CLUSTAL format seed alignment for MF_02048

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DTD3_SYNY3            -----------MHLVDTHVHINFDVFAADLDQLQHRWRQAGVVQLVHSCVKPQEFDQIQS
A0A068MZ24_SYNY4      -----------MHLVDTHVHINFDVFAADLDQLQHRWQQAGVVQLVHSCVKPEEFGQIQA
G5J4T5_CROWT          -----------MQLIDTHVHINFDVFESDLEDIKNRWQEAEVVHLVHSCVEPKEFPSIKA
B1XHW5_SYNP2          -----------MQLVDTHVHINFDVFQEDIEAIASRWRAAGVAHLVHSCVEPQEFTEIQA
Q110H0_TRIEI          MGSSKINYKSQMQLIDTHVHINFDIFNSDLEKIRKRWEEAGVVHLVHSCVEPEEFLSIKA
K9XTP5_STAC7          -----------MQLIDTHVHINFDVFQGNLSSLRQRWQQAGVVHLVHSCVEPEEFQGIQS
B2J197_NOSP7          ---MTNDKEQRMQLVDTHVHLNFDTFQPDLATVRSRWQEAGVVRLVHSCVHPGEFSTIQS
K9ZHI7_ANACC          ---MTP--EQPMQLIDTHVHLNFDLFQPDLATVRSHWRKSGVVRLVHSCVHPEEFASIQA
K9QV23_NOSS7          ---------MTMQLIDTHVHLNFDAFQADLTAVRSRWQEAGVVRLVHSCVEPKEFSSIQT
K9YKH4_CYASC          -----------MQLVDTHVHVNFDRYQGDLEEVSSRWRENGVSKLVHSCVHPDEFETIKE
Q2JIZ6_SYNJB          --------------MDTHVHLNYPDFAADLPQVAERWRQTGIRRLVHSCVTPAEFPQLQA
Q2JR81_SYNJA          --------------MDTHVHLNYPDFAEDLPQVAERWRQAGIQQLVHSCVTPAEFPQLQA
Q31N18_SYNE7          -----------MQLVDTHVHLNFDCFAAELDAVADQWRQAGVARLVHSCVTPAEFPELQA
Q8DJN5_THEEB          ------------MLVDTHVHLNFPEYAPDLEAVAERWRSAGVVRLVHSCVEPREFPVIQR
B0C2C9_ACAM1          -----------MQLIDTHVHLNFDVFQPDLDQIAQRWRDHHIVRLVHSCVEPSEFEQIQS
A5GVF4_SYNR3          -------MSAAPPLIDSHCHIVFRQFDDDLDVIAARWREAGVQSLLHACVEPSEIPGIRA
Q3AZA5_SYNS9          -------MSPTSTLIDSHCHIVFRNFEEDLDEVATRWRDAGVRALLHACVEPAEIPAIRA
A9BCH7_PROM4          --------MTRPVLIDSHCHLIFKNFEEDLDEIAERWRAVGVQSLVHACVEASEIPAIRA
Q7V005_PROMP          --------MNNIELIDSHCHLIFENFEEDLEEVVSRWRSIGVKKLLHACCELSEIPKLKN
A2BYL2_PROM5          --------MSDIELIDSHCHLIFENFEKDLEEVVSRSRSIGVKKLLHACCELSEIPKLQK
Q318Q6_PROM9          --------MSDIELIDSHCHLIFENFDKDLEDVVCRLRSKGVKKLVHACCELTEIPKLKK
A0A0A2ADN8_PROMR      --------MSDIELIDSHCHLIFENFEKDLEDVVLRLRSRGVRKLVHACCDLTEIPKLKK
                                    :*:* *: :  :  ::  :  : .   :  *:*:*    *:  :: 

DTD3_SYNY3            LADRFPELFFAVGLHPLDAEDWQDNTA-GQILAYAKADDRVVAIGEMGLDFFKAD--NRD
A0A068MZ24_SYNY4      LADRFPELFFAVGLHPLDAADWQGNTA-EQILAYAKADPRVVAIGEMGLDFFKAD--NRG
G5J4T5_CROWT          LADRFGNLSFAVGLHPLDADKWTGNMG-KEILDYAKSDHRVVAIGEMGLDFYKAS--NQK
B1XHW5_SYNP2          LVDRFPELKFSVGLHPLDADKWTETMA-AEIKALAQSDSRIVALGEMGLDFFKAE--NHR
