CLUSTAL format seed alignment for MF_02043

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DUSC_PSEAE        ------------------MQIALAPMEGLVDEILRDVLTRVGG------IDWCVTEFIRI
DUSC_PSEPK        ------------------MQIALAPMEGLVDNILRDVLTRVGG------IDWCVTEFIRV
F6A8H3_PSEF1      ------------------MQIALAPMEGLVDEILRDVLTQVGG------IDWCVTEFIRV
A4VKE3_PSEU5      ----------------------------------------MGG------VDWCVTEFIRV
DUSC_PSESM        ------------------MQIALAPMEGLVDDILRDALTKVGG------IDWCVTEFIRV
DUSC_NEIMB        ------MIDRQTNEPKQKTRIILAPMQGLVDDVMRDLLTRIGG------YDECVSEFVRI
A5WHX3_PSYWF      --------MCFSDQFFSSPVRLLAPMEGLTDPLMRQILTQIASDLGRP-YDWSVSEFIRI
DUSC_SHEON        ------------------MRVILAPMEGVVDDLMRDILSSINP------YDLLVTEFVRV
A8H2N9_SHEPA      -------------MLDCSVRIILAPMEGVVDDLMREILSAINP------YDLMVTEFVRV
DUSC_VIBCH        ------------------MRVILGPMEGVLDHLMRDMLTQIND------YDFCVTEFVRV
F0LS22_VIBFN      ----------------------------MLDHLMREMLTQIND------YDFCVTEFVRV
DUSC_VIBPA        ------------------MRVVLGPMEGVLDHLMRQILTEIND------YDLCVTEFVRV
Q6LNY4_PHOPR      ---------------------------------MREMLTNIND------YDLCVTEFVRI
DUSC_HAEIN        ------------------MRVILAPMQGVLDPFVRELLTEVND------YDLCITEFVRV
DUSC_PASMU        ------------------MRVILAPMQGVLDPFVRQLLTQVNQ------YDLCVSEFVRV
DUSC_HAEDU        -------------MIKSIPRIMLAPMQGVLDPFMRKLLTAYND------YDLCVSEFVRV
DUSC_SALTY        ------------------MRVLLAPMEGVLDALVRELLTEVND------YDLCITEFVRV
DUSC_ECOLI        ------------------MRVLLAPMEGVLDSLVRELLTEVND------YDLCITEFVRV
A9MKT1_SALAR      -------------------------MEGVLDSLVRELLTEVND------YDHCITEFLRV
DUSC_YERPE        ------------------MRVILAPMEGVLDSLVRELLSEVND------YDLCITEFLRV
Q7N6N4_PHOLL      ------------------MRVLLAPMEGVLDSLVRELLSEINE------YDLCITEFLRV
A4WCH7_ENT38      ------------------MRVLLAPMEGVLDSLVRELLTEVND------YDLCVTEFLRV
R4YSZ4_OLEAN      ------------------MRIVLAPLEGVMDHTVRELLTGLGG------YDLCITEFLRV
E1SW95_FERBD      ------------------MRVILAPMEGVLDHRMRQLLSELNP------YDLCVTEFIRV
F2K2J1_MARM1      --------------------MAVAPMEGVMDHIMRSLLSSIGG------MDYLVSEFIRV
A6W1E8_MARMS      MNNSLKATLTLKNPTNNSIVLAVAPMEGVMDHTMRALLSQTGG------MDYLVSEFIRV
Q6MNE4_BDEBA      ------------------MKLFLAPMEGVVDWVMRDTLTRLGG------IDQCVTEFLRV
C5BMN5_TERTT      ------------------MRIFLAPMEGVVDHHMRRTLHAVKGNAQQSGIDLCVTEFVRV
Q1QZQ6_CHRSD      ------------MTQVASGRIGLAPMEGVIDVVTRELLSADGA------LDWTVTEFVRV
