CLUSTAL format seed alignment for MF_02042

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

H8GJW4_METAL      ---------------------------MRIGPYQLANNLVLAPMAGITDRPFRETCKRFG
I3Y823_THIV6      ----------MNDRSSLSQNPRPPRRPFAIGPYQFANNLILAPMAGITDRPFRTLCRRLG
K0C8N6_CYCSP      -------------------------------------------MAGITDRPFRQLCRELG
C6WTJ3_METML      ---------------------------MQIGNHILKNNLVVAPMAGVTDRPFRQLCKKMG
A1K9K3_AZOSB      -----------------MPAFSRPRPPMQFAGFSLRNNLFVAPMAGVTDRPFRQLCKKLG
F2L7Q2_BURGS      --------------------------MPVLGSHVLRNNLFVAPMAGVTDRPFRQLCKRLG
Q63QY0_BURPS      --------------------------MPVLGSHVLRNNLFVAPMAGVTDRPFRQLCKRLG
B1XS21_POLNS      ---------------------------MNIGPHTLANKLFVAPMAGVTDRPFRQLCKKLG
I1XF20_METNJ      ----------------------MADKALSIGPYTLPNNLFLAPMAGVTDRPFRQLCRKLG
I1YJ72_METFJ      -----------------------MINPIQIGPYTLPNNLFLAPMAGVTDRPFRQLCRKLG
DUSB_PSEPK        ------------------------MSAVRIGQYTLRNNLILAPMAGVTDQPFRTLCQRLG
DUSB_PSESM        ------------------------MSAVRIGPYTVHNGLILAPMAGVTDQPFRQLCRQLG
DUSB_PSEAE        ------------------------MSVVRIGPYTLPNRLILAPMAGVTDRPFRQLCRRLG
A1U6A0_MARHV      -----------------------MLPTAKIGPYTLPNPLIVAPMAGVTDRPFRLLCRRMG
DUSB_VIBPA        ---------------------------MKIGNYQLKNNLIVAPMAGVTDRPFRELCLRYG
DUSB_VIBCH        ---------------------------MKIGNYQLKNNLIVAPMAGVTDRPFRELCLRYG
DUSB_SALTY        ---------------------------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG
DUSB_ECOLI        ---------------------------MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMG
DUSB_YERPE        ---------------------------MRIGHFQLTNCLIAAPMAGITDRPFRALCHGMG
DUSB_HAEIN        ---------------------------MRIGSYQLRNRVLLAPMAGITDQPFRRLCAYYG
DUSB_PASMU        ---------------------------MRIGSYQLKNRIFLAPMAGITDQPFRRICTHYG
DUSB_HAEDU        ---------------------------MRIGQYEINSRIFLAPMAGITDQPFRRLCSQLG
DUSB_SHEON        ---------------------------MQIGPYQLKNQLIVAPMAGVTDQAFRNLCLRYG
Q0A8T9_ALKEH      MQTLSPDWRGPTRSGYARARTAQPDWNMNIGPWKLSGRVLLAPMAGITDLPFRQLCRQWG
F6DAS4_THICA      -------------------------MTWQLGPYQLPNQLVLAPMAGLSDSALRQICYQQG
Q31II6_HYDCU      --------------------------MMTLFDSSTPT-IALAPMAGITDRVYRDICRESG
DUSB_XANCP        ---------------------------MQIGPYTIAPKVILAPMAGVTDKPFRLLCKRLG