Q110H0_TRIEI          IADRFPELSYAVGLHPLDAHKWTSATA-NQIKNWGISDPRVVAIGETGLDFYKAD--NQE
K9XTP5_STAC7          LADQFPELSFAVGLHPLDADKWTDSTA-DQIKALANSDQRVVAIGETGLDFYKAD--NYE
B2J197_NOSP7          IAHQFPEISFAVGLHPLDAEKWNSETA-EKIKTLASSDSNVVAIGEMGLDFYKAD--NYE
K9ZHI7_ANACC          LAQEITELSFAVGLHPLDAAKWNHETA-EKIKTLASSDAKVVAIGEMGLDFYKAQ--DYD
K9QV23_NOSS7          IAHQFPEISFAVGLHPLDAAQWQSDTG-EQILSLARSDSKVVAIGEMGLDFYKAD--NYQ
K9YKH4_CYASC          LSLQFPELYCAVGLHPLDTRRWEGETTVQKILNFAQSHTKVVAIGEMGLDFYKDD--NNE
Q2JIZ6_SYNJB          IADQYPEVFLSVGLHPLEAGQWQPDLA-EKIAHLAASDERVVAIGETGLDFYKSNPADIE
Q2JR81_SYNJA          IADQYPEVFLSVGLHPLEARQWQPDLA-EKIAQLAAGDPRVVAIGETGLDFYKSDPADVE
Q31N18_SYNE7          IADRFPEVSLAVGLHPLDVELWQDGTA-TEIEALARSDQRVVAIGETGLDFFKSE--DHV
Q8DJN5_THEEB          LSAQFPELFMAVGLHPLDTQQWQPQLK-EKIASLATSEPKVVAIGETGLDFYKAT--NRE
B0C2C9_ACAM1          LSQRFSELYYAVGVHPLDVDKWTAEAE-AQIRSMATSDSKVVAIGETGLDFFKAN--NCD
A5GVF4_SYNR3          LADRFPELRYGVGVHPLDTEHWQADTP-EVLREAAGADSRVVAIGELGLDLFRAT--NLD
Q3AZA5_SYNS9          LADRFPEMRYSVGVHPLDTQHWCPDTV-DVLRQAALDDSRVVAIGELGLDLFRDK--NLE
A9BCH7_PROM4          LADRFPELRYSVGVHPLDINSWTDETL-EVLRRAALEDSRVVAIGELGLDLFRDS--NLD
Q7V005_PROMP          ISRRFDELYYSVGLHPLEANKWECNSK-SIMKDAAQCDSRVVAIGELGLDFFKSD--NTN
A2BYL2_PROM5          ISQKFDELYYSVGLHPLEANKWECQSK-SILKMAAQRDSRVVAIGELGLDFFKSD--NTN
Q318Q6_PROM9          ISNEFNEIYYSVGLHPLEAEKWELSSI-SLLRKSAQEDRRVVAIGELGLDFFKNE--NKT
A0A0A2ADN8_PROMR      ISHDFNEIYYSVGLHPLEAKKWEKSSK-SLLRKSALEDRRVVAIGELGLDFFKNE--NKT
                      :     ::  .**:***:   *        :   .  . .:**:** ***:::    :  

DTD3_SYNY3            HQIEVFRAQLAIARELNKPVIIHCRDAAQTMRQVLTDFQA-ESGPVAGVMHCWGGTPEET
A0A068MZ24_SYNY4      HQIEVFQAQLAIARELAKPVIIHCRDAADTMRQVLTEFQQ-EQGPVGGVMHCWGGNPEET
G5J4T5_CROWT          KQQEVLEAQLKIAHQLQKPVIIHCRDAAQKLKDVLELFWQ-EIGEIKGVMHCWSGTPEET
B1XHW5_SYNP2          HQEKVLRAQLELAAELDLPVIIHCRDAAAELLAILKEFQA-NDQPVRGVMHCWSGTPEET
Q110H0_TRIEI          QQKFVFKQQLTIAQELNKPLIIHCRDAANSMAEILYDFQE-NHRPVTGVMHCWGGTPEET
K9XTP5_STAC7          QQKQALRSQLAIAKELNKPVILHCRDAARILQQVCQDLGL-NQIP-KGVMHCWGGNKQET
B2J197_NOSP7          HQLLVFESQLAIASELNLPVIIHCRDAAVATREVLQKWRELKGERVRGVMHCWGGTPEET
K9ZHI7_ANACC          HQHIVFESQLAIASELNLPVIIHCRDAAPQVRTVLQRWQESQGEKARGVMHCWGGTPEET
K9QV23_NOSS7          QQCMVLEAQLAIASELNLPVIIHCRDAAVALREILKTWQERTNHQLRGVMHCWGGTPEET