E1V8G5_HALED      ------MVEVDVVNLLHDGRIGLAPMEGVIDAATRDLLTRTAG------IDWTVTEFVRV
DUSC_RALSO        -----------------MSRLLLAPMEGVADFVMRDVLTSVGG------YDGCVSEFVRV
B2UFU6_RALPJ      -------------------------MEGVADYVMRDVLTQAGG------YDGCVSEFVRV
DUSC_CUPNH        -----------------MSRLFLAPMEGLADYVLRDVLTDTGG------YDGCVSEFVRV
C4ZNZ1_THASP      ------------------MRLLLAPMEGVADFVLRDVLTAIGG------YDLAVSEFVRV
Q21U18_RHOFT      ------------------MAILLAPMEGLLDFVLRDILTRVGG------VDRCVSEFIRV
DUSC_AZOVI        ------------------MRIALAPMEGLVDELLRDLLTRVGG------IDWCVTEFVRV
                                                                    *  ::**:*:

DUSC_PSEAE        TD-RLLPATAFHKLAPELRDGS-RTRAGTPMRVQLLGSDPACLADNAAFACELGAPVIDL
DUSC_PSEPK        CD-RLLPASSFDKLAPELRQGA-RTAAGVPMRVQLLGSDPVCLAENAALACELGAPVIDL
F6A8H3_PSEF1      TD-RVLPRSTYRKLAPELFNGA-RTAAGTPLRVQLLGSDPKCLGDNAAYACVLGAPVIDL
A4VKE3_PSEU5      SD-RLLPQSSFGKLAPELQNGA-LTRAGTPVRVQLLGSDPICLADNAAFACTLGAPAIDL
DUSC_PSESM        SE-RLMPAHYFYKYASEFHNGA-KTDAGTPLRLQLLGSDPVCLAENAAFACELGAPVLDL
DUSC_NEIMB        TH-TVHSRSIWLKYVPEIANGN-KTFSGTPCTVQLLGSDADNMAANALEAVRFGANKIDL
A5WHX3_PSYWF      TH-HVLPEHVFYRFVPELLQSG-TTDSGTPIHVQLLGSEPKLMGANALAAAELGAPAIDL
DUSC_SHEON        VD-QLLPEKVFLKLCPELLSGG-YTPSGTPVRVQLLGQEPNCMAENAMRAIELGSHGVDA
A8H2N9_SHEPA      VD-QLLPEKVFHRLCPELQTGG-QTLSGTPVRVQLLGQNPDWMAENAVRAIELGSNGVDV
DUSC_VIBCH        VN-LLLPDHVFYRLCPELQQGS-KTPSGVPVKVQLLGQDPHWMAENAIRAAELGAYGIDL
F0LS22_VIBFN      IN-LPLPDHVFYRLCPELKQGS-RTKAGVPVKVQLLGQEPHWMAENAVRAAELGACGVDL
DUSC_VIBPA        ID-QVLPDHVFHRLCPELMQGS-QTTSGVPVHVQLLGQEPHWMAENAIRAAELGARGIDL
Q6LNY4_PHOPR      ID-SLLPSSVFYRLCPELHHGG-KTTSGTPVRVQLLGQEPVWMAENAYRASNLGSAGIDI
DUSC_HAEIN        VD-QLLPEKVFYRLCPELKNQG-FTSSGTPVRVQLLGQHPKCLAENAIRAIDLGSHGIDL
DUSC_PASMU        VD-QLLPTKVFYRLCPELYQQG-LTASGTPVRVQLLGQHPQWLAENAQRAIELGSHGIDL
DUSC_HAEDU        VD-QRLPKKTFYRLAPELLQGG-LTDSGTPIRVQLLGQYPQWLAENAQLAIELGSYGIDF
DUSC_SALTY        VD-QLLPVKVFHRICPELHHAS-RTPSGTPVRIQLLGQHPQWLAENAARATALGSYGVDL
DUSC_ECOLI        VD-QLLPVKVFHRICPELQNAS-RTPSGTLVRVQLLGQFPQWLAENAARAVELGSWGVDL
A9MKT1_SALAR      VD-QLLPEKSFYRLCPELHNHS-RTKSGTLVRIQLLGQHPGWLAENAVRAVELGSHGVDL
DUSC_YERPE        VD-QLLPAKSFYRLCPELHNQS-RTQSGTLVRIQLLGQYPEWLAENAARAVALGSYGVDL
Q7N6N4_PHOLL      VD-SLLPVKSFYRLCPELRNQS-RTPSGTLVRIQLLGQYPQWLAENAARAIELGSYGVDL
A4WCH7_ENT38      VD-MLLPAKSFYRLCPELHRQS-RTTSGTLVRIQLLGQYPEWLAENAARAVELGSYGVDL
