CLUSTAL format seed alignment for MF_02041

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

O51243_BORBU      --------------------------------------------MLMN-RKISIAPMVNI
Q46I48_PROMT      -----------------------------------MISNSLKTNEIAN-YRLSIAPMMDC
Q7TVB2_PROMA      ------------------------------------MVQKSKPLITEA-YQFSVAPMLDC
I7JJ65_9BURK      ---------------------------------------MIDQKLNRG-RRVSVAPMLDV
C9RM69_FIBSS      ------------------------------------------MNIDFN-RRLSIAPMLDC
H9UGA5_SPIAZ      MHTADAAPAADGAAPADGSAAAPGSGYGREAVLPGSRRLPERPGFTSP-YPVSVAPMMDR
D3PTQ5_MEIRD      ----------------------------------------MTPLDQDS-YRLSVAPMLDW
DUSAL_THET8       ---------------------------------------------MLD-PRLSVAPMVDR
B0SLP0_LEPBP      -----------------------------------------MTDPVPS-HRISVAPMMDW
D3S9S9_THISK      ---------------------------------------MTGSLRFPD-PRFSVAPMMDW
L0DW19_THIND      --------------------------------------------------------MMDW
A8LSP6_DINSH      ------------------------------------MISEEKSNSCGS-SRLSVAPMMDW
DUSA_XYLFA        ---------------------------------MIPVINQEKQGISGD-FRLSVAPMMNW
DUSA_XANCP        ------------------------------------MTLPPPAAYADS-LRLSVAPMMDW
B2FI91_STRMK      -------------------------------------MTSATARYADS-LRLSVAPMMDW
Q5QXY6_IDILO      ------------------------------------------MTEPYS-YKLSVAPMLDW
D5W7L2_PARAM      ---------------------------------------MSLPRTPSP-RRVSVAPMMDW
B1XY95_LEPCP      --------------------------------MIDSRAHQQPGIAPEA-WRLSVAPMLDW
F5XWE9_RAMTT      --------------------------------------MQVPSPPPHP-WRLSVAPMMDW
A1VPW7_POLNA      --------------------------------MSIPVSSDVSVPADNP-WRLSVAPMMDW
DUSAL_SYNY3       ---------------------------------------MTKIFADSSINPLSVAPMMDH
D4ZTQ2_ARTPN      ----------------------------MVNMTAMSREPRLSEDNYRS-HILSIAPMMDR
B1XI00_SYNP2      -------------------------------------MSQRINTVVCP-HLLSVAPMMDR
B2II58_BEII9      ------------------------------------------MKQFQS-YRFSVAPMMEW
D7A646_STAND      ------------------------------------------MSINQS-FRFSTAPMMEW
Q6N8D4_RHOPA      ------------------------------------------MQPNQP-HRFSVAPMMDW
Q31GB8_HYDCU      -------------------------------MSLKNSLLTPNSIRSSA-SQFSVAPMLDW
Q9RTQ8_DEIRA      ----------------------------------------MTAAPRPP-HTLSVAPMMDW
Q48A03_COLP3      -------------------------------MTIITDSKPYIARATIN-HKLSVAPMLDW
I3Y9Y5_THIV6      ----------------------------------MTPSNARKTRLTKA-RKIAVAPMLDW
A1SZA5_PSYIN      ------------------------------------MINPDTACIYPS-NRFSIAPMLDW
DUSA_SHEON        -----------------------------------MLKNNINDSKNLD-RTFSIAPMLDW
D4ZFH6_SHEVD      ------------------------------------MDMQFMPVRKIN-RTFSIAPMLDW
DUSA_HAEDU        -----------------------------------------MHNKFYR-GRFAVAPMLDW
DUSA_PASMU        --------------------------------------MIQNQPHFYR-GRFSVAPMLDW
DUSA_HAEIN        --------------------------------------MPQNLPHFYR-GRFSVAPMLDW
H2FUK3_OCESG      --------------------------------------------------------MLDW
B7VI79_VIBA3      -------------------------------------MKPDNTSKYAA-NRLSVAPMLDW
DUSA_VIBCH        --------------------------------------------MTHS-CRLSVAPMLDW
F7YIQ8_VIBA7      --------------------------------------------MTHP-CKLSVAPMLDW
DUSA_VIBPA        --------------------------------------------MTHS-CRLSVAPMLDW
DUSA_YERPE        -----------------------------MHEAQTFSSTPATKPQYPL-QRFSVAPMLDW
E0SEJ3_DICD3      ---------------------MLRLTPRTSFPLMKEKESTETLRSNWH-GRFSVAPMLDW
A4W5G2_ENT38      -------------------------------------MSSELKSTFPA-HRFSIAPMLDW
DUSA_SALTY        -------------------------------------MQPETQSSALPAYRFSIAPMLDW
DUSA_ECOLI        -----------------------MHGNSEMQKINQTSAMPEKTDVHWS-GRFSVAPMLDW
A1U1Y0_MARHV      ------------------------------------MTSEQATTKALS-RRFCVAPMMDW
DUSA_PSESM        -------------------------------MQPDIAPNPHSTRPGLS-RRFSVAPMMDW
F6AA13_PSEF1      ---------------------------------MIETSKPESTGPVLS-RKFSVAPMMDW
DUSA_PSEAE        -----------------------------------MRPEPTNAPAALS-RRFSVAPMMDW
DUSA_PSEPK        -------------------------------MSLETASTPHTTRPEPS-RRFSVAPMMDW
E1V4R8_HALED      --------------------------------------MSMNNAADGA-RRFSVAPMMDW
F2K1D2_MARM1      ---------------------------MLQENSEKTSSNPYKSRDTID-RRFSVAPMLDW
A6VYA3_MARMS      -------------------------------MSLDNGATPVNPSNKLD-RRFSIAPMMDW
                                                                          *:: 

