CLUSTAL format seed alignment for MF_02035

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q1AY71_RUBXD      ------------MDTKSSAALK--------------------------------ETI--S
B1MFR9_MYCA9      ---------------MSR------------------------------------DEL--A
V5XJG6_MYCNE      ---------------MSTP-----------------------------------DLL--A
I4BQG8_MYCCN      ---------------MTSH-----------------------------------EVL--A
A0PVD7_MYCUA      ---------------MTSR-----------------------------------ERL--A
EGTB_MYCS2        ---------------MIAR-----------------------------------ETL--A
EGTB_MYCT3        ------------MTGVAVPHR---------------------------------AEL--A
EGTB_MYCTU        ---------------MTSP-----------------------------------EQL--A
T2GP64_MYCHT      ---------------MTSP-----------------------------------EAI--A
D6Y5F6_THEBD      -----------MTEHGTIPTAP-TGPAEPGALK---------------------EAI--A
E3IYP6_FRAIE      ------------MAGSAVPAHPGPTTAEPATADEGTDLSGGLAAGGSHPAPVPAGPAGWA
Q2J4D4_FRACC      MRLTRLTRSPASLASPAAPADRETAADQDAKPIREAKPITA-------------DTV--A
A8L8S3_FRASN      ------MRSGALTGDPTTTRDPAGPTAAPALDA---------------------EAL--A
J7L9P0_NOCAA      ---------------MSVERER---------VK---------------------ERI--A
D7AY99_NOCDD      ---------------MNHEQER---------AK---------------------ERI--A
C7QH02_CATAD      ---------------MTVPIDDTGSAAGAAGLT---------------------ELI--A
Q9RD00_STRCO      ---------------MTDPTDA-PATTTAEALR---------------------ERA--L
H2JW49_STRHJ      ------------MTAPETDIETQTAETDAEALR---------------------ERA--L
G2NRS0_STREK      -------------MTDHAPGLPHGPELDAEALR---------------------ERA--L
G2P4L0_STRV4      ---------------MTAPDSDLAIDPEALRRR---------------------AEL---
C1A342_RHOE4      ---------------MTGEITK--------------------------------EAV--E
F6EPS9_HOYSD      ---------------MTTEELR--------------------------------TDI--A
Q5YQ03_NOCFA      ------------MTKSFAPSDH----SATDRLR---------------------ERI--A
A4X6R5_SALTO      ---------------MTETTDR----PDGVGLR---------------------EHI--A
D9TEQ4_MICAI      --------------MTTTERLR--------------------------------DRI--A
G8S2S8_ACTS5      ---------------MINPDK---------------------------------NLI--A
I0HEE8_ACTM4      ---------------MTQDLR---------------------------------LTI--A
                                                                              

Q1AY71_RUBXD      RELEEARERTRWLI-SPLSEEQLTAQHDPIMSPLIWDYGHIGNYEELWLLNRAFGRSL--
B1MFR9_MYCA9      RDLEAARMRTLTIT--DHDDAELHRQYDPLMSPLVWDLAHIGQQEELWLLRGGDPRRPGM
V5XJG6_MYCNE      AELTRARDRTLALV--DFDDAELVRQYDPLMSPLVWDLAHIGQQEEFWLLRGGNSAAPGM
I4BQG8_MYCCN      TELTRARDRTLRLV--DFDDAEVRRQYDPLMSPLVWDLAHIGQQEEFWLLRGGDPTRPGL
A0PVD7_MYCUA      EDLDRVRTQTLRLV--DFDDAELRRQYDPLMSPLVWDLAHIGQQEELWLLREGDPDRPGM
EGTB_MYCS2        DELALARERTLRLV--EFDDAELHRQYNPLMSPLVWDLAHIGQQEELWLLRDGNPDRPGM