R4YSZ4_OLEAN      SNNQLLPPRTFYQLAPELENNG-FTPSGVPVRMQLLGSQPNTLAMNAQRAIELGSHGIDL
E1SW95_FERBD      IE-QPIPDKVFYRLAPELENGG-KTRNGTPVRVQLLGQDPDWLAYNAERAIALGSPGVDI
F2K2J1_MARM1      SQ-NPIPVTGFRRLVPEIDKNS-RTEHGHPVHIQLLGSNAERIAQSAINAVAAGAKHIDM
A6W1E8_MARMS      TQ-YPIPAATFKHLVPENTNKA-RTTHNHPVHTQLLGSNAELMAESALNATKAGAKHIDV
Q6MNE4_BDEBA      TD-RLHPESVFYKNCPELKTGS-RTRWGTPVFVQLLGGQAEPLALNAQRAVKLGALGVDL
C5BMN5_TERTT      TE-HTLPRKVFLRACPELNEA-----NAYPVRVQLLGSNPATLASNANKAAQLGAPAVDL
Q1QZQ6_CHRSD      VD-TRLPARVFLRHCPELETAACATASGTPVHLQLLGSDPEALAANAVRAQALGARQVDL
E1V8G5_HALED      VD-ARLPPRVFLRHCPELAGGDPRTPSGAPVHLQLLGSDPVALAANARQALALGATSLDL
DUSC_RALSO        TG-SLLPARTYERETPEIRNGG-YTASGTPMVIQLLGSDPEWLARNAAQAATVSPHGIDL
B2UFU6_RALPJ      TG-SLLPARTYERETPEIRNGG-YTASGTPMTIQLLGSDPEWLARNAAYAATLTPHGIDL
DUSC_CUPNH        TG-SLLPARVYERETPEILAGG-YTRSGTPMVIQLLGSDPEWLARNAAYAATLSPHGIDL
C4ZNZ1_THASP      SG-TLLPRRMFERICPEILAGS-RTAAGTPVAVQLLGSDPVLLAENAARLAALSPHGIDL
Q21U18_RHOFT      SN-TLLPDQVFIRVVPELLNGG-RTFAGVPVAAQLLGSDPVCLAENAARLAALGPHGIDL
DUSC_AZOVI        CD-RLLPVAQFEKLAPELRHGW-RTRAGTPMHLQLLGSDPACLAENAALAAELGAPAIDL
                        .   : :  .*                ****  .  :. .*       .  :* 

DUSC_PSEAE        NFGCPAKTVNRSRGGAVLLKEPELMHDIVAAVRRAVPSE-IAVTSKMRLGYDSPDGALDC
DUSC_PSEPK        NFGCPAKTVNKSRGGAVLLKEPELLHAIVREVRRAVPAN-IPVTSKMRLGFDSPDGALEC
F6A8H3_PSEF1      NFGCPAKTVNKSRGGAVLLKEPELLHAIVREVRRSVPAA-IPVTAKMRLGFDHKDLALDC
A4VKE3_PSEU5      NFGCPAKTVNKSRGGAVLLKEPDLLHAILCEVRSAVPAH-IPVTAKMRLGFDSPDGALDC
DUSC_PSESM        NFGCPAKTVNRSRGGAILLKEPELLHTIVSQVRRAVPKD-IPVTAKMRLGYENTDGALDC
DUSC_NEIMB        NFGCPAPTVNKHKGGAILLKEPELIFHIVKTLRGRLPAH-IPLTAKMRLGYEDKSRALEC
A5WHX3_PSYWF      NFGCPAKTVNNHRGGSVLLDEPRLMRDIISAVREAVPAH-IPVSAKIRLGYNDTNNIDDI
DUSC_SHEON        NFGCPAKMVNRSNGGAVLLQYPNTIHDIVRAMRQAVPAE-HPVTAKIRLGYEDKSLFMEN
A8H2N9_SHEPA      NFGCPAKMVNRSNGGAVMLQYPEQLYNVVKAMRDAVPSE-QPVTAKIRLGFNDKSLYMEN
DUSC_VIBCH        NFGCPAKMVNQSKGGAALLQHPELIYQVVKACRDAVPAH-IPVSAKIRLGWEDPEDCFEI
F0LS22_VIBFN      NFGCPAKMVNQSKGGAALLQHPELIYQVIKACRDAVPAD-IPVSAKIRLGWENPDDCFEI
DUSC_VIBPA        NFGCPAKMVNKSKGGAALLQHPELIHSVVKACRDAVPAN-IPVSAKIRLGWENPEDCFEI
Q6LNY4_PHOPR      NFGCPAKSVNKNRGGAVLLKEPEKIYQIVKEVRSAVCPT-KPVTAKVRLGWDDPTHCFEI
DUSC_HAEIN        NCGCPSKTVNGSNGGAALLKQPELIYRATQALRRAVPSE-FPVSVKVRLGWDDISQAFEI
