CLUSTAL format seed alignment for MF_02030

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

C5BSK7_TERTT          ----------MELGYIILAMSFVLAFAAVKLLQPVAEWAQLVDKPGGRKQHQGVIPLVGG
Q21IT6_SACD2          ----------MELGFGILAVAFVTAFVVVKMLKPIAYLVNLVDKPGGRKDHDGVIPLIGG
C7RAP6_KANKD          ----------MHLS---LVLSVIISFSAILVLRPLAVNWGLVDTPDNRKQHSGNIPLIGG
A0KM92_AERHH          ----------MET---SGLVAFVGTALAIACLRPLSAKLQLVDLPNQRKQHVGAIPLIGG
C4LCF3_TOLAT          ----------MEDELETIISSFVFTLMAIKGLKPVADKVGLLDVPNHRKQHKGAVPLIGG
Q07ZA1_SHEFN          -----------MDYLVPFITAFLLCFAAILVFKPIAAKVGLLDLPNERKCHDGAIPLIGG
A3QCT7_SHELP          -----------MEYFIPFVTVFCLTCVAIKLFHPIAEKVGLVDLPNERKTHVGAIPLIGG
E1SUT9_FERBD          ---MGDVTTAISNMVFPVVFAFAASYGLIRLGKPLAIHFGLVDLPGGRKEHKGAIPLIGG
Q483E9_COLP3          -----------MYIIATAVTAFFFAFLAIKFFNPVAIEIGLVDKPCERKQHAGHIPLIGG
F2GBW5_ALTMD          --------MLAYLQFVPLFTAFFVALILLVVMTPLAHQFGLVDQPSARKRHAGIVPLTGG
F5Z4M8_ALTNA          --------MLAYLQFVPLFTAFFVALILLVVMTPLAHQFGLVDQPSARKRHAGIIPLTGG
Q15QT9_PSEA6          --------MLAHLEFFPIFTAFFVAFILLIVMTPMAHHLGLVDEPNQRKHHGDTVPLTGG
WECA_HAEIN            --------------MLSIFVTFLGAFLTLIVMRPLANWIGLVDKPNYRKRHQGTIPLIGG
X2JWQ6_AGGAC          -------------MLLTLIFTFWGAFLTLLVMRPAAIRFGLVDKPNYRKRHQGAVPLIGG
WECA_PASMU            -------------MLLSLIVTFLGAFLTLLFMRPIAQKIGLVDKPNFRKRHQGAIPLIGG
A6VQ65_ACTSZ          ------------MLWLSFVLTFVVSFATIVLGRPVAEKIGLVDKPNYRKRHQGAIPLLGG
Q65U42_MANSM          ------------MLWLSLILTFIVSFLTILVIKPVALKVGLVDKPNYRKRHQGAIPLLGG
F4HCZ9_GALAU          -------------MWLSFVLTFLSSFLALIIMRPLAVKIGLVDKPNYRKRHQGLIPLIGG
A3N2K2_ACTP2          -------------MWLTFLAVFVVSFASLIFMRPVAEKIGLVDKPNFRKRHQGLIPLIGG
A0A248ZWD6_MANHA      -------------MWLTFLTVFIVSFLALIVMRPVAEFVGLVDKPNFRKRHQGLIPLIGG
B8F7H6_HAEPS          -------------MWLTFIAVFLVSFISLIAMRPVAEKIGLVDKPNFRKHHQGVIPLIGG
M4R815_BIBTR          -----------------------------MAMRPVAEKIGLVDKPNFRKRHQGVIPLIGG
C5BBB5_EDWI9          --------MNLLTLSSKFFLIFLFSMAFLLVARRVAKKIGLVDKPNYRKRHQGLIPLVGG
A0A097QXN1_HAFAL      --------MNLLDMSMSLFLIFLFSFAFLFFARKVAKKVGLVDKPNYRKRHQGLIPLVGG
WECA_ECOLI            --------MNLLTVSTDLISIFLFTTLFLFFARKVAKKVGLVDKPNFRKRHQGLIPLVGG
Q329W3_SHIDS          --------MNLLTVSTDLISIFLFTTLFLFFARKVAKKVGLVDKPNFRKRHQGLIPLVGG
A9MJ26_SALAR          --------MNLLTVSTDLISIFLFTTLFLFFARKVAKKIGLVDKPNFRKRHQGLIPLVGG
WECA_SALTY            --------MKLLTALSELISIFLFTTIFIFLARKVAIKIGLVDKPNFRKRHQGVIPLVGG
A6TGH2_KLEP7          -----------------------------------------MDKPNYRKRHQGLIPLVGG
A4WG27_ENT38          --MLRASIVNLLTAVTELISIFLFTTCFLFFARKVAKRIGLVDKPNYRKRHQGLIPLVGG
A0A089QXW0_PLUGE      --------MNLLTASTDLISIFLFTTLFLFCARKVAKRIGLVDKPNFRKRHQGLIPLVGG
I2BE82_SHIBC          -------------MSTDLVLVFAFTLVFLFFARKVAKKIGLVDRPNFRKRHQGVIPLVGG
B2VG61_ERWT9          --------MNLLNMSTELALTFLFSLVFLFFARKAAKKIGLVDKPNYRKRHQGAIPLVGG
D8MKS1_ERWBE          --------MNLLNMSTELALIFVFSMVFLFFARKAAKKVGLVDKPNYRKRHQGVVPLVGG
E6WHE4_PANSA          -------------MSTELGIVFLFSLAFLFFARKVAKKIGLVDTPNSRKRHHGAIPLVGG
E1SK71_PANVC          ------------------------------MLEKQLKKIGLVDKPNSRKRHHGAIPLVGG
WECA_YERPE            --------MNLLTMSTELIYIFLFSMAFLFVARKVAIKIGLVDKPNYRKRHQGLIPLVGG
A8G831_SERP5          -------------MSTEILFVFLFSLAFLFVARKAAKRIGLVDKPNYRKRHQGLIPLVGG
H2IWS2_RAHAC          -------------MSTELGVVFIFSFLFLFVARKVANKIGLVDRPNFRKRHQGLIPLVGG
J7TSU9_MORMO          -------------MLTELLIIFVFATATVFVARKAGVAVGLVDKPNYRKKHQGLVPLVGG
A0A140NPR6_PROSM      --------------------------MFIFIARVVATKIGLVDKPNFRKKHVGLVPLVGG
D3V6L1_XENBS          --------------------------MFLFVARKVAKIIGLVDKPNYRKRHHGLIPLVGG
D3VHX2_XENNA          --------MNISRMSVDIFCVFIFSFVFLFLARKIAKSIGLVDKPNYRKRHHGLVPLVGG
Q7MYL5_PHOLL          --------MNILSMNIEIFYVFLFSFAFLFMARKIAKKVGLVDKPNYRKCHQGLVPLVGG
B4F1V7_PROMH          --------MDILKMSTNVFYVFLFSFAFLFVARKVAKKIGLVDKPNYRKRHHGLIPLVGG
Q6CZE2_PECAS          --------MNLLTMSTELLFIFLFSLGFLFFARSIAGKIGLVDRPNYRKRHRGLVPLVGG
Q2NQB5_SODGM          --------MNILNMSTDFVAIFLFSLLFLFLARKVAKKIGLVDKPNYRKRHQGQIPLVGG
E0SKQ7_DICD3          ------------MMSAQLVAVFLCSFFSLLLARSVARKTGLVDRPNYRKRHHGAVPLVGG
C4K7R1_HAMD5          --------MNLFVFSAHLLSIFFFSLVCLLAARKVAKYIGLVDEPDHRKHHQGAIPLVGG