D2UFV1_XANAP      ---------------------------MRIGPYTIDPKVILAPMAGVTDKPFRLLCKRLG
H8L346_FRAAD      ---------------------------MHIGPYSIAPALVLAPMAGVTDKPFRLLCKRLG
B1XYS5_LEPCP      ---------------------------MQIGPHLLPNRLFVAPMAGVTDRPFRQLCKRLG
I0HMX7_RUBGI      ---------------------------MRLGAFELPNRLFVAPMAGVTDRAFRKLCKRLG
D5X6Q8_THIK1      --------MSNPADLTPSAPPAGLAGGLRLGRHLLPNRVFAAPMAGVTDRPYRRLARQLG
A0LDW2_MAGMM      -----------------MDTYDPIEKLFAQNLAGGPPPLVLAPMAGVTDAPFRLIARRYG
A5WE12_PSYWF      --------MANDMTLPTTLADHPLLQPLYIGGLEIQNRLMVAPMAGVTDNPFRRLCKSFG
C5BP66_TERTT      --------------------------MFHIGNYAITSIALLAPMAGVTDAPFRRICREMG
                                                             ***::*   *  .   *

H8GJW4_METAL      AGLTVSEMTASNPAFRQHARTLLKSDG-EGESGVRSVQILGTDPAQMAEAARFNVDRGAH
I3Y823_THIV6      AGLAVAEMVAANTALWGSRKSLRRLDY-RGEQGPIAAQIVGSNPAEMAEAAKVNVGLGAH
K0C8N6_CYCSP      AGLAVSEMTASNPALRKHRRTLLKLDH-NGENEPRSVQIVGTNPKQMAEAALFNQANGAQ
C6WTJ3_METML      AGLAVSEMVTSNSLLYGSEKTKRRANH-EGEVNPISVQIAGADPKMMAEAAKHNVDNGAQ
A1K9K3_AZOSB      AGLAVSEMVTSNSLLYGSAKTQRRANH-DGEVDPISVQIAGADPAMMAEAARHNADRGAQ
F2L7Q2_BURGS      AGYAVSEMVASNAQLWKSEKTMRRANH-AGEVEPIAVQIAGADPAMMAEAARYNVANGAQ
Q63QY0_BURPS      AGYAVSEMVASNAQLWKSEKTMRRANH-AGEVEPIAVQIAGADPAMMAEAARHNVANGAQ
B1XS21_POLNS      ADYAVSEMVASNALLWKSEKTQRRANH-IGEFKLIAVQIAGADPAMMAAAAKINVDHGAQ
I1XF20_METNJ      AGMVVSEMITANKALWASKKSLLRANH-EGEPEPRSVQIAGADPQMMAEAARHNVAEGAH
I1YJ72_METFJ      AGMAVSEMITANKALWTSKKSLLRANH-DGEPEPRSVQIAGADPHMMAEAARHNVAQGAH
DUSB_PSEPK        AGMVVSEMVSSDMSLWNSRKSSLRRIH-EGDPEPRSVQIAGGDAQMMAAAAKANVEAGAQ
DUSB_PSESM        AGLVVSEMVTSDMSLWNSRKSRLRMIH-AGDPEPRSVQIAGGDAQMMADAARANVELGAQ
DUSB_PSEAE        AGMVVSEMVTSDVRLWNSRKSRLRLIH-DGEDEPRSVQIAGGDPAMLAEAAQRNVELGAQ
A1U6A0_MARHV      AGLAVSEMVIADSKLWHTRKSRTRLNH-EGEPEPRSVQIAGGDPEMLADAARQNAEFGAQ
DUSB_VIBPA        AGMAVSEMMSANPKLWKTSKSKQRMVH-EGESGIRSVQIAGSDPQLMADAAQFSVENGAQ
DUSB_VIBCH        AGMAVSEMMSCNPALWKTAKSQNRMVH-EGESGIRSVQIAGSDPQLMAEAAQFSVENGAQ
DUSB_SALTY        AGLTVSEMMSSNPQVWESDKSRLRMVH-VDEPGIRTVQIAGSDPVEMADAARINVESGAQ
DUSB_ECOLI        AGLTVSEMMSSNPQVWESDKSRLRMVH-IDEPGIRTVQIAGSDPKEMADAARINVESGAQ
DUSB_YERPE        AGMAVSEMLSSNPEVWRTDKSRLRMVH-VDEPGIRNVQIAGNDPDEMAAAARINVASGAQ
DUSB_HAEIN        AGLTFSEMMSTNPQVWHTEKSKLRLAH-SEDLGLNAVQIAGSDPLEMAQAAAINVEYGAQ
DUSB_PASMU        AGLTFSEMMSTNPQVWHTEKSKLRLAH-HQEAGINAVQIAGCDPDEMAKAAQINVEYGAE