O51243_BORBU      TDEHFRYLIRLLSKKVTLYTPMISAKSIIMGD-VKKIVKQNPLESPIAIQIATNSKNDAL
Q46I48_PROMT      TDRHFRVLMRQITKKSLLYTEMIVAQALHYSKNRNKLLDFDEIEHPISIQLGGDNPKLLA
Q7TVB2_PROMA      TDRHFRVLMRQITGRALVYTEMIVAKALKYKN-RKSLLDFDEIEHPIALQVGGDDPIVLS
I7JJ65_9BURK      TDKHCRFFHRLLSPEALLFTEMVTTGALIFGD-VPRHLDFNVEEHPVALQLGGAEPKDLA
C9RM69_FIBSS      TDRHERYFLRLLSKHILLYSEMVVSTGLLHCENKDLFLGHEPFEHPAVLQLGGSNPADLA
H9UGA5_SPIAZ      TDKFFRWFLRQITPNTLLYSEMVSTGAIVHGD-RERHLGFFPEEKPLALQLGGSDPAEVG
D3PTQ5_MEIRD      TDRHFRYLVRLISRRVRLYTEMVVDQSILLGN-RPKLLDFSPEEHPVALQLGGSVPEKLA
DUSAL_THET8       TDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGN-RERLLAFRPEEHPIALQLAGSDPKSLA
B0SLP0_LEPBP      TDRHFRYFIRLISKHALLYTEMVTTGAILRGKDNHRYLDFSKEEHPIALQLGGDSPKALA
D3S9S9_THISK      TDSWCRRFHRLLTRRALLYTEMVHANAVIHGD-RDRLLGHVAAEHPLALQLGGSDPDTLA
L0DW19_THIND      TDRWCRRFHRLLTRRALLYTEMLHANAVVHGD-REHLLGFDPAERPLAVQLGGSDPAVLA
A8LSP6_DINSH      TDRHCRMFHRQFTQHALLYTEMVTAPAVVRGD-AGRLLEHAEAEHPLALQLGGSDPVELA
DUSA_XYLFA        TDRYCRVFHRVLAPSARLYTEMVHAKAVIYGD-RERLLGFASVEQPVALQLGGSEPALLA
DUSA_XANCP        TDRHCRVFHRLLAPSARLYTEMVHANAVIHGD-RQRLIGFDAVEHPLALQLGGSDPALLA
B2FI91_STRMK      TDRHCRVFHRVLAPGARLYTEMVHANAVIHGD-RERLLGFDRSEQPLALQLGGSDPALLA
Q5QXY6_IDILO      TDRHCRYFHRLLTRSTLLYTEMVTTGAIIFG--QQDFLAFNAEEHPVALQLGGSEPAAMA
D5W7L2_PARAM      TDRHCRSLHRMISRHTWLYTEMVTTGALLHGD-VPRHLAFTPDEAPVALQLGGSEPDDLA
B1XY95_LEPCP      TDRHCRHFHRLLTRRTRLYTEMVTTGALLHGD-QARHLDFDAIEHPVALQLGGSDPADLA
F5XWE9_RAMTT      TDRHCRYFHRLLSRRALLYTEMVTTGALLHGD-VPRHLDFDAAEHPVALQLGGSEPADLA
A1VPW7_POLNA      SDRHCRYFHRLLSRHALLYTEMVTTGALIHGD-VGRHLRFNAEEHPVALQLGGSEPADLA
DUSAL_SYNY3       TDRHFRYFLRQLTRHTLLYTEMITAQAILHGD-RQRLLNFSPEEKPVALQLGGDDPQLLA
D4ZTQ2_ARTPN      TDRHFRYFMRQITRRPLLYTEMVTSAAIINGD-RHKLLDFSPVEKPLALQVGGDDPEQLA
B1XI00_SYNP2      TDRHFRYLMRRITRRTLLYTEMITTQAIIHGD-RPKLLDFDAAEHPISLQLGGDNPKELA
B2II58_BEII9      TDRHCRVFHRLLSRRALLYTEMITTAALLHGH-VDRLLGFDDVEHPVAVQLGGSEPRDLA
D7A646_STAND      TDRNCRAFHRVLSRRARLYTEMVTANAVIFGD-RERLIGFSDAEHPVAVQLGGSDPAALA
Q6N8D4_RHOPA      TDSHCRVFHRLLTRRGLLYTEMVTTGAVIHGD-RQRLLGFDASEHPVALQLGGSNPNDLA
Q31GB8_HYDCU      TDRHCRVFHRQLTKHAWLYSEMVTTGAIIYGNNLERFLGHSEMDSPVVLQLGGSNPEELA
Q9RTQ8_DEIRA      TDRHCRMFHRTLTRRTLLYTEMVTTGAILHGD-QGRHLDFSAPEHPLALQLGGSDAAALA
Q48A03_COLP3      TDKHSRYFYRLMTQHTVLYTEMVTTGAILRG--KGDYLSYNDAEHPLVLQLGGSDVKAMT
I3Y9Y5_THIV6      TDRHFRFFLRLITRHSLLYTEMVTTGALLHGD-RERFLRFDPAEHPVALQLGGSDPVEMA
A1SZA5_PSYIN      TDRHCRYFHRVMSKNTLLYSEMVTTGAILYG--KGDYLQKDAAEHPVCLQLGGSAPVDLA
DUSA_SHEON        TDRHYRYFARLMSANALLYTEMVTTGAILHG--RGDYLTYNQEEHPLALQLGGSNPVELA
D4ZFH6_SHEVD      TDRHYRYLARIMSTELLLYTEMVTTGAIIHG--KGDYLAYNSEENPLALQLGGSNHHDLA
DUSA_HAEDU        TTRHCRYFHRQFSQQALLYTEMITAPAILHA--KYDLLEYDPAEQPVALQLGGSDPTQLA
DUSA_PASMU        TTRHCRYFHRQFSQHALLYTEMVTTGAIIHA--KYDHLEFSPAENPVALQLGGSDPTQLA
DUSA_HAEIN        TTRHCRYFHRQFSKHALLYTEMVTAPAIIHA--KYDHLDFDLQENPVALQLGGSDPEQLK
H2FUK3_OCESG      TDRHCRYFHRLMSRHAQLYTEMVTTGAIIHG--KGDYLAYNDEEHPLVLQLGGNDPQALA
B7VI79_VIBA3      TDRHCRYFHRLLSQQTLLYTEMVTTGAILHG--KGDFLEYNEQEHPLALQLGGSNPVDLA
DUSA_VIBCH        TDRHCRYFHRLLSAQTLLYTEMVTTGAIIHG--RGDFLAYNQEEHPVALQFGGSNPKDLA
F7YIQ8_VIBA7      TDRHCRYFHRLLSSQTLLYTEMVTTGAIIHG--KGDFLAYNEEEHPVALQLGGSNPQDLA
DUSA_VIBPA        TDRHCRYFHRLMTKETLLYTEMVTTGAIIHG--KGDFLAYNEEEHPLALQLGGSNPEDLA
DUSA_YERPE        TDRHCRYFHRLLTKQALLYTEMVTTGAIIHG--KADYLAYSEQDHPVALQLGGSDPQALA
E0SEJ3_DICD3      TDRHCRYFHRLLSHNALLYTEMVTTGAILHG--KGDYLAYSDEEHPLALQLGGSDPAALA
A4W5G2_ENT38      TDRHCRYFLRQLSRHTLLYTEMVTTGAIIHG--KGDYLAYSEEEHPVALQLGGSDPAALA
DUSA_SALTY        TDRHCRYFLRLLSRQTQLYTEMVTTGAIIHG--KGDYLAYSEEEHPVALQLGGSDPAQLA
DUSA_ECOLI        TDRHCRYFLRLLSRNTLLYTEMVTTGAIIHG--KGDYLAYSEEEHPVALQLGGSDPAALA
A1U1Y0_MARHV      TTPHFRYLARILSKRALLYTEMVTTGALIHGD-TERFLRHDVSEYPLALQLGGSDANELA
DUSA_PSESM        TDHHCRYFMRLLSSQALLYTEMVTTGALLHGD-RERFLRHDETEHPLALQLGGSTAAGLA
F6AA13_PSEF1      TDHHCRYFLRQLSQHALLYTEMVTTGALLHGD-TARFLHYDQSEHPVALQLGGSNPAELA
DUSA_PSEAE        TDRHCRFFLRQLSRHTLLYTEMVTTGALLHGD-RQRFLRYDECEHPLALQLGGSVPAELA
DUSA_PSEPK        TDRHCRFFLRLLSRQTLLYTEMVTTGALLHND-AHRFLRHDASEHPLALQLGGSVPADLA
E1V4R8_HALED      TTRDYRAFARTLTRHALLYTEMVTTGAILYGSPRERFLGYDAIEHPLALQLGGSDAGELA
F2K1D2_MARM1      TTRDYRVFARTLTKHTLLYTEMVTTGAILQGDNPERFLKYDDCEHPIALQLGGSDAVALA
A6VYA3_MARMS      TTSDYRVFARTLSKNTLLYTEMVTTGALLQGNHPERFLRYDECEHPIALQLGGSDAVALG
                  :    * : * .:    ::: *    .:         :     : *  :*..        