Q6D7A9_PECAS          MPDAEHLTVDDGAKMQDFIVVFLSAFAALFLARKVATIIGLVDKPCARKKHRGNIPLVGG
A8GC66_SERP5          --------------MQEIVAVFFSALAVLFMARKVARRVGLVDKPNSRKLHQGHIPLVGG
H2IPD8_RAHAC          -------------MYGFLFATPIICFIFLLAVRAISIKLKLVDKPDYRKKHSSNIPLVGG
A8GFV6_SERP5          -------------MLYQLSVIFILALMLVVIARRAALAVGLVDKPNARKRHQGHVPLVGG
Q07ZA0_SHEFN          -----------MSISTSIIFVFCLSFISLFVFRKLAKRVGLVDKPNERKHHVGQIPLVGG
A3QCT6_SHELP          -------------MSFYLIFAFFSSFILLLVCRKLAKRIGLVDKPNERKLHVGQVPLIGG
Q5E8H1_ALIF1          -------------MINAYLFVFLVSFISLFIMRKVAKRIGLVDKPNERKHHKGVIPLIGG
Q6LNS5_PHOPR          -------------MINAFIFVFITSFCSLFVFRKVAKYVGLVDKPNARKHHQGVVPLVGG
F0LP69_VIBFN          -------------MFLELTFIFFSAFAILFLLRKVAKKIGLVDKPNARKLHQGAVPLVGG
A1ST24_PSYIN          ----------MLFYFSVLIFAFVASFSAIKVLKPLAVKLGLTDKPNARKNHRGEIPLVGG
A1WV72_HALHL          ----------MTQVVLQILFAFALTAVLLLVLRRPALKAGLVDRPCGRKRHGRVVPLIGG
Q83E04_COXBU          -----------MELIKSGLIAFVASLFCIWLLRPLAIRIGFVDRPNDRKWHEREVPMIGG
                                                                * *  ** *   :*: **

C5BSK7_TERTT          LAIYASILLTTFLF----IEQPIEIRLFLLAGGLIVFMGMVDDRYELSARFRLVGQFLIS
Q21IT6_SACD2          LAIYTSVCITTFLF----IEQPIFIRLFLLAGGLIVFMGMVDDRYQLSARFRLAGQFLIA
C7RAP6_KANKD          LAIYLSTLSTVSLH----LDNK-HINLILISISLMVFIGALDDRYDLNAKLRLIAQILIA
A0KM92_AERHH          IAVCLGVYLSVFFT----LPLQNAIITMLACAGCMMVIGAIDDAKDISPWIRLTLQALLI
C4LCF3_TOLAT          VSIFIGVAISALLF----MSLDAQQKVLLAASLVIVVMGVFDDLYDLSVRLRLGIQAVCT
Q07ZA1_SHEFN          IAIFSSVLFASSLF----IQNSQTLNLYLISSSLILFIGVLDDRYDLSVRLRLVAQVITA
A3QCT7_SHELP          VAIYCSVLLVSSIV----FEQNQVFNLYLISAALILFLGVLDDKYDLSVRVRIVAQVITA
E1SUT9_FERBD          IAIFLSVLTSSLLF----FPASETLRMYLLSAILMLFIGVLDDKYDLKVSYRLFAQAFAA
Q483E9_COLP3          ISIFLAVLAASLLW----LPNTLELRMYLIASAMMVFIGALDDKFDLRVRVRIVGQIIIA
F2GBW5_ALTMD          VAIFMAVLVASVAT----DVWMKNNPLFFTASAFIVLLGMLDDRFDLSAKGRLMCQFGVA
F5Z4M8_ALTNA          VAIFMAVLVASVAT----DVWMKNNPLFFTASAFVVLLGMLDDRFDLSAKGRLMCQFGVA
Q15QT9_PSEA6          VAIFMAVLIASFVT----DVWLKNGAQFFTAAAFIVLLGMLDDRFDLSPKGRLLCQFAVA
WECA_HAEIN            ASLFVGNLCYYLME----WDQLRLPYLYLFSIFVLLAIGILDDRFDISPFLRAGIQAILA
X2JWQ6_AGGAC          ISLFMGNLCFYLMQ----WDQTRLPYLYLFSILVLLLMGIIDDRYDISPFLRAGIQAFLA
WECA_PASMU            VSLFVGNLCFYLLE----WEQMRLPTLYLFSIFVLLVIGMIDDRFDISPFLRAGIQAILA
A6VQ65_ACTSZ          ISLFMGNLCFYLMQ----WEQTRLPYLYLFSVTVLLIIGLLDDRFDLSAALRACVQAALS
Q65U42_MANSM          ISLFMGNLCFYLLQ----WDSTRLPYLYLFCVLVLLVIGLLDDRFDISAALRAGIQAVLA
F4HCZ9_GALAU          IALFISNACYYFLE----WNEMRLPYLYLSCVTVLLIVGVLDDRFDLSPFLRAIVQAILA
A3N2K2_ACTP2          IALFLGNLTFYFME----WQDMRLPWLYLAAVTILLVIGVLDDRFDVSPFLRASIQAGLA
A0A248ZWD6_MANHA      IALFIGNLTFYFMQ----WQDMRLPELYLTAVTILLIIGVLDDRFDISPLLRAGIQAALA
B8F7H6_HAEPS          IALYLGNLAFYLLE----WEQMRLPELYLIALTILLMIGVLDDRFDLSPFLRASIQTVLA
M4R815_BIBTR          IALYLGNLAFYLLE----WQQMRLPELYLSALTILLVIGVLDDRFDISPFLRAGIQALLA
C5BBB5_EDWI9          ISVYAGICFTFLFF----KPYIPHATLYLICAGILVLVGALDDRFDISVKFRATVQALIA
A0A097QXN1_HAFAL      ISVYAGICFTFLFF----QPYIPHAKLYLICAGILVFVGALDDRFDISVKFRATVQALIA
WECA_ECOLI            ISVYAGICFTFGIV----DYYIPHASLYLACAGVLVFIGALDDRFDISVKIRATIQAAVG
Q329W3_SHIDS          ISVYAGICFTFGIV----DYYIPHASLYLACAGMLVFIGALDDRFDISVKIRATIQAAVG
A9MJ26_SALAR          ISVYAGICFTFGIV----DHYIPHASLYLSCAGVLVLIGALDDRFDISVKIRATIQAAIG
WECA_SALTY            ISVFAGICFMFGLS----DYYIPHLSLYLICAGVLVFVGAMDDRFDISVKIRAVVQAVIA
A6TGH2_KLEP7          ISVYAGICFTFAIA----DYYIPHASLYLACAGVLVLVGALDDRFDISVKIRAVIQAAIA
A4WG27_ENT38          ISVYAGICFTFGIA----DYYIPHAALYLACAGVLVLVGALDDRFDISVKFRASVQAAIG
A0A089QXW0_PLUGE      LSVYAGICFSFAIA----NYYIPHAALFLSCAGVLVLVGMLDDKYDISVKIRATVQALIS
I2BE82_SHIBC          ISVYVGICFTFVISWVNSSYYIPHARLYLLCAGLLVLIGALDDRYDISVKIRAAVQALVA
B2VG61_ERWT9          ISVFAGSCFAFTLT----DFYIPHIGLYMGCAGCLVMVGALDDRYDISVKFRAVVQAAVA
D8MKS1_ERWBE          ISVFAGTCFGFAIT----NFYIPHALLYLCCAGMLVLIGALDDRWDISVKIRAIVQAIVA
E6WHE4_PANSA          ISVYAGICFAFIIS----NYYLPHALLYLGCAGLLVLVGALDDRFDISVKIRAAVQALVA
E1SK71_PANVC          ISVFAGICFTFAIT----NYYLPHALLYLGCAGVLVLVGALDDRFDISVKIRAVVQAIVA
WECA_YERPE            ISVFAGVCFAFLIT----NQQIPHFRLYLACAGLLVFVGALDDRFDISVKIRAFVQALVG