DUSC_PASMU        NCGCPSKTVNGSNGGASLLKQPELIYHATKALRAAVPKA-LPVSVKVRLGWDNSEQAFEI
DUSC_HAEDU        NCGCPSKTVNGSHGGAALLKDPELIYCATKAIREAVPKA-QPVSVKMRLGWDCASQCFEI
DUSC_SALTY        NCGCPSKVVNGSGGGATLLKDPELIYQGAKAMRAAVPSH-LPVTVKVRLGWDSGDRKFEI
DUSC_ECOLI        NCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREAVPAH-LPVSVKVRLGWDSGEKKFEI
A9MKT1_SALAR      NCGCPSKLVNGSGGGATLLKDPELIYRGAKAMREAVPAH-LPVTVKVRLGWDSDARQFEI
DUSC_YERPE        NCGCPSKLVNGSGGGATLLKDPELIYQGAKAMRAAVPAH-LPVTVKIRLGWDSGDRQFEI
Q7N6N4_PHOLL      NCGCPSKTVNGSGGGATLLKDPELIYQGAKAIREAVPAH-LPVTVKVRLGWDSGDRQFEI
A4WCH7_ENT38      NCGCPSKMVNGSGGGATLLKDPELIYRGAKAMREAVPSH-LPVTVKVRLGWDSGDRQFEI
R4YSZ4_OLEAN      NLGCPAKTVNKSKGGATLLKEPQLISDAVTAMRAVVPND-KTLSVKIRLGWDDPSCVHEI
E1SW95_FERBD      NFGCPAKTVNKSKGGAVLLKEPETLYRIVSAMRQAVPAD-QVLSAKIRLGWECTSQTMEI
F2K2J1_MARM1      NFGCPAKRVNGHGGGSVLLQTPEQLHLIMSSLQQVLPSH-IGLSAKIRLGYEDESLLFEN
A6W1E8_MARMS      NFGCPAKRVNGHGGGSVLLQTPDALYDIMSAIRDTLPSD-IPVSAKIRLGFEDEALLFDN
Q6MNE4_BDEBA      NFGCPAKTVNRHDGGASLLKSCDRVFNIVDTVRKAVPAD-VPVTAKIRLGFDDPTKCLEI
C5BMN5_TERTT      NFGCPAKTVNKSRGGACLLNETSLLGEIVSAVREAVPAE-IPVTAKIRLGYENREPYLKN
Q1QZQ6_CHRSD      NFGCPAKTVNRHDGGASLLRQPERVHTVVRAVAEALAPLGIAVTAKIRLGFDDKHVALAC
E1V8G5_HALED      NFGCPAKLVNRHDGGASMLRTPWRLRTAVSAVHDAVGDV-IPVTAKIRLGFADRRLALDC
DUSC_RALSO        NFGCPAKVVNRHGGGAMLLATPELLHRIVSTVRAAVPAR-IAVTAKMRLGVSDTSLAIAC
B2UFU6_RALPJ      NFGCPAKVVNRHGGGAMLLATPEVLHDIVRAVRAAVPAN-ISVTAKMRLGVSDTSRAIDC
DUSC_CUPNH        NFGCPAKVVNRHGGGAMLLTNPELLNRIVASVRAAVPAH-IAVTAKMRLGVSDASLAIDC
C4ZNZ1_THASP      NFGCPAKVVNRHGGGAMLLDRPRLLHDIAAAVRAAVPAA-IPVSAKMRLGIADPSRALDC
Q21U18_RHOFT      NFGCPAKTVNRHGGGAALLDEPELLLAIVAAVRRAVPKT-MPVSAKMRLGVHDDSRALEC
DUSC_AZOVI        NFGCPAKTSTARGADGCCSTSRN--CCMPSSARCAGPCRRCAGDRQDAPGVRPARGRPGV
                  * ***:   .   ...                             :   *          

DUSC_PSEAE        ARALADGGSAHVVVHARTKVDGYRPPAH-WEWVARVAEAVR-----VPVFANGEVWTLDD
DUSC_PSEPK        ATALAEGGSAHLVVHARTKVEGYKPPAH-WEWVARVQDVVK-----VPVFANGEIWTVDD
F6A8H3_PSEF1      ARALAEGGASQIVVHARTKVEGYKPPAH-WEWVARVQEVVS-----VPVYANGDIWSVED
A4VKE3_PSEU5      ARALVAGGAEQLVVHARTKVEGYKPPAH-WEWVARVQEVVP-----VPVYANGDIWSLED
DUSC_PSESM        ARALADGGAAQIVVHARTKVDGYKPPAH-WEWIARIQEVVK-----VPVVANGEIWTVED
DUSC_NEIMB        ACAIAEGGACGLTVHARTKAEGYEPPAH-WEWIRKIRDSVN-----IPVTANGDVFSLQD
A5WHX3_PSYWF      RQAIADSGADWLTIHARTKTQGYKPPAY-WEKIVAFTE-LP-----IPIIANGEIWNAQH
