAMM      ICSALAQIARLHPQAQIVYPVHLNPNVSEPVNRILSGIDNIILIEPQEYLPFVWLMNRAW
U3U0A1_9ENTR          ICSALAQLARQHPQLQIVYPVHLNPNVSEPVNRILSGINNIILIEPQEYLPFVWLMNRAW
E6WHE6_PANSA          ICSALAQIARQHPQAQIVYPVHLNPNVSEPVNRILSGIDNVMLIEPQEYLPFVWLMNRAW
E1SK73_PANVC          ICSALAQIARQHPEAQIVYPVHLNPNVSEPVNRILSGIENIILIEPQEYLPFVWLMNRAW
B2VG63_ERWT9          ICNALAEIARLHPQAQIVYPVHLNPNVSEPVNRILHGIDNVILIEPQEYLPFVWLMNRAW
D8MKS3_ERWBE          ICSALAEIARLHPDVQIVYPVHLNPNVSEPVNRILSGIDNIFLIEPQEYLPFVWLMVRSW
H2IWS0_RAHAC          ICSALAEIACQHPDVQIVYPVHLNPNVSEPVNRILQSIDNIVLIDPQDYLPFVYLMDKAY
Q2NQB7_SODGM          ICAALARIALDHPDVQVVYPVHLNPNVSEPVNRMLSGIANIKLIDPQDYLPFVYLMDRAT
W0HNF6_9GAMM          ICAALARIALDHPDVQVVYPVHLNPNVSEPVNRMLSGIANIKLIDPQDYLPFVYLMNRAT
Q6CZE4_PECAS          ICGALADIARRHPEVQIVYPVHLNPNVSEPVNRILSDIDNVMLIAPQDYLPFVYLMNRSY
G7LUD5_9GAMM          ICGALADIARRHPEAQIVYPVHLNPNVGEPVNRILSGIGNVMLIAPQDYLPFVYLMNRSY
C6CGI2_DICC1          ICHALAALARHHPDIQIVYPVHRNPNVREPVQRILHGIDNVFLIAPQDYLPFVYLMHRAW
E0SKQ5_DICD3          ICHALAALARHHPDIQIVYPVHRNPNVLEPVQRILSGIDNVFLIAPQDYLPFVYLMNRAW
                      ** *** :*  : : ::***** **:* ***:*:*  : *: ** **:*****:** .: 

Q31UJ8_SHIBS          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLLKDEN
B2TU06_SHIB3          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLLKDEN
Q329W5_SHIDS          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLLKDEN
E3PNX6_ECOH1          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLLKDEN
WECB_ECOLI            LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLLKDEN
B7MGJ6_ECO45          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLLKDEN
V7INY2_SALET          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAITAGTVRLIGTDSRRIVAEVMRLLHDEN
G4C8P1_SALIN          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAITAGTVRLIGTDSRRIVAEVMRLLHDEN
WECB_SALTY            LILTDSGGIQEEAPSLGKPVLVMRETTERPEAITAGTVRLIGTDSRRIVAEVMRLLHDEN
WECB_SALTI            LILTDSGGIQEEAPSLGKPVLVMRETTERPEAITAGTVRLIGTDSRRIVAEVMRLLHDEN
B5RFR8_SALG2          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAITAGTVRLIGTDSRRIVAEVMRLLHDEN
D2TH59_CITRI          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAITAGTVRLVGTDPRRIVEEVTRLLHDEN
A4WG25_ENT38          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAVKAGTVRLVGTDMKRIVDEVTNLLRDEK
A7MQH7_CROS8          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAVEAGTVRLVGTDTQRIVAEVTRLLHDEA
A0A089PGC5_PLUGE      MILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVEAGTVKLVGTDRQRIIDEVTRLLHDDE
