CLUSTAL format seed alignment for MF_02058

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G7WEI4_DESOD          --MDIKEFSNKFADATKNLSPEETALIMKLFQGISKGLAANNFE-VSSEAKSPVFEGEIT
Q24ME7_DESHY          ---------------------------MKLFQEISKELAANSPSPAYQERKSPVYEGEIT
A0KHW9_AERHH          ---------------------------------------------------------MME
Q30WW3_DESAG          ----------------------------------------MNAVTHSYHDDTGRRQAAGL
A0A1G5JS43_9DELT      ------------------------------------------MMTSVTEPSSCRNARKGA
A0A2V1H0J0_9GAMM      ----------------------------------------------MQQASSSAGFSFDT
Q3A617_PELCD          ------------------------------------------MAGSCCGGIAEGATRKKF
CUTC_DESAG            --MDLQDFSHKLAEATKNLTPAERASLKKIFEGVSAEVFSQPA--PVSAVATGAESGIPD
C6BX55_DESAD          --MDLQSFSNKLAEATKNLTDTERASLKKIFEGVSAEVFKEKAEQPAAAVSCTETKGIPN
Q6AM73_DESPS          --MDLQSFSEKLIVATKNLNAAERASLKKIFDGDSTEIAEDKN--VPSAHLSVDPCAIPN
B8J0I2_DESDA          --MDLHDFSSKIAEVTKNLSPEEREQLRKIFATVTLPAQSAPSAAAQPSPAAHSGPGVPE
R3W1P5_9ENTE          --MDIKEFSAKLAEATKELSAEERNALMKMFATVADHTESP---SESYSVS--DATVVPN
S0LBT6_ENTAV          --MDIKEFSAKLAEATKELSLEERQALMKMFASVSDEVKKDDVVTEILVSD--EGTEIPN
A9KPD0_LACP7          --MDIREFSNKFVEATKNMSPEERSSLMKMFETVSDEINKKETAPSTSNVCNEEGSNIPD
Q894T5_CLOTE          --MDIREFSNMLMEATKNMSDEERNGLMNMFQSISKEIKKEEKVTSNVVFN--NNGEIPD
A6TUT5_ALKMQ          --MNIREFSIKFVEATKNMSEEERNALKKIFQGITQEIPKED--TDISLYR-ENHQGIPT
A8MJE8_ALKOO          MILDIRDFSNKLTEATKNLSVEERMSLMKIFEGISNEITKKDG-TCAPAYRSEEGTGVPN
M4YZ33_STREQ          MIMDMKEFTAKLEEATKQLSQEERDSLAKLFQSVSGDITKPQEEQKESLSFASEGTSLPE
E1QYG6_OLSUV          --MDIKEFAKELSEATKDMSDEQRATVRQMFEKVANQLDAPLGEAPAHGAG-SEPYDVPE
A0A6I8A9C5_9ENTR      --------------------------------------------------------MTTE
D2ZGF9_9ENTR          --------------------------------------------------------MKID
A0A0G4K2Z4_9GAMM      -----------------------------------------------------MMNNNKE
L0M6L3_ENTBF          ---------------------------------------------------------MEK
                                                                                  

G7WEI4_DESOD          GLTPRLERLKAAYLKVKPSVSTYRARAFTQVTKENPGLPKILLRAKCFRRACETAPLVIQ
Q24ME7_DESHY          GLTPRLNNLRTVYLQAKPSVSIDRARAFTEVTRENPGLPKILLRAKCFRRACETAPLLIQ
A0KHW9_AERHH          GLTPRLQRLRNHYLTVRPSVSIYRAQAFTEVVKANPGMPTILLRAKAFRHACETAPILIQ
Q30WW3_DESAG          PLSARLRRLKAAYLEAKPSITIGRAMAYTEIEKAYPDLPPVLRRAMGFRRACETAPVLIQ
A0A1G5JS43_9DELT      QLPERLARLKEAYLNVKPSMTIGRALAFTAVAKEYPELPNNLRRAKGFKRACETAPMLIR
A0A2V1H0J0_9GAMM      PLPERLKSLKQRYLTVKPSITIERALAYTEIVAKHPDLSKNLQRAKGFKRACEIAPMIIQ
Q3A617_PELCD          ELPERIQRLKDAYLQVKPSIAIGRALAFTEVTRQNPGMPEILRRALAFKKACEDAPLLIQ
CUTC_DESAG            GPTPRHVKLKENFLKQVPSITVQRAVAITKIAKENPGLPKPLLRAKTFRYCCETAPLVIQ
C6BX55_DESAD          GPTDRHVKLKENFLKQVPSVSVESARVMTEMAKANPGLPPAILRGKSFRASCEQAPLVIQ
Q6AM73_DESPS          GPTDRHIKLKKKFLTHVPTITTHRARAITKIAQENPGLPKAILRGKSFKYCCETAPLVIQ
B8J0I2_DESDA          GPTQRHVLLKENYLKQVPRITIHRARTITKIDKENPGMPRILLRATAFRHCCESAPLIIQ
R3W1P5_9ENTE          GITPRLSALKENYLKQVPTITTHRARVITELAKENPGMPKNVLRAKSFKRCCETAPLVIQ
S0LBT6_ENTAV          GITKRLQALKDNYLEQVPSITTYRARAITKIAKENPGMPKIVLRAKCFRYCCETAPLVIQ
A9KPD0_LACP7          GITPRLHKLKENYLTHKPTITTYRARAITKIAKENPGMPKIMLRAKCFRYCCETAPLVIQ
Q894T5_CLOTE          GMTERLIKLKENYMKQVPSITTHRARAITKIAKENPGVPKSVLRGKCFKYCCETAPLVIQ
A6TUT5_ALKMQ          GITERLKTLKDNYLKWKPSISIHRARAITKIAKENPGMPKILLRAKSFRYCCETAPLVIQ
A8MJE8_ALKOO          GITERLSRLKETYLKWQPTITTHRARAITKIAKENPGMPKVLLRAKSFRYCCETAPLLIQ
M4YZ33_STREQ          GITPRLQALKDQYLKAKPTISLIRAINLTKISKANEGMPKAILRGTAFKEFCKIAPLVIQ
E1QYG6_OLSUV          GPTDRQVRLKENFLKQVPSITMYRARAVTEIMKANPGMPRIELRAKAFRRCCETAPLVIQ
A0A6I8A9C5_9ENTR      ILSLRVVQLRESYLQAKPFVSAHRAVSVTQVYKDNPGMNNSLLRALAFRRACETAPLHVA
D2ZGF9_9ENTR          ALSLRVRQLRDNYLQAKPFVSARRAISVTRVYKENPGMDNTLLRALAFRRACENAPLYVA
A0A0G4K2Z4_9GAMM      NLSVRIDSLRHRYLQAKPFISISRARAVTEIYQRYPGMAAIQLRALAFRRACQLAPLVIE
L0M6L3_ENTBF          EFTNRIDALKAHYFNAKPFISVSRAQAVTEVYKQNPGLDCIMLRALAFRRACEQAPLWIA
                        . *   *:  ::   * ::   *   * :      :     *.  *:  *: **: : 