A8G831_SERP5          ISVYAGLCFAFLIS----DQTIAHGKLYLACAGILVFVGALDDRFDISVKIRALVQALVG
H2IWS2_RAHAC          ISVFAGVCFAFLIT----NYTIPHGNLYLACAGLLVLVGALDDRFDISVKTRAMVQVVIA
J7TSU9_MORMO          ISIFISVCFAFLIS----DEFIAHKFIYLGCAGALVLVGALDDRFDLSVKLRAGVQAVVA
A0A140NPR6_PROSM      ITVFFGICFAFVIT----EEYIPHKWLYLICAGLLVLIGALDDRFDISVKLRAGVQAVVA
D3V6L1_XENBS          ISVFFGVFFAFAIT----KEFIPHKWLYLACAGILVFIGALDDRFDISVKIRAAIQALVG
D3VHX2_XENNA          ISIFFGVCFAFSIT----KEFMPHKSLYLTCAGVLVFVGMLDDRFDISVKIRATIQALVG
Q7MYL5_PHOLL          ISIFVGICFAFVIT----KEFIPHKWLYLVCAGVLVFVGALDDRFDISVKVRATIQALVG
B4F1V7_PROMH          ISVYFGIVFAFYVS----DIYIPHKELYLICAGILVFIGALDDRYDISVKIRATIQALVG
Q6CZE2_PECAS          ISVYAGICFTYFIT----DQYIPNFRLYLMCAGVLVFVGMLDDRFDISVKIRAVVQAFVA
Q2NQB5_SODGM          ISIYAGICFAFLYT----DHYIPHVALYLMCAGVLVVTGALDDRFDISVVARAIIQALVA
E0SKQ7_DICD3          ISVYIGVCLLPVLI----SEPIPHFPIYLMCAGMLVLIGALDDRFDISIGVRAAVQAAVA
C4K7R1_HAMD5          ISVYAGICFALLTA----DQFIPHAGVYLACAGLLVFVGVLDDRFNISVKIRLFIQFLVS
Q6D7A9_PECAS          VSIYCALCILFILH----SDWLPDFSLYMVCATLLLVIGVIDDRFDLPVLPRFAVQTMVG
A8GC66_SERP5          VSVYLSLWILYLMQ----PAWLPDFTLYMVCATLLLAIGVLDDRYDLPVWPRVALQAAIA
H2IPD8_RAHAC          IAIYLTVVVINLLF----FPSVAHNNAFLMSSFLLVCIGVLDDRYALSVFLRVIVQAAGA
A8GFV6_SERP5          IAIYLIMTLVTFWQ----PDWLPHSTTYLLCVTALVMLGVLDDRFDLPVAPRVIVQGGIA
Q07ZA0_SHEFN          ISIYCTLMIALFVL----FPITNNLLLYVACSTVLIVLGALDDRYDLSFKLRLVVQAGIS
A3QCT6_SHELP          ISIFTAIMLNICLV----FDVTSNVMLYMVCSTVLIVLGALDDRFDLSFKARLGVQAAIS
Q5E8H1_ALIF1          ISIFTTLCIGLLLF----LPVTETLLMYLACAAVLVVLGAFDDYFDVSFKIRLIVQTGIS
Q6LNS5_PHOPR          VSIFFTLAITFLLF----TTIDSGLVLFLICATILVVMGVIDDRYDISFKIRLVIQAGVS
F0LP69_VIBFN          ISTCIVLSQFLTFR----PDIIQYSELFVLSIATLTFVGALDDKFDLSVKVRIAIQAALS
A1ST24_PSYIN          ISVYIGLFCSGFLLLIV-EPVNIDLLTYLFASLLMVVTGALDDRFDLSVRIRILAQVLIA
A1WV72_HALHL          VCILLGFVAASLPA----DFGLRDYQGLFAGMAVLLIVGVVDDLIDIDAWIKFGAQVVAA
Q83E04_COXBU          IAMFFSFCFALLTL----STSLLPYRGMLAGSSILVLMGVVDDFSDLSSKLRLFGQLFAA
                                                  .     :   * .**   :    :   *    

C5BSK7_TERTT          CIFVYALEVHFHSFGDLFGI-GELNPGWLGYPLAVLSIMAAINAMNMMDGMDGLVGSIAM
Q21IT6_SACD2          CIFVYGLDVHIESFGDLLGI-GELNPGWLGYPLAVLSLMGVVNAMNMLDGMDGLVGSIAM
C7RAP6_KANKD          SILTFGTDIQISSFGDLFGF-GEIYTGPLSGLVTVLAIVAGINAFNMTDGIDGLAGTLAL
A0KM92_AERHH          LILCLSTNISLHQFGDVLGI-GNITIPFIDLLIAVVAVCAAINAYNMMDGIDGLAGCMAG
C4LCF3_TOLAT          LILCFSLHVSLAHLGYMLGF-INLNIGVAGYVLAIFAVIGGINAYNMMDGIDGLAGSMAL
Q07ZA1_SHEFN          SILIFGAGFYLTTLGNIFYF-FEFKLGYIGVLVTVIAVIGSINAFNMVDGIDGLAGMLSL
A3QCT7_SHELP          SILVFGAGFYLTSLGHITYF-FELKLGYVGVFVTILAVIGAINAFNMVDGIDGLAGMLSL
E1SUT9_FERBD          SLMIFGAGEYLKDFGNLLGF-GVIDLGWFGPVITLIAVIGAINAFNMVDGIDGLAGMLSI
Q483E9_COLP3          SLMIYGVGGYISNLGNLFGF-GDVTLGPVGIVFTYVGIIVVINAYNMIDGIDGLIGSLSI
F2GBW5_ALTMD          AIMAWSAQNYITSLGNIFGT-GEVVLDLGGYFFTIICVVGVINAFNMIDGIDGLAGGMSL
F5Z4M8_ALTNA          SIMAWSAQNYVTSLGNIFGS-GDIALNIGGYFFTVICVVGVINAFNMIDGIDGLAGGMSL
Q15QT9_PSEA6          AIMAWSAQNHISSVGDILGT-GSSDLGMFGYFFTLICVVGVINAFNMIDGIDGLAGGMSL
WECA_HAEIN            ILMIDLGNIYLDHLGQILGP-FQLTLGSIGLIITVFATIAIINAFNMIDGIDGLLGGLSC
X2JWQ6_AGGAC          ILMIDMGNVYLDHLGQILGP-FQLTLGSIGLIITVLATIGIINAFNMIDGIDGLLGGLSC
WECA_PASMU            ILMIDLGNLYLDHLGQILGP-FQLTLGSIGLIITVLATIAAINAFNMIDGIDGLLGGLSS
A6VQ65_ACTSZ          VAMIYFGQLSLDNLGQIIGP-FQVTLGGVGFVITVLATIAVINAFNMIDGIDGLLGGLSG
Q65U42_MANSM          VLMIYVGHLSLEHLGQIIGP-FQVTLGPIGFVITVFATIAVINAFNMIDGIDGLLGGLSS
F4HCZ9_GALAU          LSMIYIGDLSLNNLGEIIGP-FQITLGTAGIVITVFATIAIVNAFNMIDGIDGLLGGLSS
A3N2K2_ACTP2          GLMIYNG-LSLDSLGQVIAP-FSIELGILGIIFTVFVTIGVINAFNMVDGIDGLLAGLSS
A0A248ZWD6_MANHA      GAMIYSG-LSLSSLGQIIAP-FSIELGWLGIVFTVFITIGVINAFNMVDGIDGLLAGLSS
B8F7H6_HAEPS          GAMIYSG-LSIENLGQLIAP-FSLEIGVLGVVLTVFITISVINAFNMIDGIDGLLAGLSS
M4R815_BIBTR          GAMIYSG-LSIENLGQLIAP-FSLEIGALGIVLTVFITIGVINAFNMIDGIDGLLAGLSS
C5BBB5_EDWI9          IAMMVAGGLYLRSLGFVLGP-WELILGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSC
A0A097QXN1_HAFAL      VAMMVYGGLYLMTLGHVLGP-WELNLGPFGYVVTLFAVWAAINAFNMVDGIDGLLGGLSC
WECA_ECOLI            IVMMVFGKLYLSSLGYIFGS-WEMVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSC
Q329W3_SHIDS          IVMMVFGNLYLSSLGYIFGS-WEMVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSC
A9MJ26_SALAR          IIMMVFGKLYLSSLGYIFGS-WEMVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSS
WECA_SALTY            VVMMVIAKLHLGSLGYIFGP-WELVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSS
A6TGH2_KLEP7          VIMMMAGNLHLSSLGFIFGS-WELVLGPFGFFLTLFAVWAAINAFNMVDGIDGLLGGLSS
A4WG27_ENT38          IIMMVAGKLYLSSLGYIFGT-WEMVLGPFGFFLTLFAVWAAINAFNMVDGIDGLLGGLSS
A0A089QXW0_PLUGE      VVMMLAGNLYLSSLGYIFGS-WELVLGPFGYFLTLFSVWAAINAFNMVDGIDGLLGGLSC
I2BE82_SHIBC          IVMMGVGGLYLNSLGYVFGS-WEFYLGPFGYVLTLFAVWAAINAFNMVDGIDGLLGGLSC
B2VG61_ERWT9          VVMMMKAKIYLLSLGYIFGP-WELIVGPFGYVLTLFAVWAAINAFNMVDGIDGLLGGLSC
D8MKS1_ERWBE          VLMMSMGKLYLLSLGYIFGP-WELIVGPFGYVLTLFAVWAAINAFNMVDGIDGLLGGLSC
E6WHE4_PANSA          VVMMAGAKLYLLSLGFIIGP-VELIVGPFGYVLTLFAVWAAINAFNMVDGIDGLLGGLSC
E1SK71_PANVC          LVMMFGAKLYLLSLGFIVGP-FELIVGPFGYVLTLFAVWAAINAFNMVDGIDGLLGGLSS
WECA_YERPE            IAMMAVAGLYLRSLGHAFGP-WEMVLGPFGYVVTLFAVWAAINAFNMVDGIDGLLGGLSC
A8G831_SERP5          IAMMVFAGLYLRSLGHVLGD-WEMLLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSC
H2IWS2_RAHAC          VVMMSFANLTLRSLGHLMGP-WEMVLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSC
J7TSU9_MORMO          IIMMVFANLKIDSLGHAFGP-WELTLGPFSYVLTLFAVWGAVNAFNMVDGIDGLLGGLSC
A0A140NPR6_PROSM      VVMMTVADLKLESLGHAFGP-WELVLGPFGYIVTLFAVWAAINAFNMVDGIDGLLGGLSC
D3V6L1_XENBS          ISMMYFADLKIESLGSAFGS-WEMTLGPFSYVVTLFAVWAAINAFNMVDGIDGLLGGLSS
D3VHX2_XENNA          VSMMYFADLKIESLGDIFGS-WEMILGPFSYIVTLFAVWASINAFNMMDGIDGLLGGLSC
Q7MYL5_PHOLL          IAMMYFAGLKLDSLGYAFGP-WDMTLGPFSYVVTLFAVWAAINAFNMVDGIDGLLGGLSC
B4F1V7_PROMH          IAMMVFGGLKLESLGHAFGP-WDMHLGPFGYIVTLFAVWAAINAFNMVDGIDGLLGGLSC
Q6CZE2_PECAS          VVMMALAGLTIHNLGHIFGP-WQMGLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSS
Q2NQB5_SODGM          VAMMVFSGRYINSLGYIFGP-WEMVLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSC
E0SKQ7_DICD3          ILMMALAGILLQRLGYILGPLWDIGLGPVRYLMTLFVVWTAINAFNMVDGIDGLLGGLSC
C4K7R1_HAMD5          VFIMCFAGLHLNNLGFIFGF-RELGLGPFSYIITLLSVCAAINAFNMIDGIDGLLGGLSC
Q6D7A9_PECAS          GLMM-YSGLYLSSLGNVLFG-HELLLGGFGYVITLFAVCGAINAFNMIDGIDGLLGSLSC
A8GC66_SERP5          VLMI-CNGLYLKSFGEIFFG-HELFLGIGGTVITVLAIWGAINAFNMVDGVDGLLGALSC
H2IPD8_RAHAC          IIIM-SDGVYISSFGNLWNN-YELRLGILSFPVSLLAVWASVNAFNMIDGIDGLLGGLSI
A8GFV6_SERP5          LAMMLAAGMQLSSLGFLWGH-QELLLGYAALLITPLAVWGAINAYNMVDGIDGQLGALSC
Q07ZA0_SHEFN          LAMILIGYKSLHYLGAMFSDSALVIPTYISYIVTIFAVIGAINAFNMVDGIDGLLGGLAS
A3QCT6_SHELP          MAMILIGYKSLYYLGFIAGDKALILPTFVSYVVTIFAVIGAINAFNMVDGIDGLLGGLAL
Q5E8H1_ALIF1          LVIIFAGGHSLHNLGFLMGSETIMLSSAVSGFITILGVIGAINAFNMVDGIDGLLGGLAS
Q6LNS5_PHOPR          LAMILIGDKSLHSLGYLMGSEAIELSPIASAMITIFAVIGAINAFNMVDGIDGLLGGLAS
F0LP69_VIBFN          ITMMEVTGIELNNLGNLFGVGDIYLG-WFGIIVTVFAVIGAINAFNMVDGIDGLLGGLSI
A1ST24_PSYIN          SIMMFVADRVLFNLGDLLSI-GEISLGYFAYPFTVLAVLGAINAYNMIDGIDGLIGGVSF
A1WV72_HALHL          LLMTVWSGLVVEDLGQLLGPHVALELGALAVPFTVFCVVGLINAVNMFDGVDGLAAGTVA
Q83E04_COXBU          LLMIIWGNVVLSNLGNLFFLG-DLKIGLWAIPITVIVVLANINAMNMIDGQDGLAGGVAL
                        :       .  .*                 .: .     :** ** ** **  .    

C5BSK7_TERTT          VSFIGLVALFGANGNTTFQYLCMAFIGSTGAFLIFNLWGAR--KPKRIGKIFMGDSGSMF
Q21IT6_SACD2          VSFIGLIGLFGAAGHTTFQYLCLAFTGAIAAFLIFNLWGS---PTKNFRKVFMGDAGSMF
C7RAP6_KANKD          IS---LLAISFVISDVSIELLIGALTASLIVFLLFNLGLF-----SKKNKIFMGDAGSMM
A0KM92_AERHH          ISLVGLSILFASSMPDM-TQICLIITIALVPYLIVNLNI-----PPFKRKIFLGDAGSMF
C4LCF3_TOLAT          VSLTALIILFAAAGATVYMNWALIFAVAIVPYLFANLKL-----FGFKRKIFMGDAGSML
Q07ZA1_SHEFN          VTFTSLSVLFYRAGNDWFL-LPLLFDAAILAYLFFNLRWP----FVSVQKIFMGDAGSML
A3QCT7_SHELP          VTFTSLALLFYTAGNHWFI-LPLLFIGAIIGYLIFNLRWP----FETVQKIFMGDAGSML
E1SUT9_FERBD          ISFSAIAVLMAMANNPWFM-LPLLYIAAIGAYLMFNLGWP----KGKLRKIFMGDAGSMV
Q483E9_COLP3          NTFTSIAILFIMSGQTNYLSYPLILATATVPYLMYNLGFFEKFFNKECKKIFMGDAGSMF
F2GBW5_ALTMD          VILLTVAGFLTFTGHGTSVMEPLIIVAAIVPFLAFNLSWK----GFKGNKIFMGDAGSMF
F5Z4M8_ALTNA          VILLTLAGFLTATGNGAAIMEPLIIVAAIVPFLAFNLSWK----GFKGNKIFMGDAGSMF
Q15QT9_PSEA6          VVLSGVVFLLIFSNNSSAIMGPMLIIAAIVPFLAFNLSWK----GFKGNKIFMGDSGSMF