O51243_BORBU      KAIQILEKHFNFDEYNLNVGCPSLKIQNANCGACLMGNANQVGEILKTMKENT-NKPISI
Q46I48_PROMT      EAAQMAED-WGYDEINLNIGCPSPKVKSGNFGACLMGKPNIVASCIEKMKKTC-NIPITV
Q7TVB2_PROMA      EAAQIAEE-WGYDEINLNLGCPSPKVQSGNFGACLMGQPDQVFKCIEAMKKKT-NIPVTI
I7JJ65_9BURK      YCSKLGEE-WGYDEINLNCGCPSDRVQKGSFGACLMLEPDLVADCWVAMNECT-TVPISI
C9RM69_FIBSS      SASKLVEA-AGFSEVNLNCGCPSDRVQNGNFGACLMKEKNVVADCFKAMQDAV-SIPVSI
H9UGA5_SPIAZ      EAVRIAED-WDYDEVNLNVGCPSDRVQHRGIGACLMADPPRVAQLVEVMRANT-RKPVTV
D3PTQ5_MEIRD      EAARIGEA-WGYDEINLNLGCPSERVQGGGFGACLMLEPDLVAESMAAMRQAV-KIPVTA
DUSAL_THET8       EAARIGEA-FGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAV-RVPVTV
B0SLP0_LEPBP      ECAKIGED-YGYDEINLNVGCPSDRVQSGSFGACLMKEPDLVAEMVAFCKSKV-KIPVTV
D3S9S9_THISK      QAARIAAE-RGFDEINLNVGCPSDRVQSGTFGACLMAQPEQVARMVRAMQDAV-DVPVTV
L0DW19_THIND      EAARICAD-LGYDEINLNVGCPSDRVQSGAFGACLMATPKTVAACVGAMARAV-PVPVTV
A8LSP6_DINSH      EAVRIACG-HGFDEINLNVGCPSDRVQSGCFGAVLMEQPALVARCVAAMIAASDGPEITV
DUSA_XYLFA        KAARIAVD-WGYSEINLNCGCPSDRVQAGSFGARLMREPALVADCVAAMAAVV-SVPVTV
DUSA_XANCP        QAAQIAQA-WGYDEINLNCGCPSDRVQAGRFGACLMREPALVADCVAAMCAAT-ALPVTV
B2FI91_STRMK      QAARIAAE-WGYDEVNLNCGCPSDRVQAGRFGACLMREPVLVAECVAAMVDAV-DIPVTV
Q5QXY6_IDILO      ECARLAQE-RGYDEVNINVGCPSDRVQNGSFGACLMAQPEKVAECVKAMKAVT-DIPVTV
D5W7L2_PARAM      RSAKLGEQ-WGYDEINLNCGCPSERVQRGAFGACLMNEPQLVADCVKAMRDVV-SVPVTV
B1XY95_LEPCP      ACARLAQR-WGYDEVNLNCGCPSERVQKGAFGACLMAEPALVADGVKAMRDAV-DVPVTV
F5XWE9_RAMTT      QCARLGRQ-WGYDEINLNCGCPSERVQRGAFGACLMAEPRLVADCVKAMVDAV-DLPVTV
A1VPW7_POLNA      HCARLGEQ-WGYSEININCGCPSERVQRGAFGACLMAEPKLVADCVKAMVDAV-SVPVTV
DUSAL_SYNY3       ECARIGQD-WGYDEINLNVGCPSDRVQSGNFGACLMAQPDLVAQCVSAMQKAV-EIPVTV
D4ZTQ2_ARTPN      TCAKIAED-WGYDEINLNVGCPSARVQNGNFGACLMAEPERVAEAISAMKKAV-NIPVTV
B1XI00_SYNP2      ECAKVGED-WGYDEINLNVGCPSPRVQQGNFGACLMTQPELVADCVAAMQGAV-NIPVTV
B2II58_BEII9      AAARICAD-FGYDEINLNIGCPSERVQNGAFGACLMLEPELVGDCVAAIKASV-SLPVTV
D7A646_STAND      KAAAICAD-WGYAEVNLNVGCPSDRVQGGNFGACLMRSPALVADCVAAMKAEV-SIPVTV
Q6N8D4_RHOPA      TSAKIGED-FGYDEININVGCPSDRVKEGRFGACLMAEPELVAEGVAAMKRAV-SVPVTV
Q31GB8_HYDCU      HCAKLGEE-WGYSEINLNVGCPSDRVQNNMIGACLMAHPNIVADAVSAMKTAVKEIPVTV
Q9RTQ8_DEIRA      ECARLAED-WGYDEVNLNCGCPSDRVSSGSFGACLMGTPDVVARAVEAMRAAT-RLPVTV
Q48A03_COLP3      ECAKIAEQ-YGYDEVNINVGCPSDRVQNGRFGACLMAEPALVAQCVNQMQSAT-NIPVTV
I3Y9Y5_THIV6      RCARLGAN-WGYDEININVGCPSDRVQNGRFGACLMAEPGLVADCVAAMKDAV-TVPVTV
A1SZA5_PSYIN      TSALAGKE-RGFDEINLNVGCPSDRVQNGRFGACLMSEGELVGDAIKAMKDAT-GLPVSV
DUSA_SHEON        RCAKLAAE-RGYDEVNLNVGCPSDRVQNGRFGACLMAEPELVAECVDAMKQVV-DIPVTV
D4ZFH6_SHEVD      TCAKLAAE-RGYDEINLNVGCPSDRVQSGRFGACLMAEPKLVAECVTAMKQVV-DIPVTV
DUSA_HAEDU        NCAKLVQA-RGYTEINLNVGCPSDRVQNGMFGACLMANADLVADCIKAMQDVV-DIPVTI
DUSA_PASMU        QCAKIAQQ-RGYTEINLNVGCPSDRVQNGMFGACLMAKADLVADCVSAMQTEV-SIPVTV
DUSA_HAEIN        YCAKLAEE-RGYHEINLNVGCPSDRVQNGMFGACLMAKADLVADCVEQMQSAV-KIPVTV
H2FUK3_OCESG      HCARLAEQ-RGYDEINLNVGCPSDRVQNGLFGACLMAHPHTVAEGVAAMKAAV-SIPVTV
B7VI79_VIBA3      ACAKLAGE-RGYDEVNLNVGCPSDRVQNGRFGACLMAEPELVADCVSAMKEVT-DIPITV
DUSA_VIBCH        HCAKLAQE-RGYDEINLNVGCPSDRVQNGRFGACLMGEPDLVAECVAAMRAVV-DIPVTV
F7YIQ8_VIBA7      HCAKLAQQ-YGYDEINLNVGCPSDRVQNGRFGACLMAEPQLVADCVAAMKSVV-DIPVTV
DUSA_VIBPA        KCAKLAQE-RGYDEINLNVGCPSDRVQNGRFGACLMAEPQLVADCVAAMKEVV-DVPVTV
DUSA_YERPE        HCAKLAEQ-RGYNEINLNVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDAV-AIPVTV
E0SEJ3_DICD3      QCAVLAEQ-RGYDEINLNVGCPSDRVQNGRFGACLMAEAQLVADCVTAMRERV-DIPVTV
A4W5G2_ENT38      ECAKLAEA-RGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADGIKAMRDVV-SIPVTV
DUSA_SALTY        HCAKLAEA-RGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDVV-SIPVTV
DUSA_ECOLI        QCAKLAEA-RGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDVV-SIPVTV
A1U1Y0_MARHV      HCARLAQQ-FGFSEVNLNVGCPSDRVQNNMIGACLMGHPDKVAEGVSAMIEAT-DLPVTV
DUSA_PSESM        ACARLAEA-AGYDEVNLNVGCPSDRVQNNMIGACLMAHPQLVADCVKAMRDAV-GIPVTV
F6AA13_PSEF1      ACARLAEQ-AGYDEVNLNVGCPSDRVQNNMIGACLMAHPALVADCVKAMGDAV-SIPVTV
DUSA_PSEAE        ACARLAEE-AGYDEVNLNVGCPSDRVQHNMIGACLMGHPALVADCVKAMLDAV-EIAVTV
DUSA_PSEPK        ACARLAEE-AGYDEVNLNVGCPSDRVQNNMIGACLMAHPALVADCVKAMRDAV-STPVTV