DUSC_SHEON        ALAVYEAGATELAIHARSKVDGYKPPAY-WEYITEVRERLP-----IPVIANGEIWNRDD
A8H2N9_SHEPA      ALAIYEAGASELAVHARSKVDGYKPPAY-WEYITDINAKLP-----IPVIANGEIWNRDD
DUSC_VIBCH        VDAVAQAKADELTVHARTKAGGYKASEIKWHYIDQIRQKCS-----IPLIANGEVWNYAD
F0LS22_VIBFN      VDAVQQAGADELTVHARTKAGGYKASEIKWDYIDQIRQKTH-----IPLIANGEIWNYAD
DUSC_VIBPA        VDAIQSAGANELTVHARTKQGGYKASEIKWEYINKIRERFS-----IPLIANGEIWNFED
Q6LNY4_PHOPR      VDAVAQAGGDEIAIHARTKVDGYKAETIKWDYIHQVKEKSS-----IPIIANGEVWNYQD
DUSC_HAEIN        ADAVEQGGATEITVHGRTKADGYRADRINWKKISEVRERLS-----IPVIANGEIWHWQD
DUSC_PASMU        ADAVQQGGATEITIHGRTKMDGYRADRINWAKINDVRQRLS-----IPVIANGEIWDWQS
DUSC_HAEDU        ADAIQQAGADEITVHGRTKQDGYRAERINWQAIGQIQQRLN-----IPVIANGEILDFNS
DUSC_SALTY        ADAVQQAGASELVVHGRTKAQGYRAEHIDWQAIGEIRQRLT-----IPVIANGEILDWQS
DUSC_ECOLI        ADAVQQAGATELVVHGRTKEQGYRAEHIDWQAIGDIRQRLN-----IPVIANGEIWDWQS
A9MKT1_SALAR      ADAVQQAGATELVVHGRTKEDGYKAECINWSAIGEIRNRLT-----IPVIANGEIWDWQS
DUSC_YERPE        ADAVQQAGATELAVHGRTKEDGYQAERINWQAIGEIRQRLT-----IPVIANGEIWDYQS
Q7N6N4_PHOLL      ADAVQQAGATEMTVHGRTKEHGYRAERINWQAIGEIRQRLS-----IPVIANGEIWDWQS
A4WCH7_ENT38      ADAVQQAGATELVVHGRTKEDGYKAERINWQAIRDIRQRLN-----IPVIANGEIWDYES
R4YSZ4_OLEAN      VDAIVQAGADEITIHARTKEDGYKADAIKWHYIAQVKERLAREDKHFSIIANGEIWTLAD
E1SW95_FERBD      AQAIESAGANELAIHGRTKADGYRADAINWGAIAPVAKALS-----IPVIANGEINGFSD
F2K2J1_MARM1      VSAIEEAGTHALTVHGRTKKDGYKPPAR-WEKIGEINARSK-----MRIIANGDIDDFET
A6W1E8_MARMS      VAAIEAAGVGTLTIHGRTKKDGYKPPAR-WEKIGEIQAKTK-----MTVVANGDITDTKS
Q6MNE4_BDEBA      AQAVEEANATWLTVHCRTKTDGYKPPAY-WDWIPKIKEKTK-----IKLIANGEIWNVAD
C5BMN5_TERTT      ALAIAAAGADELVVHARSKVDGYKPPAY-WEYIAEIRQALS-----IPVVANGEIWTLED
Q1QZQ6_CHRSD      AEAAESGGAAHLVVHARTRREGYRPPAH-WEWIGRIQARLS-----IPVIANGDIWTLED
E1V8G5_HALED      ARATEDGGASQLVVHARTRNEGYRPPAH-WEWIGRIRRRLS-----IPVIANGDIWTLED
DUSC_RALSO        ATALAEGGAASLVVHARTRDHGYRPPAH-WDWIARIADAVR-----VPVVANGEVWTVDD
B2UFU6_RALPJ      ATALAEGGAESLVVHARTRDHGYRPPAH-WDWIARIADAVS-----IPVTANGEVWTVAD
DUSC_CUPNH        ATALAEGGAASLVVHARTRDHGYRPPAH-WDWIARIAAAVD-----VPVIANGDVWTVAD
C4ZNZ1_THASP      AQALADGGAQAIVVHARTREQGYRAPAH-WEWVARIGDAVR-----VPVTANGEVWSVRD
Q21U18_RHOFT      ALALEGGGASELVVHARTRADAYRPPAY-WERIADIRAVVN-----IPVVANGEIWNVQD
DUSC_AZOVI        RRALVEGGVAHLVVHARTKVEGYRPPAS-WEWLARVREAVA-----VPVYANRKSGRRR-
                    *   .    :.:* *::  .*..    *  :  .          . : ** .      