E3G3Z4_ENTLS          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAIDAGTVRLVGTDTQRIVDEVTRLLRDDK
A6TGH4_KLEP7          LILTDSGGIQEEAPSLGKPVLVMRDMTERPEAVAAGTVCLVGTDSQRIVAEVTRLLEDDA
I2BE80_SHIBC          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAVSAGTVRLVGTNTGEIVEQVNRLLNDEH
WECB_YERPE            LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVLLVGTNINKIVDAVTRLLTDET
A0A0B6FDC7_YERFR      LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVLLVGTNINKIVDAVTRLLTDET
A8G833_SERP5          MILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVRLVGTDVAKIVDAVTQLLTDED
A0A097QXS7_HAFAL      MILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDAGTVRLVGTDTQDILEQVSRLLTDEE
D3V6K9_XENBS          MILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDAGTVRLVGTKTQTIVEEVTRLLTDDI
D3VHX4_XENNA          MILTDSGGIQEEAPSLGKPVLVMRNTTERPEAIDAGTVRLVGTETQTIVAEVTRLLTDDT
Q7MYL7_PHOLL          MILTDSGGIQEEAPSLGKPVLVMRNTTERPEAVDAGTVRLVGTETKTIVEEVTRLLTDDA
M1S433_MORMO          MILTDSGGIQEEAPSLGKPVLVMRDTTERPEAIDAGTVRLVGTETGTIVREVTRLLTNPA
K8WW39_9GAMM          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDAGTVRLVGTDTQKIVAEVNRLLTDEA
B4F1V9_PROMH          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVEAGSVRLVGTDTKRIVSEVTSLLTDEN
C5BBB7_EDWI9          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAVQAGTVRLVGTDTATIVAQVSLLLENEQ
A0A2S5K7H2_9GAMM      LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVAAGTVKLVGTDVDTIVAEVTLLLQDEE
U3U0A1_9ENTR          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAVAAGTVKLVGTNVNKIVAEVSLLLQDDE
E6WHE6_PANSA          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVAAGTVRLVGTDVDKIVAEVSLLLNNDE
E1SK73_PANVC          LILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDAGTVRLVGTDIARIVASVSELLSDDA
B2VG63_ERWT9          LILTDSGGIQEEAPSLGKPVLVMRDATERPEAVAAGTVRLVGTDGAKIVSEVTRLLTDDE
D8MKS3_ERWBE          LILTDSGGIQEEAPSLGKPVLVMRETTERPEAVAAGTVKLVGTDVQKIVGEATRLLTDED
H2IWS0_RAHAC          LILTDSGGVQEEAPSLGKPVLVMRETTERPEAVDAGTVRLVGTDPAKMVGEVNRLLNDEN
Q2NQB7_SODGM          IILTDSGGIQEEAPSLGRPVLVMRDATERPEAVAAGTVRLVGTDEQAIHQAVSQLLNDSQ
W0HNF6_9GAMM          IILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVAAGTVRLVGTDEQAIHQAVSQLLNDAQ
Q6CZE4_PECAS          MILTDSGGIQEEAPSLGKPVLVMRDTTERPEAIEAGTVKLVGTEVVSIVDAVSMLLTDEG
G7LUD5_9GAMM          LILTDSGGIQEEAPSLGKPVLVMRDATERPEAVEAGTVRLVGTDVVKIVDTVSRLLTDDN
C6CGI2_DICC1          LILTDSGGIQEEAPSLGKPVLVMRETTERPEALAAGTVRLVGTDTATIVREVSRLLADAA
E0SKQ5_DICD3          LILTDSGGIQEEAPSLGKPVLVMRETTERPEALAAGTVRLVGTDTATIIREVSQLLADAD