G7WEI4_DESOD          EDELIVGHPCGKARAGAVSPDIAWRWIRDELDTMSTRPQDPFQISEEDKRILREEVFPFW
Q24ME7_DESHY          KDELIVGHPCGKPRAGAFSPDIAWRWVRDELDTMATRPQDPFQISEEDKRILREEIFPFW
A0KHW9_AERHH          DDELIVGHPCGKPRAGAFSPDIAWRWVRDELDTMSTRPQDPFEISEADKKTIREEIVPFW
Q30WW3_DESAG          DDELIVGHPCGAPRAGAFSPDTAWKWLRDELDTIGTRPQDPYMISEADKKIMREELFPFW
A0A1G5JS43_9DELT      DDELIVGHPCGRARAGAFSPDTAWKWVRDELDTIGTRPQDPYVISEDDKKILREEIFPFW
A0A2V1H0J0_9GAMM      PDELVVGHPCGKPRAGAFSPDTAWRWLEDELETISTRSQDPYLIAEADKKILKDKIFPFW
Q3A617_PELCD          TDELIVGHPCGKPRAGAFSPDIAWKWVRDELDTIGTRSQDPFVFSEEDKKIMREEIFPFW
CUTC_DESAG            DHELIVGSPNGAPRAGAFSPEVAWRWLQDELDTIGSRPQDPFYISEEDKKVLREEVFPFW
C6BX55_DESAD          DHELIVGNPTGAPRRGSFSPEIAWRWMKDELETIGSRPQDPFYISEEDKKYMKEELFPFW
Q6AM73_DESPS          DNELIVGSPCGAPRAGAFSPDIAWRWVKDELDTIGTRPQDPFFISEEDKKIMREELFPFW
B8J0I2_DESDA          DHELIVGAPNGAPRAGAFSPEISWRWLRDELDTIDSRAQDPFHLAEEDKKILCEEIFPYW
R3W1P5_9ENTE          DNELIVGAPNGAPRAGSFSPDIAWRWMEEEIDTISSRPQDPFHISDEDKRIMREELFPFW
S0LBT6_ENTAV          DHELIVGAPNGKPRAGAFSPDIAWRWMEDEIDTIGSRPQDPFYISDEDKKIMREELFPFW
A9KPD0_LACP7          DNELIVGAPCGAPRAGAFSPDIAWRWMVDEIDTIGTRPQDPFYISEEDKKIMKEELFPFW
Q894T5_CLOTE          DNELIVGAPNGKPRAGAFSPDIAWRWMEDEIDTIANRPQDPFYISEEDKKIMREELFPYW
A6TUT5_ALKMQ          DHELIVGAPCGAPRAGAFSPDISWRWLEEELDTIANRSQDPFYISEEDKKELVEEIFPYW
A8MJE8_ALKOO          EDELIVGAPCGQPRAGAFSPDIAWRWMEDEIDTIGNRPQDPFYISEEDKRYMREELFPFW
M4YZ33_STREQ          DHELLVGAPNGGARWGAFSPDISWRWLRDEIDTVSTRPQDPYALSDADKKVLLEEIFPYW
E1QYG6_OLSUV          DDELVVGAPCGAPRAGAFSPDLAWRWLRDELDTIGERPQDPFYISEEDKQYCRDVLFPFW
A0A6I8A9C5_9ENTR      QNELIVSHPAGGARGGEVSPEISWRWLAEELETLPTRAQDPYQIDEKTKRLLREEVFPYW
D2ZGF9_9ENTR          DNELIVSHPAGGARGGEISPEISWRWVADELDTLPQRAQDPYQIDDETKRLLREEVFPYW
A0A0G4K2Z4_9GAMM      DGELIISHPAGRARGGEISPEIAWRWVANELDTMATRAQDPYFISEADKRELREHILPFW
L0M6L3_ENTBF          ENELIVSHPAGGPRGGEISPELSWRWIAEELDTVSERKQDAYQISDSAKRILREEIFPFW
                        **::. * * .* * .**: :*:*: :*::*:  * **.: : :  *:   : :.*:*

G7WEI4_DESOD          EGKSLDEICQQQYEEAGLWSFSGESFVSDLSYHQVNGGGDTCPGYDILLIKKGINGIRQE
Q24ME7_DESHY          EGKSVDEICQKQYEDAGIWSFSGESFVSDLSYHQINGGGDTAPGYDVILIKKGIKGVRQE
A0KHW9_AERHH          EGRSLDEICEAQYREAGVWAFSGETFVSDLSYHQINGGGDTCPGYDVLLFTKGMNGIKAD
Q30WW3_DESAG          EGRSLDEVCEDAFRREGLWEFCAEAGISDLSYHHTSGGGDTSPGYDIILFTKGINGLKAE
A0A1G5JS43_9DELT      EGRSLDEACEAWFRKENLWEFSAEACVSDLTYHHTSGGGDTSPGYDILLFTKGIGGIKAE
A0A2V1H0J0_9GAMM      KGRSIDEACESKFRAAGLWEFSSEAYVSDLSYHHTSGGGDTSPGYDILLFTKGVSGLKAE
Q3A617_PELCD          EGRSLDEICETQYREAGLWEFAAEAFVSDLSYHQVNGGGDTCPGFDVILFTKGVSGIKAE
CUTC_DESAG            QNKSVDEFCEGQYREADLWEMSGESFVSDCSYHAVNGGGDSNPGYDVILMKKGMLDIQRE
C6BX55_DESAD          ADKSIDEYCEAQYREAGLWELSGESYVSDCSYHAVNGGGDSNPGYDVILMKKGMLDIKAE
Q6AM73_DESPS          EGRSIDEYCEQQYREAGMWELSGESYVTDCSYHATNGGGDSNPGYDVILMKKGMLDIVRE
B8J0I2_DESDA          AGKSVDEYCEAQYREAGLWELSGESYVSDCSYHALNGGGDSNPGYDVILMKKGMLDIQRE
R3W1P5_9ENTE          KGKSVDEHCEDQFREAGVWELSGESFVSDCSYHQLNGGGDSNPGYDVILMKKGMLDIQRE
S0LBT6_ENTAV          KGKSVDEYCEDQYREAGVWELSGESFVSDCSYHALNGGGDSNPGYDVILMKKGMIDIQNE
A9KPD0_LACP7          AGKSVDEYCEDQYREAGVWELSGESFVSDCSYHAINGGGDSNPGYDVILMKKGMLDIQQE
Q894T5_CLOTE          KGKSVDEYCEDQYREAGVWELSGESFVSDCSYHAVNGGGDSNPGYDVILMKKGMLDIKRE
A6TUT5_ALKMQ          KGKSVDEHSEDQFREAGVWEISGESFVSDCSYHALNGGGDSNPGYDVILMKKGMLDIQEE
A8MJE8_ALKOO          KGKSVDEYCEDQYRDAGVWEISGESFVSDCSYHALNGGGDSNPGYDVILMKKGMIDIQKE
M4YZ33_STREQ          EGKSVDEACESQYREAGAWELSGESFVSDCSYHAQSGGGDSNPGYDVIGMNKGMLDIKAE
E1QYG6_OLSUV          EGKSQDEVCEDQYREAGVWTLSGESFVSDCSYHAMSGGGDSNPGYDVILMRKGMLDIQEE
A0A6I8A9C5_9ENTR      QGRSLDEMAQTQLKTHGLWQWCHDDGICDVTIKTQNGGGDSCPGYDNILLIKGIKGIREE
D2ZGF9_9ENTR          EGRSLDEMAQTQLQVLGLWEWCHDDGICDVTIKTQNGGGDSCPGYDNILLTKGIKGIREE
A0A0G4K2Z4_9GAMM      QGRSLDEMAETQLRQAGLWAWSHDENICDLTIKTQNGGGDTCPGYDNILLVQGMGGVREQ
L0M6L3_ENTBF          KGRSLDEIAETRLRHAGLWEWCNEYGVCDVTIKTQNGGGDACPGYDTLLLTEGMGGARDR
                       .:* ** .:   .  . *  . :  : * : :  .****: **:* : : :*: .    