DUSB_HAEDU        AGLTFSEMMSTNPDVWHTEKSRLRLAH-HAEIGINAVQIAGSEPTEIAEAAKINVAYGAQ
DUSB_SHEON        AALAVSEMLSSNPEVWDTDKSRQRMTH-SGEEGIRSVQIAGADPELMAQAAQFNVEQGAH
Q0A8T9_ALKEH      AALAVSEMLSADPTLRKTRKSQWRATL-ADDECPRVAQIAGADPVALAEAARYNVQRGAQ
F6DAS4_THICA      AGYTIGEMLSAQTHLWESRKSATRQVN-LADPEPRAIQLLGIDPITLADAAQRQVEQGAQ
Q31II6_HYDCU      ASYAVSEMVASKKQLRESAKSSTRHAD-KTETSPRIVQLLGTHPEELVDAALWQQSQGAD
DUSB_XANCP        AGLAVSEMTISDPRFWGTRKSLHRMDH-AGEPDPISVQIAGTEPQQLAEAARYNVDHGAQ
D2UFV1_XANAP      AGLAVSEMTLSDPRFWQTRKSLQRMDH-AGEPDPISVQIAGTQPQQLADAARYNADHGAQ
H8L346_FRAAD      AGYAVSEMTTSDPRMWHTRKSLWRMDH-RGEPDPVGVQIAGGDPRYLADAARYNVDHGAQ
B1XYS5_LEPCP      AGYAVSEMVTSRPELRDSLKTSRRLDH-TGEVAPIAVQIAGTEPEMMAEAARYNIERGAQ
I0HMX7_RUBGI      AGYAVSEMITSRPDLRDSRKTSRRADH-SGEGAPIAVQIAGTEPAMMADAARHEIDRGAQ
D5X6Q8_THIK1      AGYCVSEMVTSRADLRDTLKTSRRANH-DGEAAPIAVQIVGTDPEQIAEATRYNLERGAD
A0LDW2_MAGMM      ADLTVSEMIASQAMIRNTSKSLLIGTA-HEEEHPLSVQIAGSDPQVMAEAARMNVDRGAE
A5WE12_PSYWF      AGHAVSEMMTADATLYAHKKSLFRANF-EGEIAPISAQIAGADVDKIAEAAQYQVNNGAQ
C5BP66_TERTT      AGLATSEMVTSDVNLWQSRKTRARLSALEQELAPVSVQIAGSEPQMMAQAAVAAVVQGAQ
                  *    .**      .    ::         :      *: * .   :. *:      **.

H8GJW4_METAL      IIDINMGCPAKKVCSVAAGSALLRDKKRVGSILDAVVAAA-----CVPVTLKIRTGWDAQ
I3Y823_THIV6      IIDINMGCPAKKVCKVAAGSALLRDELLVGRILDAVVAAV-----DAPVTLKIRTGWSPE
K0C8N6_CYCSP      IIDINMGCPAKKVCNVAAGSALLRDEPLVEEILKSVVSAV-----HIPVTLKIRTGWDPL
C6WTJ3_METML      IIDINMGCPAKKICNVMAGSALLKDEPLVAQILRAVVGAV-----DVPVTLKIRTGWDKQ
A1K9K3_AZOSB      IIDINMGCPAKKVCNVMAGSALMQDEPLVARILEAVVKAVP----DTPVTLKFRTGWNRQ
F2L7Q2_BURGS      IIDINMGCPAKKVCNVAAGSALLQNEPLVVRIVSAVVAAVGSGPDAVPVTLKIRTGWDRD
Q63QY0_BURPS      IIDINMGCPAKKVCNVAAGSALLQNEPLVQRIVEAVVGAVGAGPDAVPVTLKIRTGWDRD
B1XS21_POLNS      IIDINMGCPAKKVCNVAAGSALLRDEPLVQQILEAVVNAVGIGPDAVPVTLKIRTGWDRQ
I1XF20_METNJ      IIDINMGCPAKKVCNVMAGSALLQHEKLVGEILEAVVNAV-----DVPVTLKIRTGWDSN
I1YJ72_METFJ      IIDINMGCPAKKVCNAMAGSALLAHETLVADILEAVVSAV-----SVPVTLKIRTGSDRE
DUSB_PSEPK        IIDINMGCPAKKVCNKAAGSALLRDEALVSEILHAVVSAV-----DVPVTLKIRTGWDRA
DUSB_PSESM        IIDINMGCPAKKVCNKAAGSALLKDEQLVNDILQAVVAAV-----DVPVTLKIRTGWDRD
DUSB_PSEAE        IIDINMGCPAKKVCNKAAGSALLRDEALVAEILDAVVRAV-----DVPVTLKIRTGWDRD
A1U6A0_MARHV      IIDINMGCPAKKVCNKAAGSALMKDEKLVREILEAVVKAV-----DVPVTLKMRTGWDRD