WECA_HAEIN            VSFAAIGILMYRDGQMDMAHWSFALIVSILPYLMLNLGIP----FGPKYKVFMGDAGSTL
X2JWQ6_AGGAC          VSFAAIGILMYRDGQMDLAYWSFGLIIAILPYLLMNLGIP----LGPKFKVFMGDAGSTL
WECA_PASMU            VAFVSIGILLIKDNQLDLAYWSFALIIAILPYFMMNLGIP----FGQKFKVFMGDAGSTL
A6VQ65_ACTSZ          VGFAAMGILLILDNQWDLAIWCFALIVTLIPYSMFNLCIP----FGRKYKIFMGDSGSTL
Q65U42_MANSM          VSFAAIGILMLMDNQFDLAVWCFALIIALIPYVMFNLTI-----FGKERKIFMGDSGSTL
F4HCZ9_GALAU          VSFAAIGILLVLDGQIDLAAWCFALILCLIPYILFNMSV-----FGVKNKVFMGDSGSTL
A3N2K2_ACTP2          ASFAGIGVLMWLDEQYTLAYWCFAIIVVLIPYAMFNLSV-----FGAKWKVFMGDSGSTL
A0A248ZWD6_MANHA      VSFAGLGTLMFINGEPSLGYWCFALIFVLLPYAMFNLSL-----FGAKWKVFMGDSGSML
B8F7H6_HAEPS          VSFAGLGTLMLLDEQYTLAYWCFGIILVLLPYAMFNLSV-----FGAKWKVFMGDSGSTL
M4R815_BIBTR          VSFAGLGTLMYLDGQYNIAGWCLAIILVLLPYALFNLSL-----FGARWKVFMGDSGSTL
C5BBB5_EDWI9          VTFAAMGILLQWDGQPDLALWCFAIIAATLPYILLNLGV-----VGPRFKVFMGDAGSTL
A0A097QXN1_HAFAL      VTFGAMGILLFQDHQGDLALWCFAIIAAILPYIVLNLGL-----LGRRYKVFMGDAGSTL
WECA_ECOLI            VSFAAIGMILWFDGQTSLAIWCFAMIAAILPYIMLNLGI-----LGRRYKVFMGDAGSTL
Q329W3_SHIDS          VSFAAIGMILWFDGQTSLAIWCFAMIAAILPYIMLNLGI-----LGRRYKVFMGDAGSTL
A9MJ26_SALAR          VSFAAMGLILWFDGQTSLAIWCFAMIAAILPYIMLNLGI-----LGRRYKVFMGDAGSTL
WECA_SALTY            VSFAAMGLILWFDGQTSLAMWCFAMIAAILPYIMLNLGI-----LGRRYKVFMGDAGSTL
A6TGH2_KLEP7          VSFAATGIILWFDGQYSLAMWCFAMIAAILPYILLNLGA-----LGRRYKVFMGDAGSTM
A4WG27_ENT38          VSFAAIGIILWFDGQYSLSMWCFAMIAAILPYILLNLGV-----LGRRYKVFMGDAGSTL
A0A089QXW0_PLUGE      VSFAAIGIILLFDGQTSLAMWCFAMIAAIIPYIMLNLGF-----LGRRYKVFMGDAGSTF
I2BE82_SHIBC          VSFAALGFILFFDGQISLAMWCFAMIAAILPYIMLNLGI-----LGRRYKVFMGDAGSTF
B2VG61_ERWT9          VTFLAMGTILLFDGQHSLAMWCFIMIAAIIPYIFLNLGL-----LGRRYKVFMGDAGSTL
D8MKS1_ERWBE          VTFLAMGIILLLDGQQSLAMWCFIMIVAIVPYILLNLGV-----FGRRYKVFMGDAGSTL
E6WHE4_PANSA          VTFGAMGIILYFDGQTSLAMWCFAMIAATIPYILLNLGF-----LGRRYKVFMGDAGSTM
E1SK71_PANVC          VTFAAMGIILYFDGQTSLAMWCFAMIAATLPYILLNLGF-----LGRRFKVFMGDAGSTM
WECA_YERPE            VSFGAMGILLYQSGQMSLALWCFAMIATIIPYILLNLGL-----LGRRYKVFMGDAGSTL
A8G831_SERP5          VSFGALGVLLYLSGHSDLAFWCFAMIAAIVPYILLNLGI-----LGRRYKVFMGDAGSTL
H2IWS2_RAHAC          VSFGSLGIIMYDSGHMELAFWCFAMIAAIIPYILLNLGV-----LGPRYKVFMGDAGSTL
J7TSU9_MORMO          VSFGALGILFALSGNSGLAFWCFTFIAAILPYICFNLGL-----FGRRFKVFMGDAGSTL
A0A140NPR6_PROSM      VSFGALGFLLYQNGNYGLAFWCFAFIAAILPYIFLNLGV-----LGRRFKVFMGDAGSTL
D3V6L1_XENBS          VSFGALGILLYVNGNTALAFWCFAFIAGILPYIFLNLGL-----LGKRFKVFMGDAGSTL
D3VHX2_XENNA          VSFGALGILLYENGNTALAFWCFTFIAGILPYIFLNLGL-----LGRRFKVFMGDAGSTL
Q7MYL5_PHOLL          VSFGALGILLYQSGNTALALWCFAFIAAILPYIVLNLGL-----LSQRFKVFMGDAGSTL
B4F1V7_PROMH          VSFGALGILLYQSGSSALAFWCFSFIAAILPYIMLNLGV-----CGKKFKVFMGDAGSTL
Q6CZE2_PECAS          VSFGAMGILLYLSGHTNLALWCFAMIAATLPYILLNLGM-----FGRRYKVFMGDAGSTM
Q2NQB5_SODGM          VSLGAMGILLTLDNNPGLALWCFAMIAAILPYILLNLGG-----FGRRYKVFMGDAGSTM
E0SKQ7_DICD3          VLFAGLGILLYHHGSFALALWSFAMIAAILPYILLNLEL-----MGRRYKVFMGDAGSTM
C4K7R1_HAMD5          VSFLAIGFLLYQKSEMALALWCFSIIVAITPYVLLNLGL-----LGEKYKIFMGDAGSTL
Q6D7A9_PECAS          IAFCSLFFLFYSGGERQLGLWSLCMMAATLPYLFLNLGIP----LGKKFKVFMGDAGSTV
A8GC66_SERP5          VTFCALTVVFYIHGNTDMALWCLCLMVSCLPYLLLNLGVI----WGRKFKVFMGDAGSTL
H2IPD8_RAHAC          LSFTGLAICFAVAGQMHMALYCQLFIAAIVPFILLNVSC-------SRLKIFMGDAGSTF
A8GFV6_SERP5          VTFMALAILFGLAGHEAQALWCLSLIAALVAYLLFNLSVF-----GARNKIFMGDAGSMV
Q07ZA0_SHEFN          VTFSALGLMFYLAGKDYLALYCMLFVGAMLPYIMLNLGFP----FGRRFKVFMGDAGSMF
A3QCT6_SHELP          VTFGALGYMFYGAGQIELAHFCLLLMVAMLPYIMLNLGFP----FGRRFKVFMGDAGSMF
Q5E8H1_ALIF1          VTFAALATVFYYSGNDYLAHVCGLIVIAMVPYIMLNLGFP----LGRRFKVFMGDAGSMF
Q6LNS5_PHOPR          VTFGALGYLFLIDGNIELAMVCGLLVTAMIPYILLNLGFP----LGRRFKVFMGDAGSIF
F0LP69_VIBFN          VTFGAIAILLNVDSQHGLAYLCVVIITALLPYIFMNLGI-----LGRERKVFMGDAGSMM
A1ST24_PSYIN          ATFVPLTIIFYMAGDIEVAFFCLLCVVVLAPYLLHNLQLT----RFSSKKIFMGDAGSMF
A1WV72_HALHL          AALGWLVLAGAVNGGASWLVLAGLFLASVCAFLIFNMRNP----WRRKAACFLGDSGSMM
Q83E04_COXBU          GQALLLLLVSVKLHQVSDFRLLFILIILLIAFLGFNMRLL----WRKEASIFMGDSGSTF
                                                     :   *:              *:**:** .