EGTB_MYCT3        RQLIDARNRTLRLV--DFDDAELRRQYDPLMSPLVWDLAHIGQQEELWLLRGGDPRRPGL
EGTB_MYCTU        CHLARARARTLRLV--DFDDAELCCQYDPLMSPLVWDLAHIGQQEELWLLRGGDPGQPGL
T2GP64_MYCHT      DQLARTRARTLRLV--DFDDDELRRQYDPLMSPLVWDLAHIGQQEELWLLRGGDPARPGM
D6Y5F6_THEBD      AELAAARERSLAYT--DADDDLLVRQHSPLMSPLVWDLAHVGNYEELWVLRAAAGITP--
E3IYP6_FRAIE      EALERSRRRTLTYT--DLDDDLLIRQHSPLMSPLVWDLAHIGNYEELWLLRALTGADP--
Q2J4D4_FRACC      DALRTARQRSLTYT--DIAAEDLLRQHSPLMSPLVWDLAHVGNYEDLWLVRALAGGTG--
A8L8S3_FRASN      AGLAAARDRSLAYT--DLTEDDLLRQHSPLMSPLVWDLAHIGNYEEIWLLRALTGAAE--
J7L9P0_NOCAA      AELDRSRRRSNGLTLESLDEEDLLAQHSPLMSPLVWDLAHIGNYEEQWLLRAAGGREA--
D7AY99_NOCDD      AELDRARDRSNGLTLHALDEGELLAQHSPLMSPLVWDLAHVGNYEEQWLLRAAGGREA--
C7QH02_CATAD      RSLERARDRTHGLT-GPVEEPDLIRQHSPLMSPLVWDLAHIGNQEELWLLRNLGGREP--
Q9RD00_STRCO      TTLVTARERTTLLT-SCVEGPDLTAQVSPLMSPLVWDLAHIGNQEEQWLLRAVAGQEA--
H2JW49_STRHJ      ASLTTARDRTTLLT-SCVDEPDLTAQHSPLMSPLVWDLAHIGNQEELWLLRAVGGREA--
G2NRS0_STREK      TALVTARARTALLT-DSVDDHDLTAQHSPLMSPLVWDLAHIGNQEELWLLRAVGGLEA--
G2P4L0_STRV4      -ALRTARDRTHALT-TCVDEPDLTAQHSPLMSPLVWDLAHIGNQEEQWLLRAVGGRDA--
C1A342_RHOE4      AVLLRARERSTLLT-DCVDDTELIAQHSPLMSPLVWDLAHIGNQEELWLVRDVGGRDP--
F6EPS9_HOYSD      MVLDRARTRTSLLT-EAVSDDELCAQHSPLMSPLVWDLAHIGNQEELWLVRDLGGREP--
Q5YQ03_NOCFA      EVLTTARARTTALT-AAVGEADLVAQHSPLMSPLVWDLAHIGNQEELWLVRDVGGREP--
A4X6R5_SALTO      TELARARSRTEVLT-DAVDDADLVRQHSPLMSPLVWDLAHVGNQEELWLVRDVGGREP--
D9TEQ4_MICAI      AELERTRARTALLT-DAVDDDDLVRQHSTLMSPLVWDLAHVGNQEELWLVRDVGGRDP--
G8S2S8_ACTS5      AELERSRARTALLT-DAVDDDDLVAQHSPLMSPLVWDLAHVGNQEELWLVRDVGGREP--
I0HEE8_ACTM4      AELERARARTAALT-DAVDETDLIRQHSPLMSPLVWDLAHVGNQEELWLVRDVGGRDP--
                    *   * .:            :  * ..:****:** .*:*: *: *::.         

Q1AY71_RUBXD      ADRELYDIYDASITPRSERPSLNMLGRADADRYLDAVRRAALEELRKADL--------GG
B1MFR9_MYCA9      LPGEIESLYDAFRHTRASRVQLPLLSPAQARAFCHEVRGRVLDRLEALPS--------DG
V5XJG6_MYCNE      LTPAVEKLYDAFEHSRASRVGLPLLPPTDARTYCRDVRNRVLETLEHSTE----------
I4BQG8_MYCCN      LSPQVNELYDAFVHSRASRVDLPLLPPTDARAYCETVRGKTLDALGALPD--------G-
A0PVD7_MYCUA      LPRAVEGLYDAFVHNRASRVELPLLSPAQAHSYCRTLRGAVLDALDALDG--------Q-
EGTB_MYCS2        LAPEVDRLYDAFEHSRASRVNLPLLPPSDARAYCATVRAKALDTLDTLPE--------D-
EGTB_MYCT3        LEPAVEQLYDAFVHPRASRVHLPLLSPAQARRFCATVRSAVLDALDRLPE--------D-
EGTB_MYCTU        LPPAVEGLYDAFEHSRASRVELPLLSPARARSYCATVRSAALDALAALPE--------D-
T2GP64_MYCHT      LPPAVEGLYDAFVHSRASRVDLPLLSPDQARAYCRTVRSAVLDTLDALPD--------DP
D6Y5F6_THEBD      LRPEIDDMYNAFKHPRRERPSLPLLGPDEARRYLATVRSRVLDVLDRFDP--------RD
E3IYP6_FRAIE      LLPGIDDLYDAFRHPRADRPALPLLPPDQARGYIADVRSRVLDAMAALDSRSVDSRPAGW
Q2J4D4_FRACC      TRPGLDDIYDAFRHSRASRSRLALLGPAETRAYLHEVRGRTLDLLDRFGPDRFGPMAGAG
A8L8S3_FRASN      LRPGLDDVYDAFRHSRASRTALPLLGPDEARAYLRDVRGRAMDVLTGLDPDLLHAPETAG