DUSB_VIBPA        IIDINMGCPAKKVNKKLAGSALLQYPTIIEEILKAVVNAV-----DVPVTLKTRTGWDTD
DUSB_VIBCH        IIDINMGCPAKKVNKKLAGSALLRYPDVIEDILKAVVNAV-----NVPVTLKTRTGWDTD
DUSB_SALTY        IIDINMGCPAKKVNRKLAGSALLQYPDLVKSILIGVVNAV-----DVPVTLKIRTGWAPE
DUSB_ECOLI        IIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAV-----DVPVTLKIRTGWAPE
DUSB_YERPE        IIDINMGCPAKKVNRKLAGSALLQHPDLVKQILSAVVNAV-----DVPVTLKIRTGWSPE
DUSB_HAEIN        IIDINMGCPAKKVNRKLAGSALLQFPDLVEKILREVVSAV-----NVPVTLKIRTGWDKS
DUSB_PASMU        IIDINMGCPAKKVNRKMAGSALLQYPDLVKQILNKVVKSV-----TVPVTLKIRTGWDKD
DUSB_HAEDU        IIDINMGCPAKKVNKKMAGSALLREPQLVARILDAVVNAV-----DVPVTLKIRTGWDKT
DUSB_SHEON        IIDINMGCPAKKVNKKLAGSALMQNPPLVKDILQAVVAAV-----DVPVTLKIRTGWEPE
Q0A8T9_ALKEH      VIDINMGCPAKKVCNRMAGSALLADEPLVRRILTAVVSAV-----EVPVTLKYRTGPSPE
F6DAS4_THICA      VIDLNLGCPAKKVCQQAAGSALLAYPEQVTKIFQAVVAAV-----SVPVTVKIRTGIDAE
Q31II6_HYDCU      IIDLNMGCPAKKVCDVAAGSALMGQPERVADIFKSLTEAI-----DLPVTVKIRTGTDVD
DUSB_XANCP        LIDINMGCPAKKVCNAWAGSALMRDEDLVARILSAVVRAV-----DVPVTLKIRTGWDCD
D2UFV1_XANAP      LIDINMGCPAKKVCNAWAGSALMRDEALVARILSAVVKAS-----PVPVTLKIRTGWDSD
H8L346_FRAAD      IIDINMGCPAKKVCNVWAGSALLQDEALVGRILEAVVAAV-----DVPVTLKIRTGWNHE
B1XYS5_LEPCP      IIDINMGCPAKKVCNVWAGSALMQNESLALRIIDAVVAASA--PHGVPVTLKMRTGWCQE
I0HMX7_RUBGI      IVDINMGCPAKKVCNKWAGSALMQDEALAIAIVEAVVGACA--PLGVPVTLKMRTGWCAA
D5X6Q8_THIK1      IIDINMGCPAKKVCNRWAGSALMQDEDLAARLVEAAVAAAR--PFDAPVTLKMRAGWCEA
A0LDW2_MAGMM      IIDINMGCPVKKVVKGQAGAALMRDEALVARILAAVVAAV-----PVPVTLKIRLGWDKS
A5WE12_PSYWF      IIDINMGCPAKKVCRKLAGSALLKDEDLVARLLDATVAAV-----DAPVTLKTRLGYENG
C5BP66_TERTT      IVDINMGCPAKKVCKKAAGSALLRDEALVDAITRTVVEAV-----DVPVTLKIRTGWDTS
                  ::*:*:***.**:    **:**:        :    . :        ***:* * *    

H8GJW4_METAL      NRNAVAIARIAENAGIAALTVHGRTRACKFNGEAEYDTIAAVKQAVRMPVIANGDIDSPE
I3Y823_THIV6      HRNALQIARIAQEAGIAALTVHGRTRACHYGVPAEYDTLRAIRESVAMPLIANGDIATAA
K0C8N6_CYCSP      SKNAPTIAKIAEQAGIQALAIHGRTRACKYDGNAEFDTIKLVKQSINIPVFANGDITTPQ
C6WTJ3_METML      NRNAIQIAKMAEDLGVQALAMHGRTRACAYMGDAEYDTIAAVKQAIKIPLIANGDITTPE
A1K9K3_AZOSB      NKNAPIIARIAEESGIQGIAIHGRTRADQYMGDAEYDTIALVKTLVKIPVIANGDITTPQ
F2L7Q2_BURGS      HKNALTIARLAEEAGISMLTVHGRTRADLYRGEAEYETIAAVKASVKIPVVANGDITSPR
Q63QY0_BURPS      HKNALRIATLAEAAGISMLTVHGRTRADLYRGDAEYDTIAAVKAAVRIPVVANGDITSPR