C5BSK7_TERTT          MGLSLGVLLIYGSQGES---------AAFSPVTALWFVLLPITDMFTIMYRRVKRGRSPM
Q21IT6_SACD2          LGLSLGVLLIEGSQQPT---------AAFSPVTALWFVLLPMTDMFTIMYRRIKRGRSPM
C7RAP6_KANKD          LGLVVSWLLIVTSQSEQ---------AIVAPAHVLWFIAIPLIDMIAVMFRRLRKGKSPL
A0KM92_AERHH          LGFIIGYLVLFGSQHHELE-------PAFRPVTALWLIGLPLMDMVGIMIRRIRKGQSPL
C4LCF3_TOLAT          LGFVIVWLLILGTQQQE---------KYFRTVTALWIIAIPLMDMAAIMIRRIRKGNSPF
Q07ZA1_SHEFN          IGLTVVWLLVLGTQSYNVHLGGRSSNIVFSPVTALYLIAIPLMDMTAIMYRRIRKGFSPF
A3QCT7_SHELP          IGLTVVWLLVLGVEA---------DARVFAPVTALYLIGIPLMDMAAIMYRRVKKGMSPF
E1SUT9_FERBD          IGLTIVWLLVLGSQG---------ESRAFSPVIALWVIAIPLMDMAAIMYRRKKKGQSPF
Q483E9_COLP3          VGLSVIWLLTMATQG---------EQASFRPVTALWICAIPLMDMLAIVVRRYKNGKSPF
F2GBW5_ALTMD          VGLTIVWLLVDHTQG---------ETAAFRPITAVWLVGLPLMDMAAIMYRRARKGQSML
F5Z4M8_ALTNA          VGLTIVWLLVDHTQG---------DSAAFRPITAVWLVGLPLMDMAAIMYRRARKGQSML
Q15QT9_PSEA6          VGLTIVWLMVDYTQG---------SSPAMRPITAVWIIGLPLMDMAAIMYRRARKGQSML
WECA_HAEIN            IGFTIIWILLLSTQGKG---------HPMNPVTALWIIAIPLIDMVAIIYRRVRKGKSPF
X2JWQ6_AGGAC          IGFTIIWILLLSTQGKG---------HPMNPVTALWVIAIPLVDMVAIIYRRLRKGKSPF
WECA_PASMU            IGFTIIWILLLSTQGKG---------HPMNPVTALWIIAIPLIDMIAIMYRRLRKGKSPF
A6VQ65_ACTSZ          IGFTMIWILLLSTQGKG---------HPMNPVTALWIIAIPLIDMIAVIYRRVRKGKSPF
Q65U42_MANSM          IGFTMIWILLLSTQGKG---------HPMNPVTALWVIAIPIIDMIAVIYRRLRKGKSPF
F4HCZ9_GALAU          IGFTMIWILLLSTQGHG---------HPIKPITALWLIAIPLIDMICVVIRRLKKKKSPF
A3N2K2_ACTP2          IGFTIIWILLLSTQGQG---------HTISPITGLWLIAVPLIDMVAVIIRRLKKGKSPF
A0A248ZWD6_MANHA      IGFTIIWILLLSTQGQG---------SPISPITGLWLIAVPLIDMVAVIIRRLKKGKSPF
B8F7H6_HAEPS          IGFTIIWILLLSTQGQR---------HPISLITGLWLIAVPLIDMVAVFFRRLKKGKSPF
M4R815_BIBTR          IGFTIIWILLLSTQGQG---------HPISPITGLWLIAVPLIDMVAVFFRRLKKGKSPF
C5BBB5_EDWI9          IGFTVIWILLESTQGRG---------HPMNPVTALWVIAIPLMDMIAIMYRRLRKGMSPF
A0A097QXN1_HAFAL      IGFTVICILLQSTQGKS---------HPMNPVTALWMIAIPLMDMIAIMYRRLRKGMSPF
WECA_ECOLI            IGFTVIWILLETTQGKT---------HPISPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
Q329W3_SHIDS          IGFTVIWILLETTQGKT---------HPISPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
A9MJ26_SALAR          IGFTVIWILLETTQGKT---------HPISPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
WECA_SALTY            IGFTVIWLLLETTQGKT---------HSISPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
A6TGH2_KLEP7          IGFTIIWILLETTQGKT---------HPISPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
A4WG27_ENT38          IGFTVIWILLETTQGKT---------HPISPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
A0A089QXW0_PLUGE      IGFTVIWILMETTQGKT---------HPISPVTALWLIAIPLMDMVAIMYRRLRKGMSPF
I2BE82_SHIBC          IGFTLIWILMETTQGQT---------HPLSPVTALWIIAIPLMDMIAIMYRRLRKGQSPF
B2VG61_ERWT9          IGFTIIWILLETTQGQS---------HPITPVTALWLIAIPLMDMVAIMYRRLSKGMSPF
D8MKS1_ERWBE          IGFTIIWILLEATQGQY---------HPITPVTALWLIAIPLMDMVAIMYRRLSKGMSPF
E6WHE4_PANSA          IGFTIIWILLETTQGLS---------HPITPVTALWLIAIPLMDMVAIMYRRLRKGMSPF
E1SK71_PANVC          IGFTIIWILLETTQGLS---------HPITPVTALWLIAIPLMDMVAIMYRRLRKGMSPF
WECA_YERPE            IGFTAIWILLQATQGNA---------HPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPF
A8G831_SERP5          IGFTAIWLLVQSSQGKA---------HSINPVTALWIIAIPLMDMIAIMYRRLRKGMSPF
H2IWS2_RAHAC          IGFTVIWILLQSTQGES---------HPMNPVTALWLIAIPLMDMVAIMYRRLRKGMSPF
J7TSU9_MORMO          IGFTIIWLLTSASQGGEP--------HAINAVTALWIIAIPLMDMVAIMYRRLRKGMSPF
A0A140NPR6_PROSM      IGFTIIWILVESTQEAG---------RPINPVTALWIIAIPLMDMVAIMYRRIRKGMSPF
D3V6L1_XENBS          IGFTIIWLLTETTQGEH---------SSINPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
D3VHX2_XENNA          IGFTIIWLLTEVTQGEN---------RSINPVTALWIIAIPLMDMVAIMYRRLRKGMSPF
Q7MYL5_PHOLL          IGFTIIWLLIESTQGNE---------RPVNPVTALWIVAIPLMDMVAIMYRRLRKGMSPF
B4F1V7_PROMH          IGFTIIWLLISSTQVDP---------HPINAVTALWIIAIPLMDMVAIMYRRLRKGMSPF
Q6CZE2_PECAS          IGFTAIWLLIQTTQGPQ---------HPINPVTALWIIAIPLIDMIAIMYRRLRKGMSPF
Q2NQB5_SODGM          IGFTIIWLLLQSTQGWG---------HPMNPVTALWIIAVPLMDMIAIMYRRMRKGMSPF
E0SKQ7_DICD3          IGFTAIWLLLQSSQGAD---------NAIRPVAALWVIAIPLMDMVAIVYRRLRKGTGLF
C4K7R1_HAMD5          IGFTIIWLLLQTTQGSG---------HPIRPVTVLWTTAVPLIDMIAITYRRLRKGMNPL
Q6D7A9_PECAS          IGFTVLWLLVLASQGET---------AVMHPVTALWLIALPLIDMIAIMLRRFLRGDSPF
A8GC66_SERP5          IGFTVIWVLILGSQGEN---------RAMQPVTALWLIAIPLMDMVRVMISRIRCGNNPF
H2IPD8_RAHAC          LGFTVIWAIMLATGEYN---------AVMTPATAIWLIAVPLMDLVAVMFGRLIRRNSPF
A8GFV6_SERP5          IGFSVLWLLIVATQGAD---------AVIRPVTALWLIAIPLMDMVTVMVRRLMRRQSPF
Q07ZA0_SHEFN          IGFTAIWLLIEASQGENV--------LVIRPVTALWFIALPLMDMVCIMTRRLKKGQSPF
A3QCT6_SHELP          IGFTVIWLLIEASQDQQE--------AVIRPVTALWFIGLPLMDMVCIMSRRIKKGQSPF