DUSC_PSEAE        YLRCREVSGVEDIMLGRGLVSRPGLARQIAAWRDGGEIREMPWS----------------
DUSC_PSEPK        WRRCREVSGAEDIMLGRGLVSRPDLGLQIAAARDGRDYQPMSWH----------------
F6A8H3_PSEF1      WQRCREVSGAEHFMLGRGVVARPDLARQIAAAKRGQEAGVMTWS----------------
A4VKE3_PSEU5      WRRCREVSGAEDIMLGRGLVSRPDLARQIAAAKAGQQIAPMSWE----------------
DUSC_PSESM        WRRCREICGARDIMIGRGLVARPDLARQIAAAQKGEEVVPMTWA----------------
DUSC_NEIMB        YIGIKTISGCNSVMLGRGAVIRPDLARQIKQYENGGPVKDTD------------------
A5WHX3_PSYWF      AHQCIAQSHTSHVMLGRGAVTRPDLVAQIDNPES--------------------------
DUSC_SHEON        AKRCMQVTGCDSIMIGRGAISLPNLADTIKTGATPYSWAD--------------------
A8H2N9_SHEPA      AERCMSVTGCDNIMVGRGAISLPNLAAHIK-GDDTYTWEQ--------------------
DUSC_VIBCH        GQACIQTTGVDSLMVCRGALNVPNLGNVVKHNHAAMPWHE--------------------
F0LS22_VIBFN      GQACIETTGIDSLMVCRGALNVPNLGNIVKHNHSAMPWHE--------------------
DUSC_VIBPA        GQRCIETTGVDSLMVCRGAFNIPNLGNMVKHNHTPMVWSD--------------------
Q6LNY4_PHOPR      GQACLNVTQTDALMICRGALNLPNLCNVIKRNEAHMPWHH--------------------
DUSC_HAEIN        GQDCLSQTGCQDLMVGRGALNIPNLSHVLKSNAEKMPWYE--------------------
DUSC_PASMU        GQACLAETGCQDLMIGRGALNIPNLSQVVKFNQAKMPWAE--------------------
DUSC_HAEDU        AQKCREITACCGLMIGRGALNTPNLSKVIKYNVAKMAWSE--------------------
DUSC_SALTY        AQACMATSGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPE--------------------
DUSC_ECOLI        AQQCMAISGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPE--------------------
A9MKT1_SALAR      AQACMATSGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPE--------------------
DUSC_YERPE        AQECMKVTGCDAVMLGRGALNVPNLSRVVKYNEPRMPWLE--------------------
Q7N6N4_PHOLL      AQNCQSVTGCDAVMIGRGALHVPNLSRVVKYNEPKMCWQD--------------------
A4WCH7_ENT38      AQACLHATGCDSVMIGRGALNIPNLSRVIKYNEPRMPWPD--------------------
R4YSZ4_OLEAN      AINCRKVSSCDDLMIGRGALATPNLAAVIAGISDKMSWQG--------------------
E1SW95_FERBD      GQRCQAESGCQDLMIGRGALCRPNLGAMVKENAELLSWDA--------------------
F2K2J1_MARM1      LMRCHEMTGCVDFMIGRGSLSNPFVFRQLKHRLESEGHTVKTEQN---------------
A6W1E8_MARMS      LLRCQSITGCQHFMIGRGSLNNPFVFQQIRKELNGQESTADTTN----------------
Q6MNE4_BDEBA      FNRCVEVTQCEDYMIGRGVMSNPFIFSQIKQSLNQQPVEDMSWER---------------
C5BMN5_TERTT      FIRCREVTGCEDFMLGRGLLARPDLALQIKAYTAGEGYLPLSWA----------------
Q1QZQ6_CHRSD      YWKARTLSGCADVMLGRGMLADPWLARRIKHWQRHGEMLPATPW----------------
E1V8G5_HALED      YWKARTLSGCRDVMLGRGALADSGLAPRIRHWQGTGEHLPPTPW----------------
DUSC_RALSO        WARCRAVSGCDDVMIGRGAVSDPFLALRIRGQMARQPSDA--------------------
B2UFU6_RALPJ      WERCRAVSGCSDVMIGRGAVSDPFLAQRIRAQMDQAPSAA--------------------