G7WEI4_DESOD          AVDKLSK-----LSMENPDDIDKIYFYKAEIETCDGVLAYAKRLSDYARELAGREYNAVR
Q24ME7_DESHY          AEDRLSR-----LSMENPEDIDKIYFYKAEIETCDGILAYARRLSDYARESADREVDSVR
A0KHW9_AERHH          AQAHLDQ-----LSMENPDDIDRIYYYKAAIETCEGVVNYARRIAAHARELAAKEQDAQR
Q30WW3_DESAG          AEAHLER-----LDAENAGDSSGADFYRAAVIICEGVLLYAGRVAAHARQLAAAEQNPAR
A0A1G5JS43_9DELT      AEAHLAQ-----ISGDSAEEKEKVAFYQAAVETCEGVLIYAGRLSSHARELAAREQDPGR
A0A2V1H0J0_9GAMM      AKEYLAKACEVPLTDRSDATQEKIVFYQAAIETCNGILIYAQRVAQHARELALQEQNSVR
Q3A617_PELCD          AEAHLAK-----LSMDVPDDIDRIYFYKAAIQTCEGIVTYANRVSAYAKELAEKEQDPKR
CUTC_DESAG            AREKLEQ-----LDYANPEDIDKIYFYKSVIETAEGVMIYARRLSAYAAELAARETDPRR
C6BX55_DESAD          AEAHLEE-----LDYENPEDIDKIYFYKSVIDTAEGVMIYAKRLSEYAAQKAAQETDPKR
Q6AM73_DESPS          SQEKLAE-----LDYENPDDMDKIYFYKSLIDTAEGVMIYAKRLSDYAAQLAASEKDPQR
B8J0I2_DESDA          AREHLEQ-----LSYDRPEDIDKIYFYKSVIETTEGVMIYARRMSEYAAQLAARENDPRR
R3W1P5_9ENTE          AQEKLDT-----LDYATPDDMDKIYFYKAQIETAEGVMIYAKRMSEYARELAEKETNPKR
S0LBT6_ENTAV          AKAHLEE-----LDYENPEDIEKIYFYKSIIDTTEGVMIYARRMADYAAELAAKETNPKR
A9KPD0_LACP7          AKDHLKE-----LDYENPDDIEKIYFYKSIIDTTEGVMIYAKRLSEYAAELAAKETNPKR
Q894T5_CLOTE          AEEKLAS-----LSYERPEDIEKIYFYKSIIDTAEGVMIYAKRMSDYAAELAAKETDPKR
A6TUT5_ALKMQ          AKEKLNE-----LSYENPEDIEKIYFYKSVIQTTEGVMVYARRLSEYAMELAQKESNPNR
A8MJE8_ALKOO          AQEHLEK-----LSYDNPDDIEKIYYYKAVIETTEGVMIYARRLADHAADLAAKETNPKR
M4YZ33_STREQ          AEAHLAQ-----LDYGNPDDLDKIYFYKSQILTAEGVMIYAKRMSEYALELAEKETDAKR
E1QYG6_OLSUV          AKQHLAQ-----LDYANPDDLDRIYFYKSVLDTTEGVMIYAKRMSDYAAKLAGECHDARR
A0A6I8A9C5_9ENTR      AAALLLA-----LDPATPEGCDAFNFYTAMLHTCDGVVTYARRYAHYLNALAEKEGDPLR
D2ZGF9_9ENTR          AAARLAA-----VDPASPEGAEAFNFYTAMLHTCDGVLTYARRYAARLSELAETEGDPLR
A0A0G4K2Z4_9GAMM      ARRSLLA-----LTGISDEEMEKRRFYQAAIDTCDGVIEYAHRYAAYAQQLAERQTDLTR
L0M6L3_ENTBF          AVQSIKQ-----LDLNCAEDIDRHNFYQAMVQTCDAVIHYAHRYSDYAAQLAAEQSDPQR
                      :   :       :        .   :* : :   :.:: ** * :      *    :  *

G7WEI4_DESOD          QKELYKISDILTHVPANPPRSFHEALQSIWTLESLFVVEENQTGISIGRLDQYVYPMFKA
Q24ME7_DESHY          KQELHKIADVLTWVPANPPRTFHEALQSIWTLESLFVVEENQTGISLGRLDQYIYPMFKA
A0KHW9_AERHH          RAELLTIAEVNENVPANPPKTLQEALQSIWTVESLFEIEENQTGLSLGRVDQYCYPMFEA
Q30WW3_DESAG          REELLAIAEVNTRVPANPPATFHEALQAVWTIQSLFLLEENQCSTSLGRFDQYVYPCYEA
A0A1G5JS43_9DELT      KAELERIAEVNARVPAHPPETFQEALQAIWTIQSLFLMEENQCSTSLGRFDQYVYPCYEA
A0A2V1H0J0_9GAMM      KAELLKIAEINERVPANPPKSFHEALQSIWTIQSLFLLEENQCSTSLGRFDQYVLPCFMA
Q3A617_PELCD          KAELEKIAEVNARVPANPPSSFQEALQSIWTIESLFVIEENQTGLSLGRLDQYVYPCYEA
CUTC_DESAG            KAELQKISEVNARVPAHAPSNFWEAIQAVWTVESLLVVEENQTGMSIGRVDQYMYPFYRA
C6BX55_DESAD          KAELLKISEVNARVPAHKPETFWEAIQAVWTVESLLVVEENQTGMSIGRVDQYMYPYFKA
Q6AM73_DESPS          KAELEKISAVNARVPAHKPETYWEAIQAVWTVESLLIVEENQTGMSIGRVDQYMYPFYKA
B8J0I2_DESDA          KAELLKIAEVNARVPAHAPTTFWEAIQAVWTVESLLVVEENQTGMSIGRVDQYMYPFYKA
R3W1P5_9ENTE          KMELQKIAEVNAKVPANKPETFWEAIQAVWTIESLLVVEENQTGMSIGRVDQYMYPFFKN
S0LBT6_ENTAV          KAELLKISEVNRKVPAHKPDTFWEAIQAVWTIESLLVVEENQTGMSIGRVDQYMYPYFKA
A9KPD0_LACP7          KEELLKISEVNAYVPAHKPRTFWEAIQAVWTIESLLVVEENQTGMSIGRVDQYMYPFYKD
Q894T5_CLOTE          KAELQKISKVNARVPAHKPSTFWEAIQAVWTIESLLVVEENQTGMSIGRVDQYMYPFYKS
A6TUT5_ALKMQ          KAELMKIAEVNKRVPAHKPNNFWEAIQSVWTVESLLVVEENQTGMSIGRVDQYMHPFFEQ
A8MJE8_ALKOO          KAELQRISEINRRVPANKPSTFWEAIQAVWTIESLLVVEENQTGMSIGRVDQYMYPFYKA
M4YZ33_STREQ          KAELKTIAKVNANVPAHKPESFWEAMQYVVTIQNLLLCEENQTGLSIGRVDQYMYPLYRK
E1QYG6_OLSUV          KAELEQISKILAYVPAHRPRTFWEAVQSVFVIESLLPVEENQTGMSIGRVDQYMYPFYKA
A0A6I8A9C5_9ENTR      RDELLQLSGICSRVPEQPPQHFHDALQAIWFVHSLFMLEENQTGISLGRVDQYLWPLLER
D2ZGF9_9ENTR          QDELRHLADICRRVPEHPPRHFHDALQAIWFVHSLFTLEENQTGISLGRVDQYLWPLLER
A0A0G4K2Z4_9GAMM      KEELERLAAICLRVPEQPPRNFHEALQSIWFVQSLFILEENQTGISLGRADQYLWPYLAA
L0M6L3_ENTBF          KAELNRLADICRHVPEHPPRNFYEALQSVWFVQSLFCLEENQTGISLGRVDQYLWPLLQR
                      : **  :: :   ** : *    :*:* :  :..*:  **** . *:** ***  *    