B1XS21_POLNS      NKNAIEIAQLAEKSGISMLTVHGRTRADLYHGEAEYETITTVKNYVRIPVVANGDINSPE
I1XF20_METNJ      NRNGVQIARIAEDAGIQALAVHGRTRADAYKGDAEYDTIAEIKSRIAIPVIANGDIETPE
I1YJ72_METFJ      NKNGVRIAQIAEQAGIQALAVHGRTRADLYRGDAEYETIAEIKSRIHIPVIANGDIDCPE
DUSB_PSEPK        NKNGLNVAKIAEQAGIQALAVHGRTRADLYTGEAEYDTIGAIKQAVSIPVFANGDITSPE
DUSB_PSESM        NRNGLTVAKIAEQAGIQALAVHGRTRADLYTGEAEYDTIAMIKQAVSIPVFANGDIDSPE
DUSB_PSEAE        NRNGVTVAKLAEQAGIQALAVHGRTRADLYTGEAEYETIAAIKQAVSIPVFANGDIDSPE
A1U6A0_MARHV      NRNAPVIARMAEDAGIQALAVHGRTRADKYNGDAEYDTIAEVKASVGIPVFANGDITTPE
DUSB_VIBPA        NKNCVQIAKLAEDCGIQALALHGRTKACMYKGEAEYDSIKAVKEAISIPVIANGDIDSPE
DUSB_VIBCH        NKNCLSIAQLAEDCGIQALALHGRTRACMYKGEAEYDSIKAVKAAVSIPVIANGDIDSPE
DUSB_SALTY        HRNCVEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPIIANGDITNPH
DUSB_ECOLI        HRNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPL
DUSB_YERPE        HRNCIEIAQLAENCGIQALTIHGRTRSCLFNGEAEYDSIRAVKQTVSIPVIANGDITDPH
DUSB_HAEIN        NRNCVQIGKIAEQCGIQALTVHGRTRACLFEGEAEYDNIKAVKQAIAIPVIANGDIDSAR
DUSB_PASMU        NRNCLEIAKIAEQCGIQALTIHGRTRSCMFEGEAEYDNIKAVKEQLSIPIIANGDITSAE
DUSB_HAEDU        HKNFLQIAKIAEKAGISALTIHGRTRDCLFNGQAEYESIKAVKQAVFMPIIANGDITSPQ
DUSB_SHEON        HRNGVQIAQIAEDCGIASLAVHGRTRQCMYKGNAEYDTIKAIKQNVSIPVVANGDIDSPE
Q0A8T9_ALKEH      RRNAVAIARMAEDAGVAALTLHGRTRVQAYQGQAEYRSVEAVCRAVDIPVVANGDIDSPD
F6DAS4_THICA      HKNALTIAQIAQDSGLAAVTVHGRTRADKFNGHAEYDTIALIKQQLSIPVIANGDICSAE
Q31II6_HYDCU      NINAVEIAKLAQELGLKAITIHGRTRADKFNGQAEYDTIKAVKQAVDIPVIANGDICSPK
DUSB_XANCP        HRNGPTIARIAQDCGIAALAVHGRTRDQHYTGTAEYATIAQIKAALQIPVIANGDIDSPQ
D2UFV1_XANAP      HRNGPTIARIAEDCGIAALAVHGRTRDQHYSGQAEYATIAQIKAMLRIPVIANGDIDSPH
H8L346_FRAAD      NVNGLQVARIAEASGIAALAVHGRTRDQHYTGEAEYATIAAIKQAVAIPVLANGDITDAR
B1XYS5_LEPCP      QKNALQIARAAQDAGIAMVTVHGRTREQGYKGEAEYRTIAAVKAALQIPVVANGDIDSPE
I0HMX7_RUBGI      ERNALRLARAAEAAGIAMVTVHGRTREQGYQGQAEYDTIAAVKAALAIPVVANGDIDSPA
D5X6Q8_THIK1      ARNAPRIARRAEAAGAAMLVVHGRTREQGYGGEAEYATLAEVKRSVGIPVVANGDIDSPQ
A0LDW2_MAGMM      NLNGARIGQIAEQQGVRMLTVHGRTRMQMYRGHADWQCIASIKQAVTIPVVGNGDLHTPQ
A5WE12_PSYWF      QENILRVAKRAEEAGIAAIAIHGRTREDKYGGQARYDLIREVKQLVNIPVIANGDIDSPQ
C5BP66_TERTT      QRNAINIARIAENNGIQALAVHGRTRACRFNGTAEYDTIAQVVNSVAIPVIANGDIDSPA
                    *   :.  *:  *   :.:****:   :   * :  :  :   : :*:..***:  . 