J7L9P0_NOCAA      LRPDIDGLYDAFENPRADRVALPLLRPDEAREYNERVRREVLDTLEGADLSARPPDPAGG
D7AY99_NOCDD      LRPDIDTLYDAFENPRAERVSLPLLRPEEARDYNARVRREVLDALESADLTRVETGP-DG
C7QH02_CATAD      MRPEIDPLYDAFEHPRAARPTLPLLPPDEARRYVHEVRGRVLDMLEQPRW--------G-
Q9RD00_STRCO      IRPEIDSLYDAFEHPRSERPSLPLLSPAEARRYASDVRGRALDVLEATAF--------D-
H2JW49_STRHJ      MRPEIDSLYDAFEHPRSERPTLPLLPPAEARRYAAEVRGRALDLLQAADF--------H-
G2NRS0_STREK      IRPEIDGLYDAFEHSRASRPSLPLLPPAEARIYAADVRGRALDILEGAPLH-------GA
G2P4L0_STRV4      LRPEIDSIYDAFEHPRAERPSLPLLAPAEARGYAHEVRGRVLDILERIEL--------R-
C1A342_RHOE4      VRSDIDELYDAFKHSRSSRPTLPLLNPAEAREYVRTVRGKVWDVLEASTF--------G-
F6EPS9_HOYSD      VRKDIDELYDAFQHPRASRTQLPLLSPSEARGYVKSVRDKVLDVLDRTPL--------Y-
Q5YQ03_NOCFA      VRADIDELYDAFKHARKDRPALPLLNPAEARGYVGTVREKVWDVLERSAL--------R-
A4X6R5_SALTO      VRQDIDELYDAFKQPRRDRPALPLLPPPQARAYVATVRDKVFDLLDQVTF--------T-
D9TEQ4_MICAI      VRHDIDDLYDAFKQPRKDRPALPLLPPAEARAYVRTVRDKVFDLLDGIRF--------T-
G8S2S8_ACTS5      VRQDIDELYDAFQHARSDRPALPLLDPAEARRYIGQVRDKALDVLDRVRL--------D-
I0HEE8_ACTM4      VRQDIDELYDAFKHARKDRPALPLLDPGQARAYVAQVRDKALDVLDHARF--------DP
                      :  :*:*    *  *  * :*    :  :   :*  . : :               

Q1AY71_RUBXD      DD------------------------------------PLLGEGFVYRMVLQHEAQHNET
B1MFR9_MYCA9      SA--------------------------------------RAEEFVYAMVLSHEHQHDET
V5XJG6_MYCNE      -------------------------------------------LFPFGLVISHENQHDET
I4BQG8_MYCCN      ----------------------------------------HPDAFTFGMVISHENQHDET
A0PVD7_MYCUA      -----------------------------------------GDDFTFGMVISHESQHNET
EGTB_MYCS2        -----------------------------------------DPGFRFALVISHENQHDET
EGTB_MYCT3        -----------------------------------------ADTFAFGMVVSHEHQHDET
EGTB_MYCTU        -----------------------------------------GDSFVFAMVISHENQHDET
T2GP64_MYCHT      AG--------------------------------------PDAAFVYAMVVSHENQHDET
D6Y5F6_THEBD      RR------------------------------------PLCADGFVFGLVIQHEHQHDET
E3IYP6_FRAIE      GG-----------------------------QRDDVVTRLLSGGFVYGMVVQHEHQHDET
Q2J4D4_FRACC      AE----------------------------TAAVPERERLLADGFVYGMVVQHEHMHDET
A8L8S3_FRASN      EAAGPEAGNGNENGAASRNGAANGNGERDGGAAVHRRARLLSGSFVYGMVIQHEHQHDET
J7L9P0_NOCAA      DR------------------------------------SLLDAGFVFHMVIQHEHMHDET
D7AY99_NOCDD      ER------------------------------------SLLDAGFVFHMVIQHEHQHGET
C7QH02_CATAD      DE------------------------------------ELSRGGFAFGMVAQHEQQHDET
Q9RD00_STRCO      GT------------------------------------RLTEAGFAFGMIAQHEQQHDET
H2JW49_STRHJ      GT------------------------------------RLTEAGFAFGMIAQHEQQHDET
G2NRS0_STREK      GR------------------------------------PLERAGFAFGMIAQHEQQHDET
G2P4L0_STRV4      GA------------------------------------PLVDAGFAFGMIAQHEQQHDET
C1A342_RHOE4      RT------------------------------------ELDVDGFAFGMIAQHEQQHAET