                      :*******:******** ******: ******: :*:* *:**.   :   .  ** :  

Q31UJ8_SHIBS          EYQTMSRAHNPYGDGQACSRILEALKNNRISL----
B2TU06_SHIB3          EYQTMSRAHNPYGDGQACSRILEALKNNRISL----
Q329W5_SHIDS          EYQTMSRAHNPYGDGQACSRILEALKNNRISL----
E3PNX6_ECOH1          EYQAMSRAHNPYGDGQACSRILEALKNNRISL----
WECB_ECOLI            EYQAMSRAHNPYGDGQACSRILEALKNNRISL----
B7MGJ6_ECO45          EYQAMSRAHNPYGDGQACSRILEALKNNRISL----
V7INY2_SALET          EYQTMSRAHNPYGDGQSCARILQALKSYRVSL----
G4C8P1_SALIN          EYQTMSRAHNPYGDGQSCARILQALKSYRVSL----
WECB_SALTY            EYQTMSRAHNPYGDGQSCARILQALKSYRVSL----
WECB_SALTI            EYQTMSRAHNPYGDGQSCARILQALKSYRVSL----
B5RFR8_SALG2          EYQTMSRAHNPYGDGQSCARILQALKSYRVSL----
D2TH59_CITRI          EYQVMSRAHNPYGDGQACGRILDALKNNRVSL----
A4WG25_ENT38          EYQAMSHAHNPYGDGEACSRILHALKHNRVSL----
A7MQH7_CROS8          AYQAMSHAHNPYGDGQACERILHALKNNRVSL----
A0A089PGC5_PLUGE      AYHAMSRAHNPYGDGQACARILAALKQDQLPR----
E3G3Z4_ENTLS          EYQAMSRAHNPYGDGLACARILSALKNNQVTL----
A6TGH4_KLEP7          AYQAMSRAHNPYGDGEACRRILSALKNNQVTL----
I2BE80_SHIBC          DYQAMSRAHNPYGDGAACSRILAALKKYQVTL----
WECB_YERPE            AYHQMTRAHNPYGDGYACQRILKALKNHQVTL----
A0A0B6FDC7_YERFR      AYHQMSRAHNPYGDGHACQRILEALKNHQVTL----
A8G833_SERP5          EYHAMSRAHNPYGDGHACQRILEALKNHQVTL----
A0A097QXS7_HAFAL      EYHAMSRAHNPYGDGHACQRILEALKNHQVTL----
D3V6K9_XENBS          AYQQMSRAHNPYGDGQACQRILEALRKNQVTL----
D3VHX4_XENNA          AYQQMSHAHNPYGDGQACQRILEALKKNQVTL----
Q7MYL7_PHOLL          AYQRMSRAHNPYGDGDACQRILDALKKIR-------
M1S433_MORMO          AYHEMSRSHNPYGDGKACQRILEALKNNQVTL----
K8WW39_9GAMM          EYHEMSRAHNPYGDGHACQRILDALKSNQVKL----
B4F1V9_PROMH          AYHQMSKATNPYGDGHACQRILEALKNNQVTL----
C5BBB7_EDWI9          QYRAMSHATNPYGDGYACQRILSALKNYRATL----
A0A2S5K7H2_9GAMM      AWQSMSRAHNPYGDGHACARILQALNNNRV------
U3U0A1_9ENTR          AWQAMSRAHNPYGDGHACARILQALKQHRV------
E6WHE6_PANSA          VWQAMSHAHNPYGDGQSCARILQVLKNYRA------
E1SK73_PANVC          AWQAMSHAHNPYGDGKACGRILQALKDNRAEL----
B2VG63_ERWT9          AWQTMSRAHNPYGDGLACQRIVQALKNNWTTL----
D8MKS3_ERWBE          AYQSMSRAHNPYGDGLACERIVQALKNNRVTL----
H2IWS0_RAHAC          EYNSMSRAHNPYGDGHACRHILDALKNHWVSQ----
Q2NQB7_SODGM          AYQRMSRAHNPYGDGHACERIITVLKKDSR------
W0HNF6_9GAMM          AYQRMSRAHNPYGDGHACERIITVLKKDSR------
Q6CZE4_PECAS          AYQAMSRAHNPYGDGQACQRIVDALKNHRK------
G7LUD5_9GAMM          EYQAMSRAHNPYGDGHACRRIIDALKNYQENHRVTL
C6CGI2_DICC1          LYQAMSYAHNPYGDGVASQRILSVLKQHRVTA----
E0SKQ5_DICD3          VYQAMSYAHNPYGDGLASQRILSVLKQHRVTA----
                       :. *: : ****** :. :*: .*.