DUSC_CUPNH        WERCRAVSGCADVMIGRGAVSDPFLALRIRGLMDGSPSDQ--------------------
C4ZNZ1_THASP      WARCREVSAAEDVMIGRGAVSDPWLARRIRGERGTEPDER--------------------
Q21U18_RHOFT      ALRCREESGCDSLMLGRGMVTNPGLALAIRAAMAGPDASPAPWGNVRPDSSLTTSPALYP
DUSC_AZOVI        -IGCREISGVEDVMLGCGLVSRPDLARQIAMRAPDARSSR--------------------
                               *:  * .  . :   :                               

DUSC_PSEAE        -----ELLPLLRDFWLQARRKLAPRYAPGRLKQWLGMLTRTYPEAVELFARIRRESDCET
DUSC_PSEPK        -----DLLPLLREFWRQAQAKLSPRYAPGRMKQWLAMLTRSYPEAVVLFAELRREDDCAR
F6A8H3_PSEF1      -----ELQPLLAAFWLQARRKISPRYAPGRLKQWLAMLTRSYPEAVELFARVRRETSCEV
A4VKE3_PSEU5      -----EFRPVLLDFWQQARGKIAPRYAPGRLKQWLALLTRNYPEAVALFAELRRENDCAR
DUSC_PSESM        -----ELQPMLRTFWQACLVKMTLVQAPGRLKQWLVLLTKSYPEATLMFNTLRRETDCDR
DUSC_NEIMB        --FAEVSKWIRQFFELCLTKEANNKYPLARLKQWLGMMKKEFAAAQNLFDRVRTVKDADE
A5WHX3_PSYWF      --VIEWQHLIAHQIAFLQGEAKNDLVLIGRYKQWLGMLSKGYVEAKQLWEQIKRERNKQT
DUSC_SHEON        ------TLQLMLSYTQRELSGRKSDYYPARIKQWFSYLNRQYPEADTLFRELRIYKTTEE
A8H2N9_SHEPA      ------SLNLMLEYTNRELEGRKSTYYPARIKQWFGYLNRQYSEADELFRELRVFKTAEE
DUSC_VIBCH        ------VVDLLLRYTQFEVRGDKGKYYPNRIKQWFAYLRHAYPQANELFGELRTLTQVEP
F0LS22_VIBFN      ------VVDLLLEYSAYEVRGDKGKYYPNRVKQWFAYLRQAYPQAADLFREIRTMTEVDP
DUSC_VIBPA        ------VVDLLIYYSKFEMKGDKGLYYPNRVKQWFAYLRQSYPEANELFREIRTFNKAAP
Q6LNY4_PHOPR      ------VIQLLLKFSEFEIKGDKGLYYPNRVKQWFAYLRHEYPEAKDLFVDIRSLNKAAP
DUSC_HAEIN        ------IQKILQKYANVENEYDSGFYHVARIKQWLRYLNKEYNEANQVFDKIKTCQTAED
DUSC_PASMU        ------VLILLHQYAHTENQFDTGFYHVARIKQWLGYLKKAYPQADALFQLIKTCHDGQA
DUSC_HAEDU        ------VLQLLYEYVNMPNERDSGFYHVARIKQWLHYLDKAYPEAVDLFQIVKTEHSYDG
DUSC_SALTY        ------VVTLLQKYTRLEKQGDTGLYHVARIKQWLGYLRKEYIEATELFQSIRALNRSSE
DUSC_ECOLI        ------VVALLQKYTRLEKQGDTGLYHVARIKQWLSYLRKEYDEATELFQHVRVLNNSPD
A9MKT1_SALAR      ------VVTLLQKYTRLEKQGDTGLYHVARIKQWLGYLRKEYVEATALFQSIRALNRSSE
DUSC_YERPE        ------VVKLLQKYVQLEKQGDTGLYHVARIKQWLGYLRKEYTEATDLFGEIRALKNSKD
Q7N6N4_PHOLL      ------VVQLLQKYIRLEKQGDTGQYHVARIKQWLGYLRKEYEEATMLFEEIRKLKTSAD
A4WCH7_ENT38      ------VVTLLQKYTRLEKQGDTGLYHVARIKQWLSYLRKEYDEALGLFQEIRTLQTSAD
R4YSZ4_OLEAN      ------VVEMILNYRKVQVIGSKGHHYSSRAKQWLSQMRQSYPEANELFMPIRRIKKSDD
E1SW95_FERBD      ------IREVLNEYVTLEVYGDKQRYFPNRIKQWFGYLRQAYPQANELFRELRQLQRSDE
F2K2J1_MARM1      --KKEPLLTLIDQYQKNLRGECDEFATVGRLKQWCAYLKRHYPYIEANLRELRQTTTAEE
A6W1E8_MARMS      ------LNRLFISYSRELQEHYDEVAALGRLKQWCGHLRFEFKEIKENLQTLRRCKSVNE
Q6MNE4_BDEBA      ------ARPLLPQFFESSTLYINDYFAVSRSKQWLKALSLKNQEAKAIFDEIKVLKKPTE