F6EPS9_HOYSD      GT------------------------------------PLSDHGFAFAMIAQHEQQHDET
Q5YQ03_NOCFA      GS------------------------------------RLIEDGFAFGMIAQHEQQHDET
A4X6R5_SALTO      DR------------------------------------RLVTDGFAFGMIVQHEQQHDET
D9TEQ4_MICAI      ER------------------------------------PLVADGFAFGMIVQHEQQHDET
G8S2S8_ACTS5      ER------------------------------------PLLAGGFAFGMIVQHEQQHDET
I0HEE8_ACTM4      ER------------------------------------PLLDNGFAFGMIVQHEQQHDET
                                                              * : :: .**  * **

Q1AY71_RUBXD      MLQTLQLMRGE---------GYRPRRMAPL-PPGNPGG---EEMVLVPGGAFIMGTD--D
B1MFR9_MYCA9      MMQALSIRHGA---------ALLEAVDPV--PPGRPGVA--GTSVLVPEGPFVLGVDAVD
V5XJG6_MYCNE      MLQALNLRSGP---------PILPPGSPL--PVGRSGVA--GTSVLIPGGPFILGVDAAE
I4BQG8_MYCCN      MLQALSLRTGA---------PLLDRGAAL--PAGRSGVA--GTSVLVPGGEFVLGVDALT
A0PVD7_MYCUA      MLQALNLRSGP---------PLLGQTPAL--PPGRAGLA--GTSVEVPAGPFVLGVDGSA
EGTB_MYCS2        MLQALNLREGP---------PLLDTGIPL--PAGRPGVA--GTSVLVPGGPFVLGVDALT
EGTB_MYCT3        MLQALNLRSGE---------PLLGSGTAL--PPGRPGVA--GTSVLVPGGPFVLGVDLAD
EGTB_MYCTU        MLQALNLRTGS---------PLLAATSAL--PAGRPRMA--GTSVLVAGGPFVLGVDAAD
T2GP64_MYCHT      VLQALNLRSGA---------PLLRDTSVL--PAGRPELA--GTSVLVPGGEFVLGVDAAD
D6Y5F6_THEBD      MLATLQLSGRP---------GIVRDDPTP--PSRGRTK---PDEVYIPAGVFTMGTS--A
E3IYP6_FRAIE      LLATLQLATAARVQPRPARDPVVDEGVAL--PAGRPV----SGEVLVPAGPFTMGTS--T
Q2J4D4_FRACC      MLATHQLRQGP---------PVLAPGAAP--PPGRRVP---RPEVLVPGGEFTLGTS--I
A8L8S3_FRASN      MLATLQLRAGP---------PVLADPRAA--PPSPAGPVDEAAEVLVPAGEFTMGTS--T
J7L9P0_NOCAA      MLATHQLRRGA---------PALLEGSTEIGPVIPPE----AEEVLVPAGPFTLGTD--D
D7AY99_NOCDD      MLATHQLRKGE---------PVLLEEAAPV-TTLRPPV---RDEVFVPEGPFTMGTD--D
C7QH02_CATAD      MLITHQLRTGP---------PVLHRPPPPAPPADTLSL---APEVFVPGGPFTMGTS--T
Q9RD00_STRCO      MLITHQLRKGP---------QALTAPDPD--PVPLFTG---PAEVLVPGGPFAMGTS--T
H2JW49_STRHJ      MLITHQLRKGP---------QALTAPDPE--PAPLFTG---PAEVLVPGGPFTMGTS--S
G2NRS0_STREK      MLITHQLRSGP---------AVLDAPEPPR-QTDAVAL---PAEVLVEGGPFTMGTS--T
G2P4L0_STRV4      MLITHQLRRGP---------AALTAPPPPD-TADGAAL---PEEVLIPGGPFTMGTS--T
C1A342_RHOE4      MLATHQLRSGP---------TALVATPAP--QAARMPE---LDEVTIAAGPFVMGTD--D
F6EPS9_HOYSD      MLATHQLRRGS---------AALHAAPPP--P-KSAAV---GGEAVVPAGPFEMGTS--S
Q5YQ03_NOCFA      MLATHQLRAGE---------PVLSAAAPP--P-ARVRV---SGEVIVPGGEFTMGTS--A
A4X6R5_SALTO      MLATHQLRSGP---------AVFDAPPP---PEPRVRV---DGEVLVPAGEFTMGTD--T
D9TEQ4_MICAI      MLATHQLRAGA---------PVLDAPPP---PEPRARV---GGEVRVPAGPFTMGTS--T
G8S2S8_ACTS5      MLATHQLRGGS---------PVLSAPPPP--P-GDARV---RGEVLIPGGPFTMGTD--T
I0HEE8_ACTM4      MLATHQLRAGE---------PVLTAPAPP--P-SRTPV---SGEVFVAGGPFTMGTS--T
                  :: : .:                                     . :  * * :*..   