H8GJW4_METAL      KARFVLDRTGADGLMIGRAACGNPWIFEQILRFFESGEKRWEPSAAAI------------
I3Y823_THIV6      QARRILDSTGADAIMIGRAAQGRPWIFRDIAAGLAAGLAPDEPASDGIHAPSGIPPNDWI
K0C8N6_CYCSP      RARDVLHHTNADGLLIGRGAQGRPWIFREIDHFLKTGETLAPPDFEEI------------
C6WTJ3_METML      KAKFVLDYTGADAVMIGRAAQGRPWIFREIEHYLTTGTHLLPPTVDEI------------
A1K9K3_AZOSB      KARHVLDYTGADGVMIGRAAQGRPWIFREIEHFLATGEELPPPLVSDI------------
F2L7Q2_BURGS      KARAVLDATGADALMIGRAAQGRPWLFREIDHFLQTGETLPAPSVDEI------------
Q63QY0_BURPS      KAKAVLDATRADALMIGRAAQGRPWLFREIDHFLQSGELLPPPRIDEI------------
B1XS21_POLNS      KAEQVLKITGADAIMIGRAAQGRPWIFREINHYLETGGKLPTPKINEI------------
I1XF20_METNJ      KALLVLQQTGADGLMIGRAAQGNPWIFQQINHFLQTGESLAKPSVTEV------------
I1YJ72_METFJ      KAHFVLSKTGADGLMIGRAAQGNPWIFQQILHYLQTGTHLPAPAIDDV------------
DUSB_PSEPK        KARAVLETTGVDGLLIGRAAQGRPWIFREIEHYLRTGEHLPAPQLDEV------------
DUSB_PSESM        KARHVLQATGADGLLIGRAAQGRPWIFREIEHYLLTGKTLPALQSSEV------------
DUSB_PSEAE        KARKVIEQTGVDALLIGRAAQGRPWIFREIDHYLRTGEHLPAAPLPEV------------
A1U6A0_MARHV      KARQVLSHTGADGLLIGRGAQGRPWIFREILHYLETGEHLPQPPMDEV------------
DUSB_VIBPA        KAKFVLEYTGADALMIGRPAQGRPWIFQEIHHYLENGTTMDELPTQEV------------
DUSB_VIBCH        KARYVLEYTGADALMIGRPAQGRPWIFQEIQHFLEHGTTMPELPISEV------------
DUSB_SALTY        KARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEV------------
DUSB_ECOLI        KARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEV------------
DUSB_YERPE        KARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPMPLGEV------------
DUSB_HAEIN        KAKFVLNYTGADAIMIGRAALGNPWLFQAVENLIEHNSISQMPSLKEK------------
DUSB_PASMU        KAKYVLDYTNADAIMIGRGSLGNPWLFRVMESLIEKDSIVLEPSLNEK------------
DUSB_HAEDU        KAKDVLDYTGADAVMIGRGSFGRPWLFQELKQFLETGDII-DLSIDEK------------
DUSB_SHEON        KARFVLDYTGVDALMIGRGAQGRPWIFREIQHYLETGNKLAPIEVAEQ------------
Q0A8T9_ALKEH      KARQVLDETGADAVMVGRAAQGRPWLFQAIHTYLETGTRVATPSLAVR------------
F6DAS4_THICA      QAQFVLNYTNADAIMLGRGVLGRPWLFKQIQNWITRKVHLADPSWPIK------------
Q31II6_HYDCU      EAQFVLKYTGSDGIMIGRAAQGYPWIFREIAHFLKTGDCLPSPSFAEF------------
DUSB_XANCP        KAAQVLRDTGVDAVMIGRAAQGRPWIFGEVAHYLATGALLPPPSLAFV------------
D2UFV1_XANAP      KAAQVLAATGADAVMIGRAAQGRPWIFGEIAHYLAHGEVSPAPSLAFV------------
H8L346_FRAAD      KARAVLHATGVDGLMIGRAAQGRPWIFREISHFLATGKELPPLSPAEA------------
B1XYS5_LEPCP      KAARVLRATGADAVMIGRAAQGRPWIFREIAHHLATGQAMDAPRTLQV------------
I0HMX7_RUBGI      KAAAVLARTGADALMIGRAAQGRPWIFREIAHYLATGTLLAPPATHEV------------
D5X6Q8_THIK1      KAAAVLRQSGADAVMIGRAAMGRPWLFGQVAAYLEHGVLLPDPAPEQW------------