G7WEI4_DESOD          DMEAGRLNKLEAFELMSCFIIKCSEVMWLSSELGAKYFAGYQPFINVTIGGQKRSGGDAT
Q24ME7_DESHY          DMDAGRLNKLEAFELMSCFLIKCSEVMWLSSEQGAKYFAGYQPFINCTVGGQKRTGGDAT
A0KHW9_AERHH          DIREGRLTHESALELMQAFIIKCAELMWMSSELGAKYFAGYQPFINLTVGGQKRSGGDAC
Q30WW3_DESAG          GIRNGTLTREQAFELTGCFIIKCSEMIWYTPGATARYFAGYMPFINMCVGGQKREGGDAT
A0A1G5JS43_9DELT      DMKAGSLGEDRAHELMGCFIIKCSEMIWYTPEATATYFAGYMPFINLCVGGQKREGGDAT
A0A2V1H0J0_9GAMM      DIESGALTLEQALELMGCFILKCSEMVWYTPEATATYFAGYMPFINICVGGQMRDGGDAT
Q3A617_PELCD          DIKAGVIDEDQAFELMSCFIIKCAEMMWLTSELAAKYFAGYQPFINLCVGGQKREGGDAT
CUTC_DESAG            DIDSGRLTEYEAFDLAGCMLVKMSEMMWITSEGASKFFAGYQPFVNMCVGGVTREGHDAT
C6BX55_DESAD          DLEAGRLTEYEAFDLAGCMLIKMSEMMWITSEDASKFFAGYQPFVNMCVGGVTREGYDAT
Q6AM73_DESPS          DIEAGRMTEYEAFDLSGCLLVKCSEMMWITSEDASKFFAGYQPFVNMCLGGVTREGLDAT
B8J0I2_DESDA          DIEAGRMTPYEAFDLAGCMLIKMSEMMWLTSEGSSKFFAGYQPFVNMCVGGVSREGRDAT
R3W1P5_9ENTE          DLDSGRLTNHEAFELAGCMLIKMSEMMWITSEGGSKFFAGYQPFVNMCVGGVTREGRDAT
S0LBT6_ENTAV          DLEEGRMNEFQAFELAGCMLIKMSEMMWITSEGGSKFFAGYQPFVNMCVGGVTRQGRDAT
A9KPD0_LACP7          DIESGRMNDYQAFELAGCMLIKMSEMMWITSEGGSKFFAGYQPFVNMCVGGVTRSGRDAT
Q894T5_CLOTE          DIESGRMTDFEAFELAGCMLIKMSEMMWITSEGGSKFFAGYQPFVNMCVGGVTREGRDAT
A6TUT5_ALKMQ          DLKNGNLSEYEAFELAGSMLIKMSEMMWLTSEGSSKFFAGYQPFINMCVGGVTREGLDAT
A8MJE8_ALKOO          DIESGRMTEFEAFELAGAMLIKMSEMMWVTSEGGSKFFAGYQPFVNMCVGGVTREGLDAT
M4YZ33_STREQ          DIDSGRLTDYQAFELAGCMFIKMSEMMWLTSEGSSKFFAGYQPFVNMCVGGVTREGRDAT
E1QYG6_OLSUV          DIEAGRITPYQAFDIAGCMLIKMSEMMWVTSRGQSEFFAGYQPFVNMTLGGVTRQGHDAT
A0A6I8A9C5_9ENTR      DLNDGTLDLQQAEELLCCWLIKMAETLWICSESTAMYFAGYQPFINLVVGGQKREGGDAT
D2ZGF9_9ENTR          DLNDGVLTHAQAEELLCCWLIKMAETLWICSESTAMYFAGYQPFINLVVGGQKREGGDAT
A0A0G4K2Z4_9GAMM      DLSNGVLTEAQAEELICCWMIKMSECMWVCSADTAMYFAGYQPFINLVVGGQKREGGDAT
L0M6L3_ENTBF          DLENGSLTKAQAEELLCCWMIKMAESLWLCSESTAKYFAGYQPFINMVVGGQKREGGDAT
                      .:  * :    * ::  . ::* :* :*  .   : :**** **:*  :**  * * ** 