Q1AY71_RUBXD      RARALDNERPAHEVELPPFYIDRLPVTNREYLGFVEDGGYRREELWDPEGWEWIREERIS
B1MFR9_MYCA9      EPFSLDNERPAHVVHLRGFRIGTVPVTNAEWLAFMADGGYRRQELWTEIGWAHRCAEALT
V5XJG6_MYCNE      EPYSLDNERPAHTVEVDAFRIGRVPVTNAEWRAFMADGGYRTRRWWSDAGWAHRERADLM
I4BQG8_MYCCN      EPFSLDNERPAHVVDIPAFRIGRVPVSNREWREFIDDGGYGQRRWWSEQGWAHRQQAGLT
A0PVD7_MYCUA      EPYSLDNERPAHPVDVAAFRIGRVPVTNAEWQHFIDDGGYQQSRWWSPRGWAHRQSAGLS
EGTB_MYCS2        EPHSLDNERPAHVVDIPSFRIGRVPVTNAEWREFIDDGGYDQPRWWSPRGWAHRQEAGLV
EGTB_MYCT3        EPYALDNERPAHVVDVPAFRIGRVPVTNAEWRAFIDDGGYRQRRWWSDAGWAYRCEAGLT
EGTB_MYCTU        EPCSLDNERPAHVVDVPAFRIGRVPVTNGEWQDFIDDGGYTQSRWWSERGWQHRQRAGLT
T2GP64_MYCHT      EPESLDNERPAHVVDLPAFRIGTVPVTNGEWQQFVADGGYDEPRWWSQRGWQHRQAAGLT
D6Y5F6_THEBD      APWAYDNERPAHQIYLPGYWIDRYPVTNGEYAAFIADGGYRDPRLWHPEGWEWVQRTGTS
E3IYP6_FRAIE      DPWAYDNERPAHRVDVPAFWIDRLPVSNRAQLAFLDAGGYDDERLWSPAGWAWRCRERLE
Q2J4D4_FRACC      HPWAFDNEDPAHRVHLPAFWIDTLPVSNRAQIAFIDAGGYDDERLWSAAGWEWRQTEGLS
A8L8S3_FRASN      EPWAYDNERPAHRVFLPAFRLGRYPVTNRAHLAFIADGGYADERLWSAEGWAWRCQEGLT
J7L9P0_NOCAA      DPWSFDNERPARTVDLPAYLIDAAPVSNAAYQAFIDDGGYRDPRWWSPAGWEWRTARGAV
D7AY99_NOCDD      DPWAYDNERPARTVDLGPYWIDTALVTNAAYQEFMDDGGYQTRRWWTRDGWEWKEKRGAV
C7QH02_CATAD      EAWALDNERPAHEVDVAGFWLDTTPVTNGAYMEFLADGGYDDPRWWSEPGWAHRQKADLV
Q9RD00_STRCO      EPWALDNERPAHRREVAPYFIDTVPVTNGAYRAFIDDGGYDDPRWWTPEGWDHIRRHAVT
H2JW49_STRHJ      EPWALDNERPAHPREVAPFWIDTTPVTNAAYQAFIEDGGYDTERWWSPEGWAHIRQHAIS
G2NRS0_STREK      EPWALDNERPAHRRDVGAFFIDTAPVTCGAYQRFIEAGGYGDERWWAPEGWAMVREHELS
G2P4L0_STRV4      EPWALDNERPAHHRLVPAFHIDTTPVTNGAYERFIADGGYGERRWWTAEGWAYLQEHGLA
C1A342_RHOE4      EPWALDNERTAHQVYLTDFAIDRFPVTNGQFVEFIEDGGYSRPELWSRDGWRHRVDAKLR
F6EPS9_HOYSD      DPWALDNERPAHRVHVDAFAIARAPVTNGEYIEFIGDGGYSRPALWSEAGWAHRKASDLT
Q5YQ03_NOCFA      DPWALDNERPAHPVHVPAFAIDAAPVTNEQYLAFLEDGGYERPELWSERGWAHRVSAGLT
A4X6R5_SALTO      DPWALDNERPAHRVHLPAYAIDAAPVTNGAYAAFIAAGGYRDPRWWSAAGWAHRQEAGLT
D9TEQ4_MICAI      DPWALDNERPAHTVDLPAYVIDAAPVTNGQYRAFIADGGYDEPRWWSEAGWRHRIEADLS
G8S2S8_ACTS5      DPWALDNERPAHTVEVPAFLIDATPVSNSDYLAFIDAGGYDDPRWWSARGWTHRHEAGLT
I0HEE8_ACTM4      DAWALDNERPAHVVDVPGFFIDAAPITNGQYQEFIAAGGYDDPRWWSDRGWAYRVKAGLA
                   . : *** .*.   :  : :    ::      *:  ***     *   **         

Q1AY71_RUBXD      APKHWYQKEPHDWWTECFGFDQPLRPDAPVMHVSWYEADAYARWAGKRLPTEAEWEKAAS
B1MFR9_MYCA9      APKFWNQGG----TLTRFGRELQIVPDEPVQHVTFHEAQAYASWAGARLPTEAEWEKACV
V5XJG6_MYCNE      APGFWNSDG----SRTRFGYREDIPGDEPVQHITYFEAEAYAAWAGARLPTEIEWEKACA
I4BQG8_MYCCN      APLFWSGDG----TRTRFGHVEDIPDDEPVQHITYFEAEAYAAWAGARLPTEMEWEKACA
A0PVD7_MYCUA      APQFWNADG---RTRTRFGYQEDIPADEPVQHVTYFEAEAYAAWAGARLPTEIEWEKACA