A0LDW2_MAGMM      EAKEKWLLSGVDGLMIGRAAMGCPWLFGQIAHYLRSGQEKPPPDLAEQ------------
A5WE12_PSYWF      KAIEVYEQTGCDAIMIGRAAQGQPWLFRDIAHYLQTGEILPAPSIEQL------------
C5BP66_TERTT      KARKVLQHTGAQAVMIGRAALGNPWLFGQIEQFLEQGEIRELPATSEV------------
                  .*      :  :.:::**   * **:*  :   :                          

H8GJW4_METAL      KDTIVSHLEQLYDFYGESTGVRIARKHIGWYLG---PFGLIGRETLQRINTAT-QSAEQL
I3Y823_THIV6      KDILSAHLEELYLFYG-PHGVRIARKHIAWYCRHL-PGAASFREDINRTETPTDQLSRVL
K0C8N6_CYCSP      RQVVIRHITQLHQFYGDIMGVRIARKHIAWYFKHLDTSLLPLVKKSFSIQEPQQQLDFMD
C6WTJ3_METML      HAVMLEHLHDLYEFYGDLTGMRMARKHISWYTKGL-AGSAQFRHTMNTLQTIELQLQAIN
A1K9K3_AZOSB      HQVCREHLADLYAFYGEDTGVKVARKHISWYTKGL-VGSAAFRRTMNQLPDIPAQLAAVD
F2L7Q2_BURGS      QQLLNEHLEDHYAFYGEFTGVRTARKHIGWYTRGL-SGANAFRHRMNTLDTTREQLAAVN
Q63QY0_BURPS      RQVMNEHLEDHYAFYGEFTGVRTARKHIGWYTRGL-SGANGFRHRMNTLETTREQLAAVN
B1XS21_POLNS      QTIMNAHLLDHYEFYGEHIGLRTARKHIGWYCKGL-RDSHAFRQRMNTADDCKTQLQMVN
I1XF20_METNJ      QQILICHLNTLYDFYGEYSGVRMARKHIAWYSKGL-RNGNAFRQQMNTLGKAEHQLAFTD
I1YJ72_METFJ      RDILITHLKTLYDFYGEYSGVRMARKHIAWYSKGL-RDGNAFRQEMNQLEDPAQQLAFTA
DUSB_PSEPK        ERILLEHLAALHAFYGDVMGVRIARKHVGWYLATR-PGGKEFRARFNALEDTQAQCANVR
DUSB_PSESM        ERILLEHLAALHVFYGDVMGVRIARKHVGWYLATL-PGAREFRALFNRLEDTEAQCANVR
DUSB_PSEAE        QSILLEHLAELHLFYGEEMGVRIARKHVGWYLATL-PGAREFRAQFNRLQDTDAQCASVR
A1U6A0_MARHV      ERILAGHLEELHRFYGELMGVRIARKHVGWYLQSH-DDSKQFRQRFNAIDDALEQKDSIA
DUSB_VIBPA        KAIMLGHVNALHEFYGEYLGPRIARKHVGWYLKEH-EQASEFRRTFNAIDAAPLQIEALE
DUSB_VIBCH        KDIMLGHVTALHQFYGEYLGPRIARKHVSWYLQEH-EQASAFRRTFNAIETADQQLDALE
DUSB_SALTY        KRLLCTHVRELHDFYGQAKGYRIARKHVSWYLQEH-APDDQFRRTFNAIEDASEQLEALE
DUSB_ECOLI        KRLLCAHVRELHDFYGPAKGYRIARKHVSWYLQEH-APNDQFRRTFNAIEDASEQLEALE
DUSB_YERPE        QRLLDGHIRELHDFYGPGKGFRIARKHVSWYLQEH-APNDQFRRTFNAIEDASEQLEALE
DUSB_HAEIN        CGQILRHIQELHQFYGEQKGYRIARKHVAWYLQGI-QPDSVFKQTFNAISDPKEQLIVLE
DUSB_PASMU        CNVILQHIQELHQFYGVEKGCRIARKHVAWYLQGI-QPNPVFRQAFNAITDPKEQLIALE
DUSB_HAEDU        CQLMLKHIEDLHHFYGEQKGYRIARKHVGWYLDQL-TPGSNFKRTFNALSSTTEQLIALK
DUSB_SHEON        RQVMLEHLTKLYDLYGEYKGIRFARKHIGWYLDQE-DQR-QFRADFNQLETAAEQYSLVE
Q0A8T9_ALKEH      KQTLLTHLREIHRFYGDWMGPRIARKHIKWYLQAL-QVDRCHVQPLMQPTAPEAQRVAVA
F6DAS4_THICA      QQIIAEHLQAIYQLYGDEQGVRMARKHLGWYAQYL-PAGDRLRQSFNRLTKTTEQQACIL
Q31II6_HYDCU      QQVMTRHFSELEILYGEHLGHKIARKHLGWYSQYL-PNGTELRKRFNRLENTQAQLNLIN
DUSB_XANCP        RDTLLGHLEALHAFYGQPQGVRIARKHLGWYAKDH-PQSADFRAVVNRAETPEAQLALTR