K9YKH4_CYASC          LQKEVCWRQLEIAHQLDKPVIIHCRDAATAMVELLKEFFD-TKGKVNGVMHCWTGNPEET
Q2JIZ6_SYNJB          RQKESFWAQIAIAQAQDLALIVHCREAAAATYAILKEAMA-TGGPVRAVMHCWSGSPVET
Q2JR81_SYNJA          RQTESFRAHIALAQEQDLALIVHCREAAAATYEILREAMA-ARGPLRAVMHCWSGSPEET
Q31N18_SYNE7          RQYAAVEAQLAIARSLDLPVILHCREAAAAMAAVLRSQQS-QPGTLRGVMHCWGGTPEET
Q8DJN5_THEEB          QQEAAFWAQLEVAQALDLPVILHCREAAAAARDLLQQFVR-DRGPVRGVMHCWGGTPEET
B0C2C9_ACAM1          HQEQVFWTHLQMAQQLQLPVIIHCREAATTMVELLEKFWE-MHGPVKGVMHCWSGTPEET
A5GVF4_SYNR3          KQLAMLVPQLDLAEELGLPVIIHCRDAAEPMLALLEQRRA-AGHSIQGVMHCWGGTPAEM
Q3AZA5_SYNS9          EQLAVLRPQLDLAVELNLPVIVHCRDAAEPMLDELRTRRS-EGLCPTGVMHCWGGTPEEM
A9BCH7_PROM4          EQLAVLKPQLKLAFELDLPVIIHCRDAAQPMIDLLSELRD-LDICPKGVMHCWAGDSQEM
Q7V005_PROMP          KQIDALVPQMHLACELDLPVIIHCREAANEMIKICHDLSK-QGICPKGVLHCWSGTPDEM
A2BYL2_PROM5          KQIEALLPQMHLAYELELPVIIHCREAANEMIKICNKLSN-QGKCPKGVLHCWSGTPDEM
Q318Q6_PROM9          QQINALIPQMELAFELELPVIIHCRDAANEMIEICNDLSK-KGKCPKGVLHCWTGTPREM
A0A0A2ADN8_PROMR      QQIEALIPQMELAYELQLPVIIHCRDAANEMIEICSDLSK-KGKCPNGVLHCWTGTQKEM
                       *      :: :*     .:*:***:**                   .*:*** *   * 

DTD3_SYNY3            QWFLDLGFYISFSGTVTFKKAEGIQASAQMVPPDRLLVETDCPFLAPVPQRG-KRNEPAF
A0A068MZ24_SYNY4      QWFLDLGFYISFSGTVTFKKAEGIQASAQMVPLDRLLVETDCPFLAPVPKRG-KRNEPAF
G5J4T5_CROWT          KWFLDLGFYISFSGVVTFKKAQTIQESAKIVPSDRLLVETDCPFLAPVPKRG-KRNEPAN
B1XHW5_SYNP2          QWFLDLGFFVSFSGVVTFKNAEQVRDSARLVPDDRLLIETDCPFLAPVPKRG-KRNEPAF
Q110H0_TRIEI          KMFLDIGFYISFSGIVTFKNATQIQESAKIVPDDRLLIETDCPFLAPVPKRG-KRNEPAY
K9XTP5_STAC7          QWFLDLGFYISFSGILTFKNAQQIQESAKLVPSDRLLIETDCPFLAPVPKRG-KTNEPAY
B2J197_NOSP7          QWFLDLGFYISFSGTVTFKNAKAIQSSAAIVSSDRLLIETDCPFLAPVPKRGQRRNEPAY
K9ZHI7_ANACC          QWFLDLGFYISFSGTVTFKNAQTIQASAAIVNSDRLLIETDCPFLAPVPKRGEKRNEPAY
K9QV23_NOSS7          QWFMDLGFYISFSGTVTFKNAKAIQASAQMVKSDRLLVETDCPFLAPVPKRGEKRNEPAY
K9YKH4_CYASC          QWFLDLGMYISFSGVITFKNAHSVHESAKIVPSDRLLVETDCPFLAPTPYRG-KRNEPAY
Q2JIZ6_SYNJB          RQFVELGCYISFSGIVTFKNAETVRRSALEVPLSQLLVETDCPFLAPTPFRG-KRNEPAY
Q2JR81_SYNJA          RLFVELGCFISFSGIVTFKNAETVRRSAQEVPLSQLLVETDCPFLAPTPFRG-KRNEPAH
Q31N18_SYNE7          RWFLDLGFYVSFSGTLTFGKAETIRDSARLVPSDRLLIETDCPFLAPVPKRG-KRNEPAF
Q8DJN5_THEEB          AWFLELGFYISFSGTVTFKNAKQIHASAQMVPSDRLLIETDCPFLAPVPKRGEKRNEPSY