EGTB_MYCS2        APQFWNPDG----TRTRFGHIEEIPGDEPVQHVTFFEAEAYAAWAGARLPTEIEWEKACA
EGTB_MYCT3        APQFWNPDG----TRTRFGHVEDIPPDEPVQHVTYFEAEAYAAWAGARLPTEIEWEKACA
EGTB_MYCTU        APQFWRSGG---RTRTRFGHVEDIPADEPVQHVSYFEAEAYAAWAGARLPTEVEWEKACA
T2GP64_MYCHT      APQFWHPDA---RTRTRFGRVEDIPADEPVQHVSFFEAEAYAAWAGARLPTEMEWEKACA
D6Y5F6_THEBD      APLFWTWDGSS-WWRTRFGRLEPVPEDEPVQHVCWYEADAYARWAGKRLPTEAEWEKAC-
E3IYP6_FRAIE      APLFWRRDGAGGWLRRRFGRDEALPLDEPVQHVCWYEAEAHARWAGRRLPTETEWEKACA
Q2J4D4_FRACC      APAFWWREGGT-WLRRRFGRVEPVPLDEPVQHVCWYEAEAHARWAGRRLPTEAEWEKAAA
A8L8S3_FRASN      APLFWSRDGDV-WTRRRFGRVEPVPLDEPVQHVCWYEAEAHARWAGRRLPTEAEWEKACA
J7L9P0_NOCAA      APAFWTLEAGR-WTRRRFGRHEDVPPNEPVQHVSFHEASAYARWAGKRLPTEAEWEKAAR
D7AY99_NOCDD      SPAFWTREGTG-WSRRRFGRQEMVPPDEPVQHVCFHEARAYAAWAGKRLPSEPEWEKAAR
C7QH02_CATAD      APLYWSREGEQ-WLRRRFGVVEPVPAAEPVVHVTYYEAEAYAAWKGRRLPTEAEWEKAAR
Q9RD00_STRCO      APLFWRRDGGQ-WLRRRFGVTEAVPADEPVLHVCWYEADAYARWAGRRLPTEAEWEKAAR
H2JW49_STRHJ      APLFWRRDGGQ-WLRRRFGITEPVPPDEPVLHVCWYEADAYARWAGRRLPTETEWEKAAR
G2NRS0_STREK      APLFWHKDAGQ-WLRRRFGVTEPVPSDEPVLHVSWYEADAYARWAGRRLPTEAEWEKAAR
G2P4L0_STRV4      APLFWRREGGQ-WLRRRFGVTEPVPPNEPVVHVSWYEADAYARWAGRRLPTEEEWEKAAR
C1A342_RHOE4      APLFWEHDSSG-WWHETFGVEAPVPPDKPVVHVSYYEAEAYASWAGKRLPTEVEWEKAAR
F6EPS9_HOYSD      APLFWRQDSAGVWWRRRFGLVEKVQFDEPVVHVSFHEAEAFARWAGKRLPTEAEWEKAAR
Q5YQ03_NOCFA      APRFWERDGDGRWWRRVFGVLSPVRPRQPVVHVCWFEAEAYARWAGKRLPTEAEWEKAAR
A4X6R5_SALTO      APLHWHPDGDG-WAYRRFGRWALVRDDEPVVHVSWYEAQAYAAWVGKRLPTEAEWEKAAR
D9TEQ4_MICAI      APMHWRRDGDG-WAYRRFGRWSPVRDDEPVVHVCWYEAQAYAAWAGKRLPTEAEWEKAAR
G8S2S8_ACTS5      APMHWLRDGDA-WLYRRFGRISPIAGDEPVVHVDYFEAEAYAAWAGKRLPTEAEWEKAAR
I0HEE8_ACTM4      APLHWLHDGTQ-WHSRQFGRVSPINPGEPVVHVCYFEAEAYAAWAGKRLPTEAEWEKAAR
                  :* .*            **    :    ** *: :.** *.* * * ***:* *****. 

Q1AY71_RUBXD      WDPEEGTKRLFPWGDEPPT----PERANLDQLAFRPAEVGAYPAGASPCGALGMVGDVWE
B1MFR9_MYCA9      WDPEIGARRRFPWGAEAPA----RDRANLGGGALGPAPVGAYPESASAYGAEQMLGDVWE
V5XJG6_MYCNE      WDPVAGMRRRYPWGAVEPD----AERANLGGRSLRPAPVGAYPGGASAYGVEQMLGDVWE
I4BQG8_MYCCN      WDPAAGSRRRYPWGASEPT----TDVANLGGDALRPAPVGAYPASASAYGAEQMLGDVWE
A0PVD7_MYCUA      WDPVTNSRRRYPWGDSAGPVGNFAAHANLGATALRPAPVGAYPAGASAYGAEQMLGDVWE
EGTB_MYCS2        WDPVAGARRRFPWGSAQPS----AALANLGGDARRPAPVGAYPAGASAYGAEQMLGDVWE
EGTB_MYCT3        WDPATGRRRRYPWGDAAPT----AALANLGGDALRPAPVGAYPAGASACGAEQMLGDVWE
EGTB_MYCTU        WDPATGSRRRYPWGTEEPT----DTYANLGGQTLRPAPVGAYPAGASACGAEQMLGDVWE
T2GP64_MYCHT      WDPSTGTRRRYPWGAAPPS----PAVANLGGAALRPAPVGAYPAGASACGAEQMLGDVWE
D6Y5F6_THEBD      ------GGRTYPWGDRPPT----GAEANLGHRAARPAPVGAFPEGASPYGVEQLIGDVWE