D2UFV1_XANAP      RDTLLGHLHALYAFYGEAQGVRIARKHLGWYAKDR-PENAAFRAVVNRAESAQAQLALTA
H8L346_FRAAD      GAILHEHLLQLYAFYGEETGVRIARKHLGWYAKDR-PENAGFRAVVNRAETAEAQLRCAD
B1XYS5_LEPCP      RDWLLEHLQDHYSLYGERSGVRTARKHIGWAVHAL-PGGAHFRAEMNRIETTADQWRAVD
I0HMX7_RUBGI      RGWLLEHLEEHYALYGEHAGVRSARKHIGWAVRGL-PGGEDFRAAMNTIAEAGAQWRAVD
D5X6Q8_THIK1      RDWLFAHLDDHYALYGEAIGVRTARKHVGWYVAAL-PEGETFRRQFNTLGSAAEQLAALR
A0LDW2_MAGMM      HALVLEHFDRLIDFYGPHIGNRMARKHLAWYAKGL-PNSAHYRSAINHCPTPEETRHLVD
A5WE12_PSYWF      RQIVLTHLQELYDFYGEYSGCRIARKHIAWYTSGI-EDSNAFRQAMYGEESTAGQYKVVD
C5BP66_TERTT      CKTIERHLTDLTCFYGEEAGVRIARKHTRWYLQGY-RDAETFLKHFNTLNTLQSQLMAVR
                        *.     :**   * : ****  *                              

H8GJW4_METAL      RLMHLALDFLT-----------------------
I3Y823_THIV6      AFFDQCPDTENQAA--------------------
K0C8N6_CYCSP      KIFHALTQTQHQVA--------------------
C6WTJ3_METML      DFFVELKTKNERLVYIENDADDSETDASSALAA-
A1K9K3_AZOSB      EFFGQLAEADSRLSYQTGQADFG-DEQPQELAA-
F2L7Q2_BURGS      DYFDAQRALSDHLVYVDDEDS----ATDPIQ---
Q63QY0_BURPS      EFFDAQQALSDRLVYVDDEDGDRGEPDDSNQLAA
B1XS21_POLNS      DYFDEMKSHSDRLLFLEAA---------------
I1XF20_METNJ      AFFAQLAE---KDSLAA-----------------
I1YJ72_METFJ      AFFTQLAQAQQKDTLAA-----------------
DUSB_PSEPK        AFFSERRQSLETEDGQGVAA--------------
DUSB_PSESM        EFFSQGCKGPDNQNDKEVAA--------------
DUSB_PSEAE        QFFAER-----QNNGTGVAA--------------
A1U6A0_MARHV      QYFAGLR------NGEVFAA--------------
DUSB_VIBPA        GYFDNVAS--------------------------
DUSB_VIBCH        GYFDNVAS--------------------------
DUSB_SALTY        AYFENFA---------------------------
DUSB_ECOLI        AYFENFA---------------------------
DUSB_YERPE        AYFENLA---------------------------
DUSB_HAEIN        DFFNLILD--KKNVRTTT----------------
DUSB_PASMU        GFFNLILMDKEKNVRTTT----------------
DUSB_HAEDU        DLVKSIR---------------------------
DUSB_SHEON        YYFDELVQN-------------------------
Q0A8T9_ALKEH      DCLSRLNEAPAAAPA-------------------
F6DAS4_THICA      DYFDALDTRLELEPC-------------------
Q31II6_HYDCU      HYFDTL----------------------------
DUSB_XANCP        DYFDALIAGVPPPLHAAA----------------
D2UFV1_XANAP      DYFDALIAGVPPALSNAA----------------
H8L346_FRAAD      HYFQALAAGDQATLQTA-----------------
B1XYS5_LEPCP      DYLSDLADAHERWPQAAAEPTTIEETLAA-----
I0HMX7_RUBGI      RWFAELAEHHPQLPCATAANDDLVVRSA------
D5X6Q8_THIK1      GFLDSGSRAAPLAA--------------------
A0LDW2_MAGMM      DFYRGVHNTQAA----------------------
A5WE12_PSYWF      KFLSSHSARER-----------------------
C5BP66_TERTT      QFLERSVTHEENAA--------------------