G7WEI4_DESOD          NDLTYLIMDAVRFTKMYQPSLACRIHNKSPQGYLKKIVDVVKAGLGFPACHFDDTHIKMM
Q24ME7_DESHY          NELTYLIMDAVRFTKMYQPSLACRIHNQSPQRYLKKIVEVVKAGLGFPACHFDDSHIKMM
A0KHW9_AERHH          NDLTYLIMDAVRFVKVYQPSLACRIHNQSPQKYMEKIVDVVKAGMGFPACHFDDSHIKMM
Q30WW3_DESAG          NDLTLLLMDAVRSVGVYQPSLACRIHNQSPQEYLEKIADVVRAGTGMPACHFDDAHIRMM
A0A1G5JS43_9DELT      NDLTYLVMDAVARVGVYQPSLACRIHNQSPQAYLQKIVEVIKAGGGMPACHFDDAHIKMM
A0A2V1H0J0_9GAMM      NPLTYLVMDAVRLTNVYQPSLACRIHNQSPIEYLKKISDVVKAGGGMPACHFDDAHIKMM
Q3A617_PELCD          NDLTYLVMDVVRKLGVYQPSLACRIHNQSPQKYLQKIVEVVKAGLGFPACHFDDAHIKMM
CUTC_DESAG            NDLTYMLMDAVRHVRIYQPTLATRVHNKSPQKYLKKIVDVIRSGMGFPAVHFDDAHIKMM
C6BX55_DESAD          NDLTYLLMDAVRHVKIYQPSLATRVHNKSPHAYLKKIVEVIRSGMGFPAVHFDDAHIKMM
Q6AM73_DESPS          NDLTYLLMDAVRHVKVYQPSVSTRVHNQSPQKYLKKIVDVIRAGMGFPAIHFDDAHIKIM
B8J0I2_DESDA          NDLTYLLMDAVRHVRIYQPSLATRVHNTSPQEYLKKIVSVIRSGMGFPAVHFDDTHIKMM
R3W1P5_9ENTE          NELTYLLMDAVRHVKVYQPSLACRIHNRSPREYLKKIVDVVRAGIGFPACHFDDTHIKMM
S0LBT6_ENTAV          NELTYLLMDAVRHVKVYQPSLACRIHNHSPREYLKKIVDVVRAGMGFPACHFDDTHIKMM
A9KPD0_LACP7          NDLTYLLMDAVRHVKIYQPSLACRIHNKSPKEYLKKIVDVVRSGMGFPACHFDDAHIKMM
Q894T5_CLOTE          NELTYLLMDAVRHVKIYQPSLACRIHKGSPQKYLKKIVDVIRAGMGFPACHFDDVHIKMM
A6TUT5_ALKMQ          NDLTYLLMDAVRHVKIYQPSLATRIHSKSPKKYLRKIVDVVRSGMGFPACHFDDVHIKMM
A8MJE8_ALKOO          NDLTYLLMDAVRHVKIYQPSLATRIHSKSPKKYLKKIVDVVRSGMGFPACHFDDVHIKMM
M4YZ33_STREQ          NDLTYLLMDAVRHVKVYQPTLATRINNKSPRKYLKKIVDVVRAGVGFPACHFDDTHIKMM
E1QYG6_OLSUV          NELTYLLMDAVRHVKVYQPSVACRINNKSPEKYMRKIVDIVRSGMGFPACHFDDSHIKMM
A0A6I8A9C5_9ENTR      NPLTLMIMDCSARLKIYQPGLAVRIHNQSPQPFMRKVVEVVRSGMGFPACHFDDAHIRMM
D2ZGF9_9ENTR          NPLTLMIMDCSAQLKIYQPGLAVRIHNQSPQPFMRKVVDVVRSGMGFPACHFDDAHIRMM
A0A0G4K2Z4_9GAMM      NPLSLLFMECSRKLKLYQPGLAVRIHNRTPQHFMRKVVEVIRAGMGFPACHFDDAHIKMM
L0M6L3_ENTBF          NPLTLMIMVCSRKLKIYQPSLAVRIHNQSPWHYLREIVEVIRGGTGFPACHFDDAHIKMM
                      * *: :.*       :*** :: *::. :*  ::.:: .:::.* *:** **** **::*

G7WEI4_DESOD          LAKGFSIEDSRDYCLMGCVEPQKSGRIYQWTSTGYTQWPIAIEFVLNRGVMKWRN-----
Q24ME7_DESHY          LAKGFSIEDSRDYCLMGCVEPQKSGGIYQWTSTGYTQWPIAIEFVLNRGVMKWRG-----
A0KHW9_AERHH          LRKGFDFEDARDYCLMGCVEPQKSGRIYQWTSTGYTQWPIAIEFVLNRGRMVLFD-----
Q30WW3_DESAG          LRKGFDFDDARDYCLMGCVEPQKSGRIHQWTAGGFTQWPVAVELVFNRGVLRSYG-----
A0A1G5JS43_9DELT      LRKGFDFEDARDYSLMGCVEPQKSGRIHQWTAGGFTQWPIAIEFVFNRGVMPSFG-----
A0A2V1H0J0_9GAMM      LRKGFDFDDARDYCLMGCVEPQKSGRLHQWTVGGFTQWPVAIEFVFNRGKILSYDGLPEN
Q3A617_PELCD          LRKGYDFEDARDYCLMGCVEPQKSGRIYQWTSTGYTQWPVAIEFVLNRGVMKWHG-----
CUTC_DESAG            LAKGVSIEDARDYCLMGCVEPQKSGRLYQWTSTGYTQWPICIELVLNHGVPLWYG-----
C6BX55_DESAD          LAKGVSMEDARDYCLMGCVEPQKAGRLYQWTSTAYTQWPICIELVMNHGVPLWYG-----
Q6AM73_DESPS          LAKGCSIEDSRDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIEMALNHGVPLWYG-----
B8J0I2_DESDA          LAKGVDIEDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIELVLNRGVPLWYG-----
R3W1P5_9ENTE          LAKGVSVEDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIELVLNQGVPLWYG-----
S0LBT6_ENTAV          LAKGVSIEDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIELVLNHGVPLWYG-----
A9KPD0_LACP7          LAKGVSIEDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIELVLNNGVPLWYG-----
Q894T5_CLOTE          LAKGVSIEDARDYCLMGCVEPQKSGRLYQWTSTGYTQWPICIELVLNHGVPLWYG-----
A6TUT5_ALKMQ          LAKGVSIEDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPICIELALNKGIPLWYG-----
A8MJE8_ALKOO          LAKGVSIEDARDYCLMGCVEPQKSGRLYQWTSTAYTQWPIAIELVLNNGVPLWYG-----
M4YZ33_STREQ          LAKGVSMEDARDYCIMGCVEPQKSGRLYQWTSTSYTQWPILIETTLNHGIPLWYG-----
E1QYG6_OLSUV          LAKGVSVEDSRDYCMMGCVEPQKSGRLYQWTSTSYTQWPICIELTLNHGVPLWFG-----
A0A6I8A9C5_9ENTR      LHKGFSYEDARDYCLMGCVEPQKSGKMYQWTSVGYTTCTAAIELALHNGRTQNG------
D2ZGF9_9ENTR          LHKGFSYEDARDYCLMGCVEPQKAGKMYQWTSVGYTTFTAAIELALRNGRSSAG------
A0A0G4K2Z4_9GAMM      LRKGFDYEDARDYCLMGCVEPQKSGKIYQWTSVGYTTFTAAIELAMNNGKSANG------
L0M6L3_ENTBF          LRKGFDYEDARDYCLMGCVEPQKSGKMYQWTSVGYTTFTRALELVFSNGYGPQG------
                      * ** . :*:***.:********:* ::***  .:*  .  :* .: .*           