E1V4R8_HALED      ECAAIAEA-WGYDEVNLNVGCPSDRVQNNLIGACLMAYPDKVAAAVKAMQAAV-SIPVTV
F2K1D2_MARM1      TCAKIAET-FHYDEVNLNVGCPSDRVQNSLIGACLMAYPDKVADILKAMQDAT-SIPVTI
A6VYA3_MARMS      KCAKMAEQ-AGFDEVNLNVGCPSDRVQNSLIGACLMAHPDKVKEAMRAMQDNC-SIPVTI
                   .         : * *:* **** . .    ** *:     *               :: 

O51243_BORBU      KHRLGIRPLSSDYKNESYSEVKNFVKIISDFG-IKNFIVHARIAILKGFSPKNNRNIPKL
Q46I48_PROMT      KHRLGID------NLDSDDYLLKFVDTCSLAG-ADRFIVHARKAWLNGLNPKENRSIPPL
Q7TVB2_PROMA      KHRTGID------NLDSEQLLLDFVDKMASAG-ADRFSIHARKALLNGFNAKENRSIPPL
I7JJ65_9BURK      KHRLGVD------DHNDYEFVYHFVSKLYDVG-CRLFITHARNAFLKGLSPKDNRSIPPL
C9RM69_FIBSS      KCRIGVD------DLDSWEFFTDFIQTVRDAG-CKIFIVHARKAWLKGLSPKENREVPPL
H9UGA5_SPIAZ      KHRIGID------GRESFEELCEFVDVVARAG-VERLTVHARIAILEGLSPKDNRNVPPL
D3PTQ5_MEIRD      KHRLGVD------EVEDYRYLARFVEKLAGVG-VGVFIVHARKAYLKGLSPAENRTIPPL
DUSAL_THET8       KMRLGLE------GKETYRGLAQSVEAMAEAG-VKVFVVHARSALL-ALSTKANREIPPL
B0SLP0_LEPBP      KHRIGVN------GKESYEDLHQFVSKIQKAG-VDHCIVHARIAILEGLSPKENRTIPPL
D3S9S9_THISK      KHRIGID------EQDSEADLRNFVETVARGG-CRHFIVHARKAWLQGLSPKDNRDVPPL
L0DW19_THIND      KHRIGID------DQDSEADLHRFVREVEDAG-CHSFVVHARKAWLQGLSPAENREVPPL
A8LSP6_DINSH      KCRIGVD------DQQPEEMLPGFLRTVSEAG-VRRFTIHARKAWLQGLSPKENRDIPPL
DUSA_XYLFA        KCRLGVN------EDDDYGRFAKFVDWVSRASSSRMIVVHARNAWLQGLSPKENREIPPL
DUSA_XANCP        KCRLGVD------DDDDYAVFAGFIDQVVGAG-AAMVVVHARNAWLKGLSPKENREVPPL
B2FI91_STRMK      KCRLGVD------EDNDYDVFASFVDRQVAAG-AAMVVVHARNAWLKGLSPKENREVPPL
Q5QXY6_IDILO      KTRLGID------EQDSDDFLYELTDAVVAAG-VDQLTLHARKAWLQGLSPKENRDIPEL
D5W7L2_PARAM      KHRIGVD------TVEEYGFVRDFVGTIAEAG-CEVFIVHARNAILKGLSPKENREIPPL
B1XY95_LEPCP      KHRIGID------RGESYDFVRDFVGTLADAG-CEVFIVHARNAWLQGLSPKENRDIPPL
F5XWE9_RAMTT      KHRIGID------KTESYDFVRDFVGTVAEAG-CRVFIVHARNAWLQGLSPKENREVPPL
A1VPW7_POLNA      KHRIGID------REERYEFVRDFVGTVSEAG-CDTFIVHARNAWLKGLSPKENREVPPL
DUSAL_SYNY3       KHRIGID------HRDSYEDLVHFVEIVANAG-CQRFTVHARKAWLQGLSPKENRTIPPL
D4ZTQ2_ARTPN      KHRIGID------NRDRYEDMTAFVRVVAASG-CQRFTVHARKAWLQGLSPKDNRNIPPL
B1XI00_SYNP2      KHRIGVD------EQDSYADLCRFIEIVSATG-CDRFSVHARKAWLQGLSPKENRTVPPL
B2II58_BEII9      KCRIGVD------DQDPEEALGTLSAAIIAAG-VDGIIVHARKAWLKGLSPRQNRDVPPL
D7A646_STAND      KCRIGVD------EQDPEAALDALADAVLAAG-ADALIVHARKAWLEGLSPKENRDIPPL
Q6N8D4_RHOPA      KCRIGID------DQDPEVALDALARAVVAAG-ADALIVHARKAWLNGLSPKENRHIPPL
Q31GB8_HYDCU      KSRIGID------EQEDFDTLVEFVSAIQTAG-VDGVIIHARKAWLQGLSPKENRDVPPL
Q9RTQ8_DEIRA      KHRIGID------DLDSYEHLTGFVRTVAAAG-CEQFIVHARKAWLSGLSPKENREIPPL
Q48A03_COLP3      KSRIGID------DLDSYEFLHTFIEEVSKAD-CRHFIIHARKAWLTGLSPKQNRDVPPL
I3Y9Y5_THIV6      KTRIGID------DRDSYGELVDFVGTQAAAG-CDALIVHARKAWLKGLSPKENRDVPPL
A1SZA5_PSYIN      KTRIGID------DLDSYAFLCDFVGKVAEKG-CDTFVVHARKAWLSGLSPKQNRDVPPL
DUSA_SHEON        KTRIGID------EQDSYEFLTHFIDTVMAKG-CGEFIIHARKAWLQGLSPKENREIPPL
D4ZFH6_SHEVD      KTRIGID------DQDSYEFLSEFVDTVSDVG-CDTFIVHARKAWLQGLSPKQNREIPPL
DUSA_HAEDU        KHRIGID------TLDSYAFLCDFIDKIQPY--SQDFIVHARKAWLSGLSPKENREIPPL
DUSA_PASMU        KTRIGID------DLDSYEFLCEFVQKVHEAG-CQEFIIHARKAWLSGLSPKENREIPPL
DUSA_HAEIN        KTRIGID------ELDSYEFLCDFIEKVQGKG-CQEFIIHARKAWLSGLSPKENREIPPL
H2FUK3_OCESG      KTRIGID------EQDSYEFLCTLVDKVAEAG-VDALIVHARKAWLQGLSPKENRDIPPL
B7VI79_VIBA3      KTRIGID------DQDSYEFLTKFVSTVSEKGGCEQFTIHARKAWLSGLSPKENREIPPL
DUSA_VIBCH        KTRIGID------DQDSYEFLTQFIATVAEKGGCEQFTIHARKAWLSGLSPKENREIPPL
F7YIQ8_VIBA7      KTRIGID------DMDSYEFLTDFISLVSEKGGCEQFTIHARKAWLSGLSPKENREIPPL
DUSA_VIBPA        KTRIGID------DQDSYEFLTDFVSIVSEKGGCEQFTIHARKAWLSGLSPKENREIPPL
DUSA_YERPE        KTRIGID------QLDSYEFLCEFVQTVAERGECEIFTIHARKAWLSGLSPKENREVPPL
E0SEJ3_DICD3      KTRIGID------DQDSYAFLCDFIRTVSEQGGCDTFIVHARKAWLSGLSPKENREIPPL
A4W5G2_ENT38      KTRIGID------DQDSYEFLCDFIDTVAGKGECETFIIHARKAWLSGLSPKENREIPPL
DUSA_SALTY        KTRIGID------DQDSYAFLCDFIDTVSGQGECEMFIIHARKAWLSGLSPKENREIPPL
DUSA_ECOLI        KTRIGID------DQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPL
A1U1Y0_MARHV      KHRIGIN------GRESWEELCEFIETVAAAG-CKTFIVHARIAVLEGLSPKENRDIPPL