E3IYP6_FRAIE      FDPASGRSRRFPWGDDPPT----PRHANLGHRAARPAPLGAYPDGASASGVEQMIGDVWE
Q2J4D4_FRACC      YDPVTGRSRRYPWGDTDPT----PERANLGNWTSGPAPLGAYPAGASPCGAEQMIGDVWE
A8L8S3_FRASN      HDPVTGRSRRYPWGDTDPT----PELANLGHRTARPAPVGGRPAGASPYGAEQMIGDVWE
J7L9P0_NOCAA      HDPVTGRSHRFPWGDEEPE----PRHANLGQRRLGPAPVGAHPDGASPLGVRQMIGDVWE
D7AY99_NOCDD      FDPVSGRSRRYPWGDTDPG----PGHANLGQRRLGPSPAGRHPDGASPLGVQQLVGDVWE
C7QH02_CATAD      HDPVSGRSRRYPWGDEDPL----PRHANLGQAHLQPSAAGSYPEGEAPSGARQLIGDVWE
Q9RD00_STRCO      YDPAGDRAMRYPWGDADPG----PEHANLGQRHLRPAPAGSYPAGESPLGVRQLIGDVWE
H2JW49_STRHJ      FDPATGRSRRYPWGDADPA----PEHANLGQRHLRPAPAGSYPAGASPLGVRQLIGDVWE
G2NRS0_STREK      HDPASDRSRRYPWGDGDPT----PEHANLGQRHLRPAAAGAYPAGRSPSGAGQLIGDVWE
G2P4L0_STRV4      HDPDSGRSRRYPWGDTDPA----PDQANLGQRHLRPAPAGSYPKGASPLGVRQLIGDVWE
C1A342_RHOE4      WDSESGRSRRFPWGDVSAD----ENLANLGQRHLGPAGVGSYPAGASAAGVEQLIGDVWE
F6EPS9_HOYSD      WDPATGRSRRYPWGDEAPS----AERANLGQRHLQPAAVGAYPAGASPLGVHQLIGDVWE
Q5YQ03_NOCFA      FDPATGGSRRYPWGEDEPD----DTRANLGQRHLEPAEVGAYPAGVSATGAHQLIGDVWE
A4X6R5_SALTO      WDPATGRSRRYPWGDEDPT----TTHANLGQRHLWPAPVGAYPAGVSPLGVHQLMGDVWE
D9TEQ4_MICAI      WDPATGRSRRYPWGDEDPT----TEHANLGQRHLWPAPVGAYPAGASPLGVHQLVGDVWE
G8S2S8_ACTS5      WDPATGRSRRFPWGDEPPG----PEHANLGQRHLAPAPAGAYPAGASPLGVHQLIGDVWE
I0HEE8_ACTM4      FDPATGRSRRFPWGDESPE----PRHANLGQRHLSPAPVGAYPDGASPLGVHQMIGDVWE
                            :***            ***.     *:  *  * . :. *.  ::*****

Q1AY71_RUBXD      WTATEFSGYPGFESFPYREYSEVFF-----------DEG-----YMVLRGGSFATRPCAI
B1MFR9_MYCA9      WTTSPLRPWPGFTPMIYQQYSEPFF-----------DGD-----YRVLRGGSWAVAREIM
V5XJG6_MYCNE      WTSSPLRPWPGFTPMIYDRYSVPFFDSDAS------TGD-----YRVLRGGAWAVAGDIL
I4BQG8_MYCCN      WTTSALRPWPGFTPMIYDRYSQPFFEGVA-------TGD-----YRVLRGGSWAVAASIL
A0PVD7_MYCUA      WTASPLRPWPGFAPMIYQRYSQPFF-----------DGD-----YRVLRGGSWAVEPAIL
EGTB_MYCS2        WTSSPLRPWPGFTPMIYERYSTPFFEGTT-------SGD-----YRVLRGGSWAVAPGIL
EGTB_MYCT3        WTSSPLRPWPGFTPMIYQRYSQPFFEGAG-------SGD-----YRVLRGGSWAVAADIL
EGTB_MYCTU        WTTSPLRPWPGFVPMVYERYSQPFF-----------GGD-----YRVLRGGSWAVEPAIL
T2GP64_MYCHT      WTTSPLRPWPGFAPMLYERYSQPFF-----------FRD-----YRVLRGGSWAVEPGIL
D6Y5F6_THEBD      WTDSWFRPYPGFVSFPYREYSEVFF-----------GQT-----YRVLRGGSWATHPTVA
E3IYP6_FRAIE      WTSSGFTAYPGFAAFPYREYSEVFFRGPDGVERADADPDQQFRGYRVLRGGSWAADPSAA
Q2J4D4_FRACC      WTASGFTPYPGFVSYPYREYSEVFF--PKA------GRESS---FRVLRGGSWATDAVAV
A8L8S3_FRASN      WTGGGFTPYPGFASFPYREYSEVFY-----------PRDAAPARFRVLRGGSWATDPSAV
J7L9P0_NOCAA      WTSTTFHGYPGFRAFPYREYSEVFF-----------DEG-----YKVLRGGSWATHPTAV
D7AY99_NOCDD      WTSTTFTGYPGFRAFPYEDYSEVFF-----------DDG-----YKVLRGGSWATHPTAA