Q5E8H1_ALIF1          IGFTVVWMLIRGSQEPAV--------IAFKPVTALWLIAIPLMDMATIMIRRVRKGQSPF
Q6LNS5_PHOPR          IGFTVIWLLIEATQGVNS--------TPIRPVTALWVIALPLMDMATIMVRRIRKGQSPF
F0LP69_VIBFN          IGFTVIWLLLGASQTGRE--------PLMRPVTALWLIAVPLMDMAAIMIRRVRRGDSPF
A1ST24_PSYIN          IGFTVIWLLAIGSQGDSSG-----SEPYFSPVVAVWFIALPLMDMTAIIIRRIKKGNSPF
A1WV72_HALHL          LGFALAWFAVEAAQGDH---------ALLPPVAIAWILALPVLDTLTLMGRRILRGRHPF
Q83E04_COXBU          IAFLLAWFAIDLSQQNS---------ALIKPMTILWIMAFPLFDLINVIVLRVRQKKSII
                      :.:                         .      :   .*: *   :   *       :

C5BSK7_TERTT          APDRTHIHHIILRAGFNAKQTLYIMLCVQGLFVVVGAVLHV-YKAPDWFSFLGAIALVVF
Q21IT6_SACD2          APDRTHIHHIIIRAGFSRKQALYIVLVLQSIFVVTGVLLH--NSTYEWRSFTLVVTFVIG
C7RAP6_KANKD          VADREHLHHVFMDIGLNSRQALLFISSISLVFGLIGFLIIS-YQLPEYITVISFIVTFII
A0KM92_AERHH          RPDRNHLHHILLHAGFTPRESLLLIVVANLGVVFFGILAEQA-KLPEWLMMTLYLLLFAA
C4LCF3_TOLAT          KPDRNHLHHIFLRAGLNSRQALMVIVAAALLFTSFGLAGEFW-QVPEWIMLAGFLGLFAG
Q07ZA1_SHEFN          KPDRDHLHHIFERAGYNRKQTLVRITLLSLLLALCGMAGEFY-QVPEWVMFSLFIVLFVS
A3QCT7_SHELP          KPDRDHLHHIFERAGYSRKQTLVRISLASIVLAALGVSGEWM-LVPEWIMFLGFVAIFVA
E1SUT9_FERBD          KPDRDHLHHICMRAGLTPRGALGWISGIAISVASIGVCAYLI-NVPDFLLLLIFVMMFLG
Q483E9_COLP3          KPDRDHLHHIVQRAGLSSKQALVAISSAAAAMSVIGLAGEYF-SIPDVIMLTGFIVTFAC
F2GBW5_ALTMD          KPDRQHLHNIFMRAGLSSRKSLVAILCLGACYCLIGILGEVY-QVPEAVMFWGFMGLLVI
F5Z4M8_ALTNA          RPDRQHLHNIFMRAGLSSRQSLIAILCMGACYCVIGILGELY-LVPEYVMFWGFICLLVL
Q15QT9_PSEA6          RPDRQHLHNIFMRAGLSSRRALAAILLLGCGYAAIGILGEMF-NVAESVMFGSFILLLFV
WECA_HAEIN            RPDRLHVHHLMVRAGLTSRQAFLLITFVSAVCATIGILGEVY-YVNEWAMFVGFFILFFL
X2JWQ6_AGGAC          RPDRLHVHHLMVRAGLTSRQAFLLITFVAALCAGFGILGEIY-YINEWVMFIAFIILFFL
WECA_PASMU            RPDRLHVHHLMMRAGLTSRQAFLLITFAAAICATIGILGEIF-YINEWLMFAGFILLFFM
A6VQ65_ACTSZ          KPDRLHVHHLMVRAGLTSRQAFLVITLFAALCAGFGILGEVY-YLNEWFMFGAFIVLFFL
Q65U42_MANSM          KPDRLHVHHLMVRAGLTSRQALLVITFFAALCAGFGILGEVY-YINEWIMFILFIVLFFL
F4HCZ9_GALAU          RPDRLHVHHLMVRAGLTSRQAFAVITLMAAVCAGFGILGEIY-YINEWLMFFGFIVLIFL
A3N2K2_ACTP2          RPDRLHLHHLMMRAGLTSRQALAVITFGAAICSTIGVLGEYY-YWNQWLMTIGFIGLFFI
A0A248ZWD6_MANHA      KPDRLHLHHLMMRAGLTSRQALLVITLWAGFCSTIGVLGEVY-YWNQWVMMLMFIGLFFL
B8F7H6_HAEPS          RPDRLHIHHLMMRAGLTSHQALAVITFGAGLCATFGVIGEVY-YWNQWVMFVAFVFLFFL
M4R815_BIBTR          RPDRLHIHHLMMRAGLSSRQALAVITFGSALCAAFGVLGEVY-YWNQWVMFLSFVSLFFL
C5BBB5_EDWI9          SPDRQHIHHLIMRAGFTSRQAFVLITLAAVLLAAIGVLGEI--WLPEYAMMALFLLAFAL
A0A097QXN1_HAFAL      SPDRQHIHHLIMRAGFTSRQAFALITVAAALLAGIGILGEKLPFMPEWGMLALFLLAFFM
WECA_ECOLI            SPDRQHIHHLIMRAGFTSRQAFVLITLAAALLASIGVLAEYSHFVPEWVMLVLFLLAFFL
Q329W3_SHIDS          SPDRQHIHHLIMRAGFTSRQAFVLITLAAALLASIGVLAEYSHFVPEWVMLVLFLLAFFL
A9MJ26_SALAR          SPDRQHIHHLIMRAGFTSRQAFVLITLAAAILAGIGVTAEYSHFVPEWVMLVLFLLAFFL
WECA_SALTY            SPDRQHIHHLVMRAGFTSRQAFVLITLAAAILAGVGVTAEYSHFVPEWVMLVLFLLAFFL
A6TGH2_KLEP7          SPDRQHIHHLIMRAGFTSRQAFVLITLAAALLALVGVVAEYTRIVPEWVMLILFLVAFFL
A4WG27_ENT38          SPDRQHIHHLIMRAGFTSRQAFVLITLAAALLAGIGVAAEYAHFIPEWVMLALFLLAFFL
A0A089QXW0_PLUGE      SPDRQHIHHLIMRAGFTSRQAFLLITLAAALLAGIGVLGEYTHILPEWGMLILFLLAFFL
I2BE82_SHIBC          TADRQHIHHLIMRAGFTSRQAFVLITLAAAILASIGVLSEYYTIFPEWMMLVLFLLAFLL
B2VG61_ERWT9          SADRQHIHHLIMRAGFTSRQAFVLITAAAALLALIGGIGEYLTFVPEWVMLVLFLLAFML
D8MKS1_ERWBE          SADRQHIHHLIMRAGFTSRQACFLITLAAALLAAVGVLGESLSFIPDWAMLVLFLMAFML
E6WHE4_PANSA          SADRQHIHHLIMRAGFTSRQAFLLITVAAAILAGIGVLGEYLAFIPEWVMLLLFLVAFLF
E1SK71_PANVC          SADRQHIHHLIMRAGFTSRQAFVLITVAAAILAGIGVLGEYLAFIPEWVMLLLFLGAFMV
WECA_YERPE            SPDRQHIHHLIMRAGFTSRQAFVLITLAAALLAMIGVIGERLTFIPEWVMLALFLLAFLL
A8G831_SERP5          SPDRQHIHHLIMRAGFTPRQAFVLITLAAALLAAIGVLGERLTFIPEWVMLALFLLAFFL
H2IWS2_RAHAC          SADRQHIHHLIMRAGFTSRQAFVLITVAAAILAGIGVVGEHLSFVPEWIMLALFFVAFLV
J7TSU9_MORMO          SPDRQHIHHLIMRSGFTSRESFVVITLAAAVLAAIGIAGQVLSFVPEWVMLALFLLAFIM
A0A140NPR6_PROSM      SPDRQHIHHLIMRSGFSPRGAFVLITLAAAILACIGIIGERLTFVPEWVMLALFLLVFFM
D3V6L1_XENBS          SPDRQHIHHLIMRAGFTSRQAFILITVAAALLASIGIIGEHLSFVPEWVMLALFLLAFML
D3VHX2_XENNA          SPDRQHIHHLIMRAGFTSRQAFMLITLAAALLASIGIIGERLSFVPEWVMLALFLLAFML
Q7MYL5_PHOLL          SPDRQHIHHLVMRSGFSSRQAFILITVAATLLAAVGITGEWLEFVPEWIMLALFLLAFVL
B4F1V7_PROMH          SPDRQHIHHLIMRAGFTPRQAFVLITLAAAVLAAIGIIGENLSFVPEWVMLALFLLAFVM
Q6CZE2_PECAS          SPDRQHIHHLMMRAGFSSRQAFLLITLAAALLAAVGVLGEYFFFIPEWVMLALFLLAFLL
Q2NQB5_SODGM          APDRQHIHHLIMRAGFSSRQAFIIITLTAALLAFFGVAGERWLRWPESVMLLLWIGVFLL
E0SKQ7_DICD3          SPDRQHIHHLLMRAGLTSRQACLLITLAAVLLAAVGIAGEWL-AVPEYVMLALFLLAFGG
C4K7R1_HAMD5          FPDRQHLHHLMMRSGFTSQQTLTLIIFFAALCALIGIIGEF--FIPEWIMFALFLCMFFV
Q6D7A9_PECAS          KADRGHLHHILMSSGLTSRQSLMVITFAALLLAAVGIISDRN-NVSQSMMLSLFFVTFIG