DUSA_PSESM        KHRIGIN------GRDSYAELCDFVGTVHDAG-CQSFTVHARIAILEGLSPKENRDIPPL
F6AA13_PSEF1      KHRIGID------GRDSYAELCDFVGQVRDAG-CRSFTVHARIAILSGLSPKENREIPPL
DUSA_PSEAE        KHRIGIN------GRDSYAELCDFVGQVREAG-CRSFTVHARIAILEGLSPKENREVPPL
DUSA_PSEPK        KHRIGIN------GRDSYAELSDFVGQVREAG-CRSFTVHARIAILEGLSPKENREIPPL
E1V4R8_HALED      KCRIGID------DQDEDADLAHFIQRVADAG-CSTFIVHARKAWLEGLSPKQNRDVPPL
F2K1D2_MARM1      KHRIGLD------DQQEYSILRDFVGTVADTG-IQTFIVHARNAILQGLSPKENREIPPL
A6VYA3_MARMS      KHRIGLD------DQEDYSVVRDFVGDVATTG-VTTFIVHARNAILEGLSPKENREVPPL
                  * * *:         :    .                  *** * * .:..  ** :* *

O51243_BORBU      RHEFVYKLKKENKNLFIEINGGINN----------SEQIKKHLSF-VDSVMIGRSAFENP
Q46I48_PROMT      QYERVQNLKNNRPELIIELNGGINT----------INDSIEALKV-FDGAMVGRAAYSHP
Q7TVB2_PROMA      EYEKVAKIKKCRPNLKIELNGGLQN----------QYDCIKALKT-FDGVMVGRAIYSNP
I7JJ65_9BURK      KYDYVSRLKADFPDANFVINGGISN----------YELAMQLLEE-FDGIMLGRLAWHEP
C9RM69_FIBSS      HYEFVHRLKAEMPELNLSINGGIKT----------LDQIEEQLKD-LDGVMVGREAYENP
H9UGA5_SPIAZ      RYEDVYRLKCEFPELEIEINGHIGS----------VADIRGHLQQ-VDAVMLGRAAYDNP
D3PTQ5_MEIRD      RYDWVYRLKQDFPHLTIVLNGGVRT----------LEEVQAHLAK-VDGVMLGRAVYEDP
DUSAL_THET8       RHDWVHRLKGDFPQLTFVTNGGIRS----------LEEALFHLKR-VDGVMLGRAVYEDP
B0SLP0_LEPBP      RYEDVYRLKSDFPNLPITINGGIKT----------HAEIKTHLTK-ADGVMVGRAAYDNP
D3S9S9_THISK      DYERVFRLKAEFPELTIVLNGGLDD----------VRVAHGYLER-VDGVMFGRLAYHQP
L0DW19_THIND      DYPRVYRLKQEFPMLEIVVNGGIDG----------PEQGLPHLAH-VDGVMVGRAAYHRP
A8LSP6_DINSH      DYPLVVRMKQAFPGLHLSINGGITD----------LDQAAAHLASGLDGVMIGRAAYHEP
DUSA_XYLFA        RYDWVYRLKRERPELAVVLNGGITS----------VEAGLDHLLM-VDGVMLGRAAYQDP
DUSA_XANCP        RYDWAYRLKQERPALPVVLNGGIAS----------VEASLAHLQH-TDGVMLGRAAYHDP
B2FI91_STRMK      KYDWAYRLKQERPALPVVINGGLAS----------IEAVQAQAAH-VDGVMLGRAAYHDP
Q5QXY6_IDILO      QYERVYRAQKRYPDVPVAINGGIVE----------LHEVKQHLNQ-VHGVMIGRAAYQNP
D5W7L2_PARAM      KYDYAYQLKRDFPQLEIIINGGIKT----------LDEVDTHLQH-VDGVMLGREAYHNP
B1XY95_LEPCP      RYEQVYQLKRDFPQLTIVINGGIRT----------DDEIAAHLAH-VDGVMVGRQAYHEP
F5XWE9_RAMTT      RYELVHRLKRDFPGLVIAINGGVTA----------DDQVAGQLQV-LDGVMVGRQAYHQP
A1VPW7_POLNA      RYELVHRLKKEFAHLTICVNGGITT----------GEQVQGQLLE-LDGVMIGREAYHNP
DUSAL_SYNY3       RYEDVYQLKKDFPQLLIEINGGITQ----------TEQIQQHLSH-VDAVMVGRAAYENP
D4ZTQ2_ARTPN      RYGDVHRLKAEFPHLTIEINGGFTT----------LEQVKQQLKK-VDAVMMGRAAYDNP
B1XI00_SYNP2      RYADVYRLKQDFPHLWIEINGGITT----------LEHIQTHLTQ-VDAVMVGRAAYDNP
B2II58_BEII9      DYPLVHALKRTYPEIPIMINGGLVT----------HESMQEQLRH-VDGVMVGRQAYQEP
D7A646_STAND      DYGRVHRLKQRLPHVPISINGGIAS----------LEEAQAQLAH-VDGVMLGRAAYHQP
Q6N8D4_RHOPA      DYDRVYRLKQAMPQVPIIINGGIGS----------IAEAKRHLEH-VDGVMLGRAAYQEP
Q31GB8_HYDCU      KYDWVRQIKALFPELEIAINGGIQTPQAGLNFLEILKDDEQSLPA-VDGVMLGRAVYEKP
Q9RTQ8_DEIRA      RYEVVQQLKADFPQLTVVLNGGVKS----------LTEAQQALAW-ADGVMIGRAAYQEP
Q48A03_COLP3      DYDRVYQIKNDFKDLEVSINGGIKT----------FSEANEHLQH-IDGVMIGREIYNSP
I3Y9Y5_THIV6      RYEVVQQLKTDFPDLTISINGGIKT----------LIEAADFLTT-LDGVMIGREAYHNP
A1SZA5_PSYIN      DYERVYQLKKDFPQLTIAINGGIKT----------LDECETHLQY-LDGVMLGREIYTNP
DUSA_SHEON        DYDRVYQLKRDYPALNISINGGITS----------LEQAQTHLQH-LDGVMVGREAYQNP
D4ZFH6_SHEVD      DYQRVYRLKKDYPDLHISINGGVKT----------LDECHEHLQH-IDGVMVGREAYQNP
DUSA_HAEDU        DYERVYQLKRDFPQLNISINGGIKT----------IDEIKQHLTK-VDGVMVGREAYQNP
DUSA_PASMU        DYERVYQLKRDFPHLLMSINGGIKT----------LEEMQQHLQY-MDGVMVGREAYQNP
DUSA_HAEIN        DYIRVYQLKRDFPHLTIAINGGIKT----------IEEMKQHLQY-VDGVMVGREAYQNP
H2FUK3_OCESG      DYDRVYQLKRDYPGLTIAVNGGIKT----------LEEARVHLAN-LDGVMLGREVYQNP
B7VI79_VIBA3      DYDRAYQIKKDFSDLVIAVNGGITT----------LEQTKEHLQH-LDGVMIGREAYHSP
DUSA_VIBCH        DYPRAYQIKRDFPHLTIAVNGGVKS----------LEEAKLHLQH-LDGVMIGREAYQNP
F7YIQ8_VIBA7      DYSRAYQLKKDFPHLVIAVNGGVKT----------LAEVSEHLQH-LDGVMIGREAYQSP
DUSA_VIBPA        DYPRAYQLKQDFSHLTIAINGGVKS----------LEEAKVHLQH-LDGVMIGREAYQSP
DUSA_YERPE        DYERVYQLKRDFPALTIAINGGVKT----------LAEAKEHLKH-LDGVMMGREAYQNP
E0SEJ3_DICD3      DYPRVYQLKRDFPSLTLAINGGVKT----------LAEARQHLQH-VDGVMVGREAYQNP
A4W5G2_ENT38      DYPRVYQLKRDFPHLTMSINGGIKS----------LEEAKTHLQH-MDGVMVGREAYQNP