G7WEI4_DESOD          -----TVEGIDTGDLDSFKTFEEFEAACKKQIEHIIRLSAIGTLISQRVHRELAPKPLMS
Q24ME7_DESHY          -----TMEGLDTGDLDNFKTYEEFDAACKQQIENIIRLSAIGTIISQRVHKELVPKPLMS
A0KHW9_AERHH          -----SHQGLDTGDLRELRTFEQFDAAVKQQIAHIVRMSAVGTVISQRVHRDVAPKPLMS
Q30WW3_DESAG          -----RRVAPDTGDPAGFTSYAQFEAAVKTQLDYIMEMTARGTVINQKLVRDLMPTPYMS
A0A1G5JS43_9DELT      -----SMQGVDTGDLKGLTTYEAFDAAVKKQLDHIMAMTARGTVINQTLVRDMVPTPYMS
A0A2V1H0J0_9GAMM      NLNGDSRQGLDSGPLSSFTSYDQFDAAVKQQIEHVLRLTAKGTIINQELVRDTMPTPYMS
Q3A617_PELCD          -----TKQGIDTGDLDQFATYEQFDAAVKEQIEYICKLSAVGTVISQRVHRDVAPKPMMS
CUTC_DESAG            -----KKVTPDMGDLSQYDTYEKFEAAVKEQIRWITKNTSVATVISQRAHRELAPKPLMS
C6BX55_DESAD          -----KQVCPDFGPLENYDTYEKFEAAVKEMIKYITKWTSVATVISQRVHRDHAPKPLMS
Q6AM73_DESPS          -----KQVCPDLGALESFDTYEKFDAAVKEQIKYVTKWTSVGTVISQRIHRDLAPKPLMS
B8J0I2_DESDA          -----KQVCPDLGDLSQFDTFEKFDAAVKEQIRYITKWSSVATVISQRVHRDLAPKPLMS
R3W1P5_9ENTE          -----KKVCPDLGPIATYKTYEQFEEAVKEQIRYVTKWSSVATVITQRVHRDLAPKPLMS
S0LBT6_ENTAV          -----KQVCPDMGDLSRFKTYEEFETAVKEEIKYITKWTDVATVISQRVHRDLAPKPLMS
A9KPD0_LACP7          -----KQVCPDMGALSNFKTYEEFEAAVKEQIKYITKWSDVATVISQRIHRDLAPKPLMS
Q894T5_CLOTE          -----KQVCPDMGDLSQFKTYEQFEGAVREQIKYITKWTAVATTISQRVHRELAPKPLMS
A6TUT5_ALKMQ          -----KKVCPDTGDVDGFASYEDFEKAVKEQINYITKLSSIATVITQRVHRELAPKPLMS
A8MJE8_ALKOO          -----KQVTPNMGDINQYKTYEQFEAAVKEQIQYITKLSNIATVISQRVHRDLAPKPLMS
M4YZ33_STREQ          -----KPVTPDMGPLDQYKTFEEFEAAVKATIKYVTKWTSVMTVISQRVHRELAPVPLMS
E1QYG6_OLSUV          -----KQVTPDLGDPSQYKTYEEFDEAVKKTIYYVTKWTDVATVISQRVARDVAPKPLMS
A0A6I8A9C5_9ENTR      -----KQCGPATGDVSQFSRYEDVESAVRTQLSAIVRKAAEATLIVQKLHAEHARKPLMS
D2ZGF9_9ENTR          -----KPCGPATGEVSAFSCYDDVERAVRTQLSAIVRKAAQATLIVQKLHADYARKPLMS
A0A0G4K2Z4_9GAMM      -----VQVGPATGEINTLTDYDGFELAVKNQLRHIIRQAAHASLMVQKLHRTYAPKPLIS
L0M6L3_ENTBF          -----ERIGSQTGELAAMRNYDDFEAAVKQQLAAITAKAARVTLLVQKLHKQYAPKPLIS
                                  *       :  .: * :  :  :   :   : : *         * :*

G7WEI4_DESOD          LLVEGCMEKGADVTSGGAMINYGPGLIFSGLGTYADSIAAIKKLVFEDKKYTLKQIRDAV
Q24ME7_DESHY          LLVEGCMEKGTDVTSGGARINFGPGLIFSGLGTYADSMAAIKKLVFEEKKYTLKQIRDAL
A0KHW9_AERHH          LMVEGCMESGKDVSAGGAMINYGPGLIFSGLATYVDSMAAIRKLVFEEQRYTLEQIRDAL
Q30WW3_DESAG          LFVDGCMQTGKDVTAGGAVLYEGPGTIFAGLGTYADSMAAVRRLVFDEARYTMAEMKQAL
A0A1G5JS43_9DELT      LFVDGCMQSGKDVTAGGAVLYEGPGTIFAGLGTYADSMAAIKKLVFDEKKYTLTDMKTAL
A0A2V1H0J0_9GAMM      LFVNGCMEKGKDVTNGGAVLYDGPGTIFAGLGTYVDSMAAIKKLVFDDQKYSLEQIKLAM
Q3A617_PELCD          LFVEGCMETGKDVSAGGAVLNHGPGLIFSGLATYADSMASIKKLVYDDKKYTLADFQKAL
CUTC_DESAG            LMYEGCMESGRDVSAGGAMYNFGPGVVWSGLATYVDSMAAIKKLVYDDRKYTLAQLNEAL
C6BX55_DESAD          LMYEGTMESGLDVASGGAMYNFGPGVVWSGLATYADSMAAIKKLVYDDKKYTLAQMNEAL
Q6AM73_DESPS          MMYEGCMESGKDVSAGGAMYNFGPGVVWSGLATHADSMAAIKKLVFDDKKYSLTQLNEAL
B8J0I2_DESDA          IMYEGCMEKGRDVAAGGAMYNFGPGVIWSGLATYADSMAAIKKLVYDDRKYTLQQLNEAL
R3W1P5_9ENTE          IMYEGCMENGKDVSAGGAMYNFGPGVVWSGLATYADSMAAIKKLVFDEKKYTLEELNRAL
S0LBT6_ENTAV          IMYEGCMEKGKDVSSGGAMYNFGPGVVWSGLATYADSMAAIKKLVFDEKKYTLQELNEGL
A9KPD0_LACP7          IMYEGCMESAKDVSAGGAMYNFGPGVVWSGLATYSDSMAAIKKLVFDEKKYTLEQLNEAL
Q894T5_CLOTE          MMYEGCMEKGRGVEAGGAMYNFGPGVVWSGLATYTDSMAAIKKLVFEEKKYTLEELSEAL
A6TUT5_ALKMQ          IMYEGCMEKGKDVSSGGAMYNFGPGVVWSGLATYVDSMAAIKKLVFDEKKYTFKQLNEAL
A8MJE8_ALKOO          IMYEGCMESGKDVSAGGAMYNFGPGVVWSGLATYVDSMAAIKKLVFDDKKYTLQQLNEAL
M4YZ33_STREQ          MMFEGTMEKGRGVKSGGATYNFGPGVVWSGLANYADSMAAIKKLVFDEKKYSLEELNKAL
E1QYG6_OLSUV          IMFEGCMESGKDVSAGGAMYNYGPGVVWTGLATYADSMAAIKKLVFEDHKYTLTQLFDAM
A0A6I8A9C5_9ENTR      CLIEGCIATAKDVTQGGARLNAGPGLIWTGLADCVNSLMAIRTLVFDTARFTLRQLVEAL
D2ZGF9_9ENTR          SLIDGCMATAKDVTQGGATLNAGPGLIWTGLADCVNSLMAIRTLVFETQRFTLQQVVDAL
A0A0G4K2Z4_9GAMM      CLIEGCVSSGRDVMHGGAEINNGPGLIWTGMADFANSMMVMRELVYRQGTVTAAEMAQAL
L0M6L3_ENTBF          SLTEGCMEKGRDVTAGGAWLNNGPGLIWTGLADLANGLMAVKTLVYQKKQVTLQELDDAL
                       : :* : .. .*  ***    *** :::*:.   :.:  :: **:     :  :.  .:

G7WEI4_DESOD          AANFEG--YEGIRTDCLNAPKYGNDDDYVDEIAADIINWTERVHHSFKMLYSHFTHGTLS
Q24ME7_DESHY          NANFEG--YEALRTDCLNAPKYGNDDDYADLIASDLIVWTERVHNSFKMLFSHFTHGTLS
A0KHW9_AERHH          LANFEG--FEALRRDCLNAPKYGNDDNYVDQYALDITEWTEKECRKYKMLYSRMSHGTLS
Q30WW3_DESAG          AADWAG--FEQMRRDCRNAPKYGNDDEYADGIARDIIDYTEKTINGFKTLYARLIHGTLS
A0A1G5JS43_9DELT      DANWDG--YEEIRRDCLSAPKYGNDDDYADLITRDIVDYTEKTINQHTSLYARLIHGTLS
A0A2V1H0J0_9GAMM      DANWQGAEFEEIQRDCLAAPKYGNDDDYADLIAKDITDFTEKRINQHKTLFARMIHGTLS
Q3A617_PELCD          DANWEG--YEQMRQDCLDAPKYGNDDDYADKIAADLVEFTEKACRQFKMLYSTMSHGTLS
CUTC_DESAG            KADFAG--YDQILADCLAAPKYGNDDDYADMIAADLVHFTETEHRKYKTLYSVLSHGTLS
C6BX55_DESAD          VAEFKG--YDQIKADCLAAPKYGNDDDYADMIAADLVHFTETEHRKYKTLYSVLSHGTLS
Q6AM73_DESPS          KAEFKG--YDQLKADCLAAPKFGNDDDYADLIVNDLVNFTEREHRKFKTLYSVLSHGTLS
B8J0I2_DESDA          KANFEG--YDAILADCLAAPKYGNDDDYADDIAADLIAFTEREHRKYRTLYSILSHGTLS
R3W1P5_9ENTE          KADFVG--YDQIRTDCLNAPKFGNDDDYADLIAADLIHFTEAEHRQYKTLFSELCHGTLS
S0LBT6_ENTAV          KADFAN--NDRMRTDCLNAPKYGNDDDYADLIAADLINFTEAEHRKYKTLYSVLSHGTLS
A9KPD0_LACP7          KADFAG--YDQIRTDCLNAPKYGNDDDYADLIAADLVDFTEHEHRKYKTLYSILCHGTLS
Q894T5_CLOTE          KADFVG--YERLRKDCLEAPKYGNDDDYADYIAADLVNFTEQEHRKYKTLYSVLSHGTLS
A6TUT5_ALKMQ          NKDFEG--HEELRNDCLKAPKYGNDDDYADLIAVDLVNYTENEHRKYKTLYSVLSHGTLS
A8MJE8_ALKOO          KADFVG--YDQVKSDCLKAPKYGNDDDYVDLIAADLVNFTEKEHRKYRTLHSIMCHGTLS
M4YZ33_STREQ          VADFEG--YDRIKADCLAAPKYGNDDDYVDYFTADIIEFTEEEHRKYKTLYSVLSHGTLS
E1QYG6_OLSUV          KADFEG--FEQLRKDCLDAPKYGNDDDFADSIAADIVDYTEHIHLDFKTLYSHMSTGTLS
A0A6I8A9C5_9ENTR      EHNFVG--YQEILTACQRAPKYGNDIREVDDIARELVRFLEQEHRQYRMLYAPFAFGTLS
D2ZGF9_9ENTR          EHNFVG--HDDILTACLRAPKYGNDIRAVDEIARELVRFLEQEHRQYRMLYAPFAFGTLS
A0A0G4K2Z4_9GAMM      RHNFRG--HAELRDQCLNIAKFGNDIEEVDLIARDLIRFTEYEHRQYRMLYGPFTHGTLS
L0M6L3_ENTBF          KANFIG--HEALRQLCLRAPKYGNDMADVDELARDIIHFTEQEHRRYHMLYGRLTHGTLS
                        :: .     :   *   .*:***   .*  . ::  : *     .  *.. :  ****

G7WEI4_DESOD          ISNNTPIGEITGASANGRLDWTPLSDGISPTQGADKLGPTAIIKSVSKLSCESMNIGMVH
Q24ME7_DESHY          ISNNTPIGEITGATPNGRLAWTPLSDGISPTQGADKFGPTAIIKSVSKLSVESMNIGMVH
A0KHW9_AERHH          ISNNTPIGELTNATPNGRLAWMPLSDGISPTQGADKQGPTAIIKSVSKMNVETMNIGMVH
Q30WW3_DESAG          QSFNTPLGEMVGATPDGRAAGAPLSDGMSPSQGADRKGPTAIIKSVGRLNVESMSLGMAH
A0A1G5JS43_9DELT      QSFNTPLGEMVGATPNGRSAGAPLSDGMSPSQGADTKGPTAVIKSVGKLNVESMSLGMAH
A0A2V1H0J0_9GAMM      QSFNTPLGEMIAATPNGRAAGAPLSDGMSPSQGADKFGPTAVIKSVSKINVESMSLGMAH
Q3A617_PELCD          ISNNTPIGEITGATADGRLAFTPLSDGISPVQGADKMGPTAIIKSVSKMNSESMNIGMVH
CUTC_DESAG            ISNNTPFGQLLGASANGRRAWMPLSDGISPTQGADYKGPTAIIKSVSKMANDNMNIGMVH
C6BX55_DESAD          ISNNTPFGQLLGASANGRDAWMPLSDGISPTQGADYKGPTAVIKSVSKMANDLMNIGMVH
Q6AM73_DESPS          ISNNTPFGQLLGASANGRDAWMPLSDGISPTQGADFKGPTAIIKSVSKMPTDSMNIGMVH
B8J0I2_DESDA          ISNNTPFGQLLGASAGGRKAWQPLSDGISPTQGADYKGPTAIIKSVSKMSNDNMNIGMVH
R3W1P5_9ENTE          ISNNTPLGQLTGASANGRKAWVPLSDGISPTQGADFKGPTAIVKSVSKMANDTMNMGMVH
S0LBT6_ENTAV          ISNNTPFGQMTGASANGRKAWTPLSDGISPTQGADFKGPTAIIKSISKMSNDSMNIGMVH
A9KPD0_LACP7          ISNNTPFGQLTGASANGRHAWLPLSDGISPTQGADFNGPTAIIKSISKMANDSMNLGMVH
Q894T5_CLOTE          ISNNTPFGQMTGATANGRRAWMPLSDGISPSQGSDFKGPTSIIKSVSKISCEDMNIGMVH
A6TUT5_ALKMQ          ISNNTPFGQLTGASANGRKAWAPLSDGISPTQGADFKGPTATIKSVSKMACDNMNIGMVH
A8MJE8_ALKOO          ISNNTPFGQLTGATANGRGAWTPLSDGISPTQGADFKGPTAIIKSVSKMACDNMNLGMVH
M4YZ33_STREQ          ISNNTPLGQITGASASGRRAWAPLSDGISPDHGMDTKGPTAIIKSVSKMANENMNIGLVH
E1QYG6_OLSUV          ISNNTPFGEMTGASANGRKAWTPLSDGISPTQGADFRGPTAIIKSVSKLSNDSMNIGMVH
A0A6I8A9C5_9ENTR      ISNNTPFGLITGALPSGRLAGKPLADGISPAQQTDYLGPTAIINSVSRINVEEMDIGMVH
D2ZGF9_9ENTR          ISNNTPFGLITGALPSGRLAGKPLADGISPSQQTDYLGPTAIINSVSRINVEEMDIGMVH
A0A0G4K2Z4_9GAMM      ISNNTPFGLITGALPSGRLAGQPLADGISPCQQSDTAGPTAIVNSIARINVEEMEIGMVH
L0M6L3_ENTBF          ISNNTPFGLATGALPSGRLAHKPLADGISPSQQTDVNGPTAVINSVSRLNAEEMEIGMVH
                       * ***:*    * ..**    **:**:** :  *  ***: ::*:.::  : *.:*:.*