A8GC66_SERP5          KPDRQHLHHILMRAGSSARGTVMIMAFLATLLATVGIVGEML-HIAEFFSLLLFMCVFVF
H2IPD8_RAHAC          QPDRTHLHHVLINYGFSNKKTLSIILLVSFGMNVFGIGLNIL-KVNELLSLFLFCLIFVT
A8GFV6_SERP5          KAGRDHLHHILMRRGLNARQALGMSCMLAVTLACVGICSEVL-QTPDHLMLLAFVFCFFG
Q07ZA0_SHEFN          KPDREHLHHICQRIGLSSSLSLLVICLLASIMAGVGILSELY-NVSESIMFFSFLVTFAI
A3QCT6_SHELP          KPDREHLHHICQRVGMSPRMSLLVICLIATLMAVVGVWSEYL-EISETVMFVAFLLVFAL
Q5E8H1_ALIF1          KPDREHLHHICQRLGLSSYMTLFLICTVALICAFFGIWADLN-GVSESVMFFSFLALFGV
Q6LNS5_PHOPR          KPDREHLHHICQRIGLSSHMSLFVICLCASIMASIGIWSDVA-QINETVMFVSFLAVFAV
F0LP69_VIBFN          KPDREHLHHIFQRLGLTPKQTLAMICLIAVGFAAFGIYGEAA-RISEATMFYTFIACFMI
A1ST24_PSYIN          AADRDHLHHLFMRAGFTPRQTLIFITCLALMLSMIGVFTTLY-SIPDWIQLVAFITLFGI
A1WV72_HALHL          HPDREHLHHIFYRAGFTPGQTVTVLVLASLALGSIGVVGTWL-GVPEWVLAALFVPVAAA
Q83E04_COXBU          VASRDHFHHVLHVAGLNTSLSTLLLCALSLLLGIFGLALNYF-TVSDGWQFILWVGALFC
                       ..* *.*::    * .   :              *          :             

C5BSK7_TERTT          YQLLMKRSWRFIRWSKRRIFTAA----------------
Q21IT6_SACD2          YQLFMRRAWLFVRWSKKRFA-------------------
C7RAP6_KANKD          YNKLLSLRHKFKLPK------------------------
A0KM92_AERHH          YSLCLAYAWKLGRWLKGIKTPLTDANRAKRN--------
C4LCF3_TOLAT          YYYSLHRIWKIVRWVKAKIYR------------------
Q07ZA1_SHEFN          YNWALAHVWQIITWLKRSD--------------------
A3QCT7_SHELP          YNWALSHIWQILTWLRKA---------------------
E1SUT9_FERBD          YSYAIQNIWKLVTWVRSSKTQ------------------
Q483E9_COLP3          YVMVIRRITKFEKVQ------------------------
F2GBW5_ALTMD          YSLVIQHIWSVLRFVKRLTS-------------------
F5Z4M8_ALTNA          YSIVIQNIWSVLRFIKKR---------------------
Q15QT9_PSEA6          YSFVIQNIWTILRFVRDRNTN------------------
WECA_HAEIN            YVYSITHAWRITRWVRRMKRRAKRLKKA-----------
X2JWQ6_AGGAC          YSYSITRAWKITRWIRRMKRRAARRSKIK----------
WECA_PASMU            YSYSITRAWRITRWIRRMRRRAKRIHNKG----------
A6VQ65_ACTSZ          YLYSITRAWRVTRFIRRMKRRASRRIER-----------
Q65U42_MANSM          YLYSITKAWKVTRLIRRMKRRAQRRKHS-----------
F4HCZ9_GALAU          YGYSITRAWRVTRFIRRIQRRWRKAKGLVSKK-------
A3N2K2_ACTP2          YAYSITHAWRVTRFIRRMKRRAKRKLKIGSE--------
A0A248ZWD6_MANHA      YAYSITHAWRVTRFVRRLKRRAKRSKQL-----------
B8F7H6_HAEPS          YSYSIVQAWRITRFVRRHKRRARRKQTV-----------
M4R815_BIBTR          YSYSIVHAWRITRFVRRHKRRARKKQLI-----------
C5BBB5_EDWI9          YGYCIKRAWRVARMVKRFKRRLRRKSTGIHV--------
A0A097QXN1_HAFAL      YGYCIKRAWRVARYIKRMKRRLRNAAQRKKA--------
WECA_ECOLI            YGYCIKRAWKVARFIKRVKRRLRRNRGGSPNLTK-----
Q329W3_SHIDS          YGYCIKRAWKVARFIKRVKRRLRRNRGGSPNLTK-----
A9MJ26_SALAR          YGYCIKRAWKVARFIKRVKRRLRRHRENRPNLTK-----
WECA_SALTY            YGYCIKRAWKVARFIKRVKRRLRRQRENRPNLTK-----
A6TGH2_KLEP7          YGYCIKRAWKVARLVKRIRRRIRRHSGNNPKLTK-----
A4WG27_ENT38          YGYCIKRAWKVARFIKRVKRRMRKNSGKNQTLTK-----
A0A089QXW0_PLUGE      YGYCIKRAWKVARFIKRVKRRMRRNSDRSPT--------
I2BE82_SHIBC          YGYCIKRAWKVARFIKRVKRRLRRGHNKNPGLTK-----
B2VG61_ERWT9          YGYCIKRAWRVARMIKRLKRRLRNSSNGKKSSADR----
D8MKS1_ERWBE          YGYCIKRAWRVARMIKRFKRRLRQTQ-------------
E6WHE4_PANSA          YGYCLKHAWRVARKVRRIKRRWQSAGDDKK---------
E1SK71_PANVC          YGYCLKHAWRVARRVRRIKRRLSHHREAKNK--------
WECA_YERPE            YGYCIKRAWRVARFIKRFKRRMRRASKNKHES-------
A8G831_SERP5          YGYCIKRAWRVARYIKRIKRRLRRSNGNKQVS-------
H2IWS2_RAHAC          YGICIKHAWRMARFIKRVKRRLRRSSTQ-----------
J7TSU9_MORMO          YGYCIKRAWKVARFIKRHRRRVRRKSVTH----------
A0A140NPR6_PROSM      YGYCIKRAWKVARFIKRVRRRMRRGGAVR----------
D3V6L1_XENBS          YGYCIKRAWRVARFIKRCKRRMRRAVSHH----------
D3VHX2_XENNA          YGYCIKRAWRVARFIKRLKRRMRREASHH----------
Q7MYL5_PHOLL          YGYCLKRVWKVARFIKRQKRRMRRSANH-----------
B4F1V7_PROMH          YGYCIKRAWRVARFIKRYKRRLRKATQLKH---------
Q6CZE2_PECAS          YGYCLKRAWRVARFIKRIKRRMRHSDEQKQSS-------
Q2NQB5_SODGM          YGYVLKCAWRVARFVKRTKRRLSQYKKSTTLNGNSGRK-
E0SKQ7_DICD3          YGYCIKRAWRVARAVRRILRYWRSRRYCE----------
C4K7R1_HAMD5          YGYSVKNAWRLSRLIKRINKASKIKK-------------
Q6D7A9_PECAS          YFYFIPRIGKVLQLGRRTHSDRLVAKLSNRTAQRR----
A8GC66_SERP5          YCL-------VIKILSQTRGSQIYLK-------------
H2IPD8_RAHAC          YCLVRHWLVIHTKYSEVSPGDESHNKTIEISVQ------
A8GFV6_SERP5          YFALLREPRQASIFTDNPTADR-----------------
Q07ZA0_SHEFN          YFSVIANIWRITAFLHKYFRFTLPSHN------------
A3QCT6_SHELP          YYLAISYVWRITAFMHRWFKFTRAT--------------
Q5E8H1_ALIF1          YFMTISYIWRITTFVHKLFGKRMSVQLQAEISK------
Q6LNS5_PHOPR          YFWVISHIWKITTWVHKLFGKTGPIQLNLNESEAGK---
F0LP69_VIBFN          YSVLLSYVWRLTAFLRRVKSERSEEVIASK---------
A1ST24_PSYIN          FQTSLAYIWVLLKTFRKIMALKRLAKFKKIRKKLKADRY
A1WV72_HALHL          HLLAQARAWRFARLMRRQLRWARSRLRG-----------
Q83E04_COXBU          YIYIVELTRKPIIDNEIDIIANPEG--------------
                      .