DUSA_SALTY        DYPRVYQLKRDFPHLTMSINGGIKS----------LEEAKEHLRH-MDGVMVGREAYQNP
DUSA_ECOLI        DYPRVYQLKRDFPHLTMSINGGIKS----------LEEAKAHLQH-MDGVMVGREAYQNP
A1U1Y0_MARHV      KYDWVYRLKQAYPHLEIIINGGIKT----------FGECHEHLTH-TDGVMLGREAYHNP
DUSA_PSESM        RYDVVAQLKTDFPELEIVLNGGIKT----------LEQCSEHLQT-FDGVMLGREAYHNP
F6AA13_PSEF1      RYDIAAQLKQDFADLELILNGGIKT----------LEACQEHLHT-FDGVMLGREAYHNP
DUSA_PSEAE        RYEVAAQLKKDFPDLEIVLNGGIKT----------LEACREHLQT-FDGVMLGREAYHNP
DUSA_PSEPK        RYDIAAQLKRDFPDLEIVLNGGIKT----------LDECQAHLET-FDGVMLGREAYHNP
E1V4R8_HALED      NYPRIHRLKAQHPELHIGLNGGLKT----------LENCQAQLAH-VDSVMVGREAYQNP
F2K1D2_MARM1      KYDYVYQLKKDFPDLEIIINGGIKT----------IDETISHLDH-VDGVMMGREAYNNP
A6VYA3_MARMS      KYHYVHQLKKDFPDLEIIINGGIKT----------LDECKEQLAH-VDGVMVGREAYHNP
                   :      :       .  ** .                         . *.**  :  *

O51243_BORBU      Y-FIANASREFLNETD----------------------------EILTRKDILMQMVEYI
Q46I48_PROMT      F-LWTKIDSLIFGQKE----------------------------KYLSRSKIIKKLIPFA
Q7TVB2_PROMA      L-MWKEIDDIFFGEKK----------------------------VKINASIILRGLIPYA
I7JJ65_9BURK      R-AFMNIATTEFERSE-----------------------------PPNFTFIRDALIGYA
C9RM69_FIBSS      W-FLHDADARIFGDVRPESNDPAEIIAGNA--------------RPATRKALLEAYLPYV
H9UGA5_SPIAZ      Y-LFADIEREIFGGAAGAAAAGAAGGAMDAAGASGAGAGAGAVWQAPSRAEVIARTIEFL
D3PTQ5_MEIRD      F-VLEPADRRLFGEAH----------------------------AT-TRLEVAQAMLRYA
DUSAL_THET8       F-VLEEADRRVFGLPR----------------------------RP-SRLEVARRMRAYL
B0SLP0_LEPBP      F-LFADVDSLYFGSKE----------------------------GTITRESILQKMIPYV
D3S9S9_THISK      W-VLAEVDRLFFDETG----------------------------GV-TREAVLQGLIDMA
L0DW19_THIND      F-ELACVDRLYYGDSR----------------------------DP-TIVEVVDGLVALA
A8LSP6_DINSH      ARVLGDADRRFFGG-A----------------------------ETVSAETAVEAMRPYI
DUSA_XYLFA        Y-ILHQFDCALSN--A----------------------------PLLPRALLLRALRPYV
DUSA_XANCP        Y-VLHQLEAALSG--R----------------------------PERARADLLQAYQPYV
B2FI91_STRMK      Y-LLHQLEALHTG--A----------------------------PLQARGDLLRAMRPYI
Q5QXY6_IDILO      W-LLTQLDS-LSETKP----------------------------AELTREAVVTAMIPYI
D5W7L2_PARAM      Y-VLADVDARFYGSTQ----------------------------SPPTRDQVEAKLIEYC
B1XY95_LEPCP      W-QMAGWDLRFFGEAA----------------------------PAGERAQVEAAWMDYL
F5XWE9_RAMTT      W-WLASWDAAFLGAPA----------------------------RELSRETVEEQMVGYM
A1VPW7_POLNA      W-WLASWDADFFGAGG----------------------------ESITREQVEAQMCDYM
DUSAL_SYNY3       Y-LFATVDRDIYHKTN----------------------------LVPSRAEIIERMLPYV
D4ZTQ2_ARTPN      Y-LFAIADREIYGDNI----------------------------NPPTRHQVVEQMLPYI
B1XI00_SYNP2      Y-LFATVDRDIYGEAI----------------------------QPKSRHEIVEEMLPYI
B2II58_BEII9      A-MLLSVDPLFFGEEA----------------------------PLTDATDVVEAFIPYV
D7A646_STAND      E-LLLRVDSLFFGEAD----------------------------PHEDAFAAVEAFEPHI
Q6N8D4_RHOPA      W-RLLEVDPELYGETA----------------------------PYPSMKEALEALIPYI
Q31GB8_HYDCU      Y-LLTEVDALYYDDAS----------------------------PVKSREAVLEAMYPYI
Q9RTQ8_DEIRA      Y-LLAAADRDVFGEDA----------------------------QAVSRREAIEAYLPYV
Q48A03_COLP3      Y-MLADADNEIYQSDT----------------------------IKLSRSEVIDLMVPYI
I3Y9Y5_THIV6      W-MLAQADRVVFGDDH----------------------------PPLTRHEVLDRFLPYA
A1SZA5_PSYIN      Y-LLSSVDQRLFAGNE----------------------------KILTRFEVLEKMYPYI
DUSA_SHEON        Y-MLAQVDQVLCGSTK----------------------------AVMSREAVIEAMLPYI
D4ZFH6_SHEVD      Y-ILAEVDQRLCGSNK----------------------------PVLSRDAVLDKFIPYI
DUSA_HAEDU        A-LLGEIDQQLFDQNQ----------------------------PLITARIAVENMLPYI
DUSA_PASMU        S-LLGYIDQALFDPTC----------------------------PVVTPREAVEKMFPYI
DUSA_HAEIN        S-LLGQIDQALFDPNA----------------------------PIVTAHEAVESMLPYI
H2FUK3_OCESG      Y-LLARVDAELFNDEH----------------------------EAPSRHQVIRQLLPYI
B7VI79_VIBA3      F-ILAEVDQQIFGLDT----------------------------PIKKRSQVVEEMYPYI
DUSA_VIBCH        Y-LLAEVDQQIFGLET----------------------------PVKKRSQVIHEMMPYI
F7YIQ8_VIBA7      Y-LLAEVDQTIFGMDT----------------------------PIKKRSQIIEEMFPYI