G7WEI4_DESOD          NFKLLRGILETPEGENGLITLLRTASILGNGQMQFSYVDNEVLKKAQLEPDKYRDLIIRV
Q24ME7_DESHY          NFKLLRGILETPEGENGLITLLRTASILGNGQMQFSYVDNEVLKRAQIEPDKYRDLIIRV
A0KHW9_AERHH          NFKFLKGLLDTQEGRHGLITLLRTASILGNGQMQFSYVDNEVLKKAQQEPEKYRDLIVRV
Q30WW3_DESAG          NFKLVHGCLETQEGRAGLVSLLKTASVLGNGQMQFNYVDDSMLRDAQRHPEQYRDLMVRV
A0A1G5JS43_9DELT      NFKLMQGSLETPQGEAGLIALLRTASLFGNAQMQFNYIDNETLRKAQENPEAYRDLMMRV
A0A2V1H0J0_9GAMM      NFKLLKGSLDTPQGEAGLVNLLRTASVLGNAQMQFNYLDNETLVKAQKNPEQYRDLMVRV
Q3A617_PELCD          NFKLMEGILETPEGEAGLITLLRTASILGNGQMQFSYVDNEVLKQAQQSPEEYRDLMIRV
CUTC_DESAG            NFKLMSGLLDTPEGENGLITLIRTACMLGNGEMQFNYLDNELLLDAQKHPEKYRDLVVRV
C6BX55_DESAD          NFKIMSGLLDTPEGENSIITLLRTASALGNGEMQFNYLDNATLLDAQKHPEKYRDLVVRV
Q6AM73_DESPS          NFKLMSGLLDTPEGENGIITLIRTASMMGNGEMQFNYLDNDTLLDAQLHPEKYRDLVVRV
B8J0I2_DESDA          NFKLMPGLLDTPEGEQGIITLIRSASILGNGEMQFNYLDNKTMLEAQQNPKDYRDLVVRV
R3W1P5_9ENTE          NFKIMSGMLNTPEGEESLITLLKTASVLGNGEMQFNYLDNDTLLAAQEHPEEYRDLIVRV
S0LBT6_ENTAV          NFKIMTGLLDTPEGEESLITLLKTACHLGNGEMQFNYLDNNTLIEAQKHPEQYRDLIVRV
A9KPD0_LACP7          NFKIMSGLLDTPEGEESLITLLRTACMFGNGEMQFNYLDNNTLIDAQKHPEKYRDLIVRV
Q894T5_CLOTE          NFKLMSGLLDTPEGEQGIIALLRSACALQLGEIQFNYLDNETLIEAQKHPEQYRDLIVRV
A6TUT5_ALKMQ          NFKLMSGLLDTPEGEEGIVTLLRTASMLGVGEMQFNYLDNETLIKAQKNPEQYRDLIVRV
A8MJE8_ALKOO          NFKLIAGLLDTPEGEEGIITLLRTANNIGIGEMQFNYLDNNTLLEAQKHPEKYRDLIVRV
M4YZ33_STREQ          NFKIMAGLLDTPQGEESLITLLRTASILGNGEMQFNYLDNSILVDAQKHPEKYRDLIVRV
E1QYG6_OLSUV          NFKLMSGLLDTPEGENGLVTLLRTASMFGNGEMQFNYLDNKTLIDAQEHPERHRDLVVRV
A0A6I8A9C5_9ENTR      NIKLMFGMLETPEGQNSLIHLLRTASILGNAQLQFSYVDDETLRKAQKHPAEYRNLMIRV
D2ZGF9_9ENTR          NIKLMYGMLETPEGQNSLIHLLRTASILGNAQLQFSYVDDDTLRQAQQNPGDYRNLMIRV
A0A0G4K2Z4_9GAMM      NFKLMYGMLDTPEGEQGIINLLRSASLLGNAQMQFSYVDNDTLLKAQQDPDAYRNLMIRV
L0M6L3_ENTBF          NLKLMHGMLESDEGINQLINLLRSASMLGNGQMQFSYVDNEELKRAQAHPEDYPNLMIRV
                      *:*:: * *:: :*   :: *:::*  :  .::**.*:*:  :  **  *  : :*::**

G7WEI4_DESOD          AGYSAYFVELCKEVQDEIISRTVLEHF
Q24ME7_DESHY          AGYSAYFVELCKEVQDEIISRTVLEHF
A0KHW9_AERHH          AGYSAYFVELCKEVQDEIISRTVIEKF
Q30WW3_DESAG          AGYSAFFVELCKEVQDEIISRTALH--
A0A1G5JS43_9DELT      AGYSAFFVELCKDVQDEIISRTMIE--
A0A2V1H0J0_9GAMM      AGYSAFFVELCKEVQDEVISRTML---
Q3A617_PELCD          AGYSAFFVELCKEVQDEIISRTTLSGF
CUTC_DESAG            AGYSAFFVELCKDVQDEIISRTMLHGF
C6BX55_DESAD          AGYSAFFVELCKDVQDEIISRTMMNEI
Q6AM73_DESPS          AGYSAFFVELCKDVQDEIISRTMLTEI
B8J0I2_DESDA          AGYSAFFVELCKDVQDEIISRTVLRHF
R3W1P5_9ENTE          AGYSAFFVELCKDVQDEIISRTMLTKF
S0LBT6_ENTAV          AGYSAFFVELCKDVQDEIISRTMLTKI
A9KPD0_LACP7          AGYSAFFIELCKDVQDEIISRTMLTHF
Q894T5_CLOTE          AGYSAFFVELCKDVQDEIISRTMLTHF
A6TUT5_ALKMQ          AGYSAFFVELCKDVQDEIISRTMLTKI
A8MJE8_ALKOO          AGYSAFFVELCKDVQDEIISRTMLTHF
M4YZ33_STREQ          AGYSAFFVELCKDVQDEIIARTVLTKI
E1QYG6_OLSUV          AGYSAFFNELCKDVQDEIISRTMLEKF
A0A6I8A9C5_9ENTR      AGYSAFFVELSKEVQDEIISRTTQRHF
D2ZGF9_9ENTR          AGYSAFFVELSKEVQDEIISRTTQRHF
A0A0G4K2Z4_9GAMM      AGYSAFFVELSREVQDEIISRTLLRHF
L0M6L3_ENTBF          AGYSAFFVELSREVQDEIISRTVQHEY
                      *****:* **.::****:*:**