C7QH02_CATAD      WVSSDFLPYPGFVAWPYREYSEVFF-----------GPD-----YKVLRGGSFAVDPVAC
Q9RD00_STRCO      WTSSDFTPYPGFRAFPYKEYSEVFF-----------GPE-----YKVLRGGSFAVDAVAC
H2JW49_STRHJ      WTASDFLPYPGFRAFPYKEYSEVFF-----------GSE-----HKVLRGGSFAVDPVAC
G2NRS0_STREK      WTSSDFLPYPGFVAFPYREYSEVFF-----------GPG-----HKVLRGGSFAVDAVAC
G2P4L0_STRV4      WTSSDFLPYPGFRAFPYREYSEVFF-----------GPA-----HKVLRGGSFAVDEVVC
C1A342_RHOE4      WTSSGFHPYPGFRAFPYREYSEVFF-----------GGD-----YKVLRGGSFGTDSVAC
F6EPS9_HOYSD      WTSTPFRGYPGFRYFPYAEYSEVFF-----------GTD-----HRVLRGGSFGTDEVAV
Q5YQ03_NOCFA      WTSSGFDPYPGFRAFPYREYSEVFF-----------GGD-----YRVLRGGSFGTDPVAC
A4X6R5_SALTO      WTSTTFRGHPGFTAFPYREYSEVFF-----------GDD-----YRVLRGGSFGTDRSAC
D9TEQ4_MICAI      WTSSPFRGHPGFTAFPYREYSEVFF-----------GDD-----HRVLRGGSFGTDRSAC
G8S2S8_ACTS5      WTSTDWHGYPGFRVFPYAEYSEVFF-----------GGD-----YKVLRGGSFGTDAAAC
I0HEE8_ACTM4      WLSSDFDPYPGFAAFPYREYSEVFF-----------GGD-----YKMLRGGSFGTDAAAG
                  *        ***    *  **  *:                   . :****::..     

Q1AY71_RUBXD      RNTFRNWDFPIRRQLFVGFRCARDA-------------
B1MFR9_MYCA9      RPSFRNWDHPVRRQIFSGLRLAWDI-------------
V5XJG6_MYCNE      RPSFRNWDHPIRRQIFSGLRLAWDV-------------
I4BQG8_MYCCN      RPSFRNWDHPIRRQIFSGVRLAWDV-------------
A0PVD7_MYCUA      RPSFRNWDHPYRRQIFAGVRLAWSIEDAA---------
EGTB_MYCS2        RPSFRNWDHPIRRQIFSGVRLAWDV-------------
EGTB_MYCT3        RPSFRNWDHPIRRQIFAGVRLAWDVDRQTARPGPVGGC
EGTB_MYCTU        RPSFRNWDHPYRRQIFAGVRLAWDI-------------
T2GP64_MYCHT      RPSFRNWDHPYRRQIFAGVRLAWDVPGVRDHR------
D6Y5F6_THEBD      RTTFRNWDFPIRRQIFAGFRCARSED------------
E3IYP6_FRAIE      RATFRNWDHPIRRQIFVGFRLARDAD------------
Q2J4D4_FRACC      RATFRNWDYPIRRQIFAGFRLARDAG------------
A8L8S3_FRASN      RSTFRNWDFPIRRQIFAGFRLARDADTP----------
J7L9P0_NOCAA      RSTFRNWDHPIRRQIFSGFRCARDVDRD----------
D7AY99_NOCDD      RATFRNWDHPIRRQIFSGFRCARDAEPA----------
C7QH02_CATAD      RGTFRNWDYPIRRQIFSGFRTARDGVL-----------
Q9RD00_STRCO      RGTFRNWDYPVRRQIFSGFRTARSASAEVA--------
H2JW49_STRHJ      RGTFRNWDYPIRRQIFSGFRTARSEAV-----------
G2NRS0_STREK      RGTFRNWDLPVRRQIFSGFRTARDA-------------
G2P4L0_STRV4      RGTFRNWDLPVRRQIFSGFRTARDAS------------
C1A342_RHOE4      RGTFRNWDHPIRRQIFSGFRCARTISGRP---------
F6EPS9_HOYSD      RGTFRNWDYPVRRQIFAGFRLARDAEQGENS-------
Q5YQ03_NOCFA      RGTFRNWDHPIRRQIFAGFRLARDLRADER--------
A4X6R5_SALTO      RGTFRNWDYPIRRQIFSGFRCARDVAAEEAAE------
D9TEQ4_MICAI      RGTFRNWDYPIRRQIFSGFRCARDAGPEE---------
G8S2S8_ACTS5      RGTFRNWDHPIRRQIFSGFRCARELV------------
I0HEE8_ACTM4      RSTFRNWDHPIRRQIFSGFRLARDA-------------
                  * :***** * ***:* *.* *.