DUSA_VIBPA        Y-LLASVDQELFGSNA----------------------------PVKKRSEIVEEMYPYI
DUSA_YERPE        G-ILTQVDRELFDPNA----------------------------PVVDSVKAIEALYPYI
E0SEJ3_DICD3      G-MLAQVDRELFGADS----------------------------AAPDQADVVRAMYPYI
A4W5G2_ENT38      G-ILATVDREIFGIEG----------------------------ADSDPVAVVRAMYPYI
DUSA_SALTY        G-ILAAVDREIFGADT----------------------------TDADPVAVVRAMYPYI
DUSA_ECOLI        G-ILAAVDREIFGSSD----------------------------TDADPVAVVRAMYPYI
A1U1Y0_MARHV      W-LLAEVDAALFGEPP----------------------------AVTSRHEALRAMFPFI
DUSA_PSESM        Y-LLAQVDQQLFGSVA----------------------------PVISRHAALESMRPYI
F6AA13_PSEF1      Y-LLAEVDQQLFASTN----------------------------TPVSRHEAMLAMRPYI
DUSA_PSEAE        Y-LLAAVDSQLFGSEA----------------------------PPLSRSEALLRLRPYI
DUSA_PSEPK        Y-LLAEVDQQLFGSDA----------------------------PVVSRSEALAQLRPYI
E1V4R8_HALED      W-LLASVDSRLYGEPD----------------------------PAEDRHSAARALRPYI
F2K1D2_MARM1      W-ILSDIDTKVYGASA----------------------------CVNNRFEALERFVPYV
A6VYA3_MARMS      W-ILSQVDEVLFGGQP----------------------------LVNDRYEALEAFVPYV
                                                                              

O51243_BORBU      KEY--ENYLSINILFKHLMGIVFSKEGAKKFRQNLTAPFPKN---LKKHEILLKAIETLP
Q46I48_PROMT      QKH-LENGGRLWQISRHILNLIENIPNAKILRQELSEKCQTQ---KADISILKKIAQQLE
Q7TVB2_PROMA      EKH-LSKNGRLWDICKHTLHLVQGVKGARKWRNELSQKAQNP---KAELIILEKAARQLE
I7JJ65_9BURK      KKN-IENGGSLREVVNPVLGFMNGLKGARKFRQILSNPDLLK---RNDISIIGEAFAPFL
C9RM69_FIBSS      EKQ-TAEGCPATILVKHLYGLFAGLPGARKFRATLSNESPRAHLYGGAAALIRKAMELVG
H9UGA5_SPIAZ      ETR-WRDDFPRAPLG-HLMGLYHGMPGARRWRGTISTELAAG---TAPAEVLRRAQEVLP
D3PTQ5_MEIRD      EAQ-LEQGTPLWAMARHMLNLFKGQPRGRLWRRVLSERACRR---GAGVEVLQEALERVA
DUSAL_THET8       EEE-VLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSE--------GRSLQALDRALRLME
B0SLP0_LEPBP      QSV-RMSGGKVSHILRHILGLYHGEKGAREFRRYFTNGMHLT---SATESILESYLQR--
D3S9S9_THISK      REM-RAKGVPLARLTRHVLGLFHGEPGARQWRRILTEGAHRA---DAGPELIERAAEPCL
L0DW19_THIND      EEM-RGRGFPLARLTRHVLGLFHGAPGARQWRRILTEEARDR---DAGPELIARAAMPCL
A8LSP6_DINSH      ADH-LARGGKLAQITRHMLGAFAGRPGARGWRRVLSEEGHRP---EAGLGTLDRALAHIA
DUSA_XYLFA        EVW-LEQGLTLRHIVRHLFGLFHGQPGGRVFRQVLTQGGQRS---DADWSLVEQALSIIE
DUSA_XANCP        QAQ-LDQGLALKHMTRHILGLFHGQPGGRVFRQVLSEGAHRP---GAGWELVEQASQRTD
B2FI91_STRMK      EAR-LREGLALKHITRHLLGLFHGQPGGRAFRQVLSEGAHRP---GAGWSLIEQALAVTE
Q5QXY6_IDILO      DNH-IRQGGRAWHVARHMLGLFQGMTGGKRWRQYLSVKGPRA---TSAEQLLYGALAFRD
D5W7L2_PARAM      ATE-MARGTYLGAITRHALGLYRGEAGARGWRRVLSDSKRLA---ARDLTIFDEARQHLR
B1XY95_LEPCP      QAQ-HLGGRPWPQAMRHALGLWNGVAGARSWRQFWSDHHHKL---RPPHEL--SALSPRP
F5XWE9_RAMTT      ERQAQAHGTPWHAVARHMMGLYNGLPGARRWRQVWSDHRLKG---RPAREVMAMAHRREP
A1VPW7_POLNA      VREAAGHGTPFSAIARHMLGLRHGLPGSRRWRQVWSDHKLKT---MDPRDVMMLAHADVQ
DUSAL_SYNY3       EER-LRHGDRLNQITRHLLSLFNGQPRAKFWRRTLSDSTLLA---SAGPELLQTALQAQK
D4ZTQ2_ARTPN      ENW-LSQGGRLNSVVRHILQLFAGQPGTKAWKRHLSENAHLP---GAGVEVVKAALAEVP
B1XI00_SYNP2      ERA-TKAGVKLHSISRHMLSLFLGQPGTKAWKRFITEEGRGT---TVGREIIEQALALVS
B2II58_BEII9      EAR-RAEGVPLHSMTRHILGLFNGRPGARAFRRHLATEGLAR---DAGADVLRAAAAHVV
D7A646_STAND      AAH-LATGGRLHDITRHMLGLFTGRPGARAFRRRLAIDGVKA---DAGLDVLRAAVDEVR
Q6N8D4_RHOPA      ERQ-LAQGLRLHAITRHVIGAYQGVPGARAFRRYLSEFGVKP---DADASVLLKAMVAVT
Q31GB8_HYDCU      ENH-LTQGGKLNQVSRHMLGLFAGLPGGRMWRRYISENAFKS---GAGIDVLQEAYRRVV
Q9RTQ8_DEIRA      AAQ-VEAGQPLNRMMKHTLGLFAGQPGARHWKRTLSEQGHKP---GAGLDVVRAALAGVP
Q48A03_COLP3      DET-IANGGRAWHVLRHMLGLCNGLSGARKFRQHLSECAGKD---GAGGQVLLDAFNKVT
I3Y9Y5_THIV6      QRE-LAAGVPLSAMSRHLLGLFQGQPGGRAWRRRISENAHRP---GAGIEVLSTAAPRAD
A1SZA5_PSYIN      EQQ-LSNGAYFKHVARHMLGLFQGLPGARAWRRHLSENGHLP---GAGIEVMEKAAAFVV
DUSA_SHEON        EAH-LQVGGRLNHITRHMIGLFQGLPGARAWRRYLSENAHKN---GAGIEVVKLAYQSVQ
D4ZFH6_SHEVD      EKH-LMDGGRLNHITRHMTGMYQGEPGSRAWRRYISENAHKP---GAGIEVIEQARKNID
DUSA_HAEDU        EQQ-LSKGVYLNHIVRHMLGAFQNCKGARQWRRHLSENACKQ---GAGIEVVEQALRFVT
DUSA_PASMU        EQQ-LSQGVYLNHVVRHMLGAFQSCKGARQWRRYLSENAHKA---GAGLEVVEKALSFVA
DUSA_HAEIN        EQQ-LSQGIHLNHIVRHILGAFQNCKGARQWRRYLSENAFKQ---GAGIEVVETALSFVE
H2FUK3_OCESG      ERE-LTQGTYLGNITRHTLGIFQGMPGARAWRRHLSENAHKR---GAGPEVVEAAMARVP