C5BMN5_TERTT      -----DFAPLVHAFFEQTCDAYPKKYMGNRLKQWLHYLQRSYAEAAALFADIKPLRDREP
Q1QZQ6_CHRSD      ----SARAEILHAYAQRMRAHLPEKVVVSLLKQWLNQMRGRHEEAARRFAALRRRTELAD
E1V8G5_HALED      ----ADKASLLLDYAAMQRSILSSKTVVARLKQWMNHMRGRDPEAARCFQALRRITELDD
DUSC_RALSO        --EWPLVLGCLADYLKKLRARIAIHHEHGRVKLWLGYLKRTWPQAAELHDAIRRLQDSAE
B2UFU6_RALPJ      --EWPIVLGYLADYLKKLHARISAKHEHGRVKLWLSYLKRTWPQAAELHDAIRRLQDALE
DUSC_CUPNH        --EWPLVLRQIATYLKKLHARIASCHEHGRVKLWLSYLKRTWPQAAELHAAIRRMQDSLE
C4ZNZ1_THASP      --DWVELHPHLLRYWEGVQGRAAPVHACGRLKLWLGMLRRNYPAAGRLHEAVRRVVHPSR
Q21U18_RHOFT      IINWQVLLPFIAEFWRLVCARLDRRKQAGRLKQWLNFLRHHHPEAERAYMALRTLSEPAA
DUSC_AZOVI        --------RAGVRYSRWCASSGGAPGSGSRRATPLAGSSSGWACWRAVIRRRPRCSPNCA
                                                                              

DUSC_PSEAE        IDRLLQVSFSQAA------------------
DUSC_PSEPK        ISRLLGVEAQVLEACVA--------------
F6A8H3_PSEF1      IDALLGVGIAPAEVSTLQTLEADEEALSALR
A4VKE3_PSEU5      IDAMLGVDTRELRAAALA-------------
DUSC_PSESM        ITVLLGCSTKS--------------------
DUSC_NEIMB        VRNILAEFEREMNT-----------------
A5WHX3_PSYWF      IVDLLQAQLG---------------------
DUSC_SHEON        IVRVLEQAQHHLNQ-----------------
A8H2N9_SHEPA      IIDVLQRAQDNLAK-----------------
DUSC_VIBCH        IVDQLHRYRDQLHHAAAELPV----------
F0LS22_VIBFN      IVSHFQRYRDSLA------------------
DUSC_VIBPA        IVEHIQRYRDELQSRQSQVA-----------
Q6LNY4_PHOPR      IVEILQRAQALAHA-----------------
DUSC_HAEIN        LKLRLNEK-----------------------
DUSC_PASMU        LRMKIDGVMN---------------------
DUSC_HAEDU        VKAHIEKAVGRNEKTNFQ-------------
DUSC_SALTY        IARAIQAIKI---------------------
DUSC_ECOLI        IARAIQAIDIEKL------------------
A9MKT1_SALAR      IARAIQAIKI---------------------
DUSC_YERPE        IALAIQRINR---------------------
Q7N6N4_PHOLL      IAHVISLV-----------------------
A4WCH7_ENT38      IARVIQSK-----------------------
R4YSZ4_OLEAN      MQVAIEGYLEALVTNKVSEWQRSLES-----
E1SW95_FERBD      IIALLNQH-----------------------
F2K2J1_MARM1      FLALLDKIERS--------------------
A6W1E8_MARMS      LISTFNDAMRKT-------------------
Q6MNE4_BDEBA      FKAKLHALCGVDHLSEG--------------
C5BMN5_TERTT      IDTRLRRELQAP-------------------
Q1QZQ6_CHRSD      FLAGLGPMTPATDTQPRVDASGERA------
E1V8G5_HALED      FLAGLR--ASMTSEAPALPA-----------
DUSC_RALSO        ILGVIEHALARIGQQSAPAG-----------
B2UFU6_RALPJ      IERVIEQMQLRLGRPGAANG-----------
DUSC_CUPNH        IERVLEGLP---GAATAPE------------
C4ZNZ1_THASP      MNEELRRHGIPACDHPPSARADGPRPTSPDR
Q21U18_RHOFT      IGQWLALQ-----------------------
DUSC_AZOVI        GRTTAGGWMPCWA------------------