B0C2C9_ACAM1          QQFLALGFYVSFSGIVTFKNATQVHESARLVPCDRILVETDCPFLAPVPVRGKRRNEPAN
A5GVF4_SYNR3          HAFLAYGLYISFSGTVTFPKATETHQCAQQVPEDRYLVETDCPFLSPVPRRG-KRNEPAM
Q3AZA5_SYNS9          HAFLDLGFYISFSGTVTFPKALATHACAEQVPEDRFLVETDCPFLAPVPRRG-KRNEPAF
A9BCH7_PROM4          QAFLDLGFFISFSGMVTFPKAQKTHLCARKVPEDRFLIETDCPFLSPVPWRG-KRNEPAH
Q7V005_PROMP          KQFLDLGFYISFSGIVTFPKAYEIHECARIVPSDRYLIETDAPFLAPVPYRG-KRNEPAF
A2BYL2_PROM5          RKFLDLGFYISFSGIVTFPKAHEIHECARIVPSDRYLIETDSPFLAPVPYRG-KRNEPAF
Q318Q6_PROM9          KQFLDLGFYISFSGIVTFPKAYEIHECAKIVPNDKYLIETDSPFLAPVPHRG-KRNEPAF
A0A0A2ADN8_PROMR      KQFLKLGFYISFSGIVTFPKAHEIHECAKIVPNDKYLIETDSPFLAPVPFRG-KRNEPAF
                        *:  * ::**** :** :*   : .*  *  .: *:***.***:*.* ** : ***: 

DTD3_SYNY3            VRHVAEAIAALRHVPLETLAQQTTTNARNLFKLPVPA-----------
A0A068MZ24_SYNY4      VRHVAEAIAALRHISLETLAEQTTANARNLFKLPVPA-----------
G5J4T5_CROWT          VRHVAEFLAELREVPLENLAQQTTHNACQLFNLSLAP-----------
B1XHW5_SYNP2          VRHVAEYLAQLRETSLETLAQQTTANARQLFRLHF-------------
Q110H0_TRIEI          VKYVAKKVAELRGITLENLAAQTSKNACELFGFSIHFQ----------
K9XTP5_STAC7          VSYVAEFLASLRNVSVETIAQQTTENACKLFGIELTQSN---------
B2J197_NOSP7          VLYVAEQVAKLRQETVEAIAHQTTKNACELFGLSI-------------
K9ZHI7_ANACC          VFYVAEKLAQLRGETIEAIAHQTTQNACKLFGLAL-------------
K9QV23_NOSS7          VRYVAEQVAQLRGETLEAISTQTTQNACELFGLAL-------------
K9YKH4_CYASC          VLHVAEKLAELRNEPLEAIASTTTANAHKLFKL---------------
Q2JIZ6_SYNJB          VQRVAQTLAELLGIPPEKLAEETSQNAARLFRLPLP------------
Q2JR81_SYNJA          VQRVAQTLAELLQIPLQDLARQTSQNAARLFRLPQPPL----------
Q31N18_SYNE7          VQHVAARMSEVRSEPLEAIAATTTRNAFDLFRLPTALPQVA-------
Q8DJN5_THEEB          VRFVAEAVARLRQCDLGELEQQTTLNACHLFRLPLPTEQSTAPFS---
B0C2C9_ACAM1          VRYVAQQVADLRGVSLEELAATTTQNACRLFQLSLPVQS---------
A5GVF4_SYNR3          VRHVAERVAELRGQSLEQVARRSSANASKLFALPYQPQPEPANIGQEG
Q3AZA5_SYNS9          VASVASRVADLRGVDVDRVAAVTTSNARRLFKLP--------------
A9BCH7_PROM4          VEAVAKKIAEIRGKSFLTVANQSTDNAIKLFNLI--------------
Q7V005_PROMP          VESVAKSIASLRSSDLKSIADESSRNAEDLFKFDLIN-----------
A2BYL2_PROM5          VKSVAKYIANLRSSELKNIAKESYRNAEDLFKFDLIK-----------
Q318Q6_PROM9          VENVANFMADLRSTELITIAKQSSKNAEDLFKFDLLS-----------
A0A0A2ADN8_PROMR      VENVANYMAVLRSTELTTIAKESYKNAEDLFKFDLLSRRSSC------
                      *  **  :: :       :   :  **  ** :