B7VI79_VIBA3      ERQ-LSNGASLGHISRHMLGLFQSMPGARQWRRYISENAHKK---GAGIEVIQTALAKIP
DUSA_VIBCH        ERE-LSQGTHLGHMTRHMLGLFQNMPGARQWRRHISENAHKP---GAGLEVVEQALAKIP
F7YIQ8_VIBA7      ERQ-LAQGSYLGHITRHMLGMFQNMPGARQWRRYISENAHKP---GAGIEVVQAALAKIP
DUSA_VIBPA        EAQ-LAKGAYLGHITRHMLGLFQNMPGARQWRRHISENAHKP---GSGLEVLQDALAKIP
DUSA_YERPE        EQE-LSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKP---GAGVSVVEEALALVS
E0SEJ3_DICD3      ERE-LSAGASLGHITRHMLGLFQGLPGARQWRRYLSENAHKP---GADAAVVERALALVK
A4W5G2_ENT38      ERE-LSNGTYLGHVTRHMLGLFQGIPGARQWRRYLSENAHKA---GADIEVLEHALRLVA
DUSA_SALTY        ERE-LSQGAYLGHITRHMLGLFQGIPGARQWRRYLSENAHKA---GADVAVLEQALKLVA
DUSA_ECOLI        ERE-LSQGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKA---GADINVLEHALKLVA
A1U1Y0_MARHV      QQE-LDRGVYLTHITRHIMGLFLGQPGGRQFRRHLSENANKP---GSGLEVVEQALAKVR
DUSA_PSESM        AAH-IASGGNMHHVTRHMLGLGLGFPGARRFRQLLSVDIHKA---ENPLLLLDQAAKFLE
F6AA13_PSEF1      ERH-MAAGGLMHHVTRHMLGLAQGFPGARRFRQLLSADIHKS---TDPLAIFDQAAQILH
DUSA_PSEAE        ERH-QAEGGAMHHVTRHILGLAQGFPGSRRFRQLLSVDVHKA---ADPLRVFDQALELLA
DUSA_PSEPK        VAH-MESGGAMHHVTRHILGLAQGFKGARRFRQLLSADIHKA---AEPLAVFDQAVELLQ
E1V4R8_HALED      AQR-LEEGARLNHLTRHLLGLFQGCPGGRRFRRHLSENAHRD---GAGLAVFDDALGLVA
F2K1D2_MARM1      EEQ-LAKGERLMHMTRHILGIFHGLPGGKQFRRYLSENGHKT---DAKIDILLEAIEIVR
A6VYA3_MARMS      ERK-LQEGERLMHLTRHILGIFQGEAGGKQFRRYLSENGHKA---DAQVNVLLEAIELVK
                                         .    .  .   :                        

O51243_BORBU      EKILNSNS---------------------
Q46I48_PROMT      DAGQ-------------------------
Q7TVB2_PROMA      DAGL-------------------------
I7JJ65_9BURK      -----------------------------
C9RM69_FIBSS      ETRD-------------------------
H9UGA5_SPIAZ      KI---------------------------
D3PTQ5_MEIRD      ASGEVAPELAHHAGL--------------
DUSAL_THET8       EEVGEEGEKEKPGPRGQREAAPGPAREGV
B0SLP0_LEPBP      -----------------------------
D3S9S9_THISK      RACT-------------------------
L0DW19_THIND      GDGHTAGESAGG-----------------
A8LSP6_DINSH      GPHRLAG----------------------
DUSA_XYLFA        DQETYAAVV--------------------
DUSA_XANCP        DQARRIAA---------------------
B2FI91_STRMK      READRAAA---------------------
Q5QXY6_IDILO      DHSQHVSSLTS------------------
D5W7L2_PARAM      EPLEIFE----------------------
B1XY95_LEPCP      GTAAGRERIAP------------------
F5XWE9_RAMTT      LAA--------------------------
A1VPW7_POLNA      KAA--------------------------
DUSAL_SYNY3       FPGVLVA----------------------
D4ZTQ2_ARTPN      -----------------------------
B1XI00_SYNP2      QTNAIADPVSMVSGRK-------------
B2II58_BEII9      KARSFRPVEAVSG----------------
D7A646_STAND      RAEGRRDDRRMLVA---------------
Q6N8D4_RHOPA      ERAEIAAA---------------------
Q31GB8_HYDCU      NEIQRMEEQNR------------------
Q9RTQ8_DEIRA      DDVLDARA---------------------
Q48A03_COLP3      LP---------------------------
I3Y9Y5_THIV6      PPLGG------------------------
A1SZA5_PSYIN      EG---------------------------
DUSA_SHEON        TDLVAQ-----------------------
D4ZFH6_SHEVD      C----------------------------
DUSA_HAEDU        E----------------------------
DUSA_PASMU        S----------------------------
DUSA_HAEIN        S----------------------------
H2FUK3_OCESG      EESVVYS----------------------
B7VI79_VIBA3      KELNV------------------------
DUSA_VIBCH        YQELGV-----------------------
F7YIQ8_VIBA7      KELNV------------------------
DUSA_VIBPA        KELNV------------------------
DUSA_YERPE        PSYYESVGG--------------------
E0SEJ3_DICD3      LV---------------------------
A4W5G2_ENT38      DKR--------------------------
DUSA_SALTY        DKR--------------------------
DUSA_ECOLI        DKR--------------------------
A1U1Y0_MARHV      EPEPSLET---------------------
DUSA_PSESM        GH---------------------------
F6AA13_PSEF1      GR---------------------------
DUSA_PSEAE        GR---------------------------
DUSA_PSEPK        GR---------------------------
E1V4R8_HALED      EDQPALAG---------------------
F2K1D2_MARM1      KQTTKHTCI--------------------
A6VYA3_MARMS      NHQRKG-----------------------