CLUSTAL format seed alignment for MF_02060

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F4B0W0_DOKS4      -----------------------------MDQELLAYLQSFLTERRVQLFDKVLKERTNH
G2Z155_FLABF      ----------------------------MIDLDYLAYLETFLTENRKENFLKILKNRTNH
A0M0C5_GRAFK      ----------------------------MNDKNTLDHLQSFLTPRRKALFEKVLAQRTDH
TRMH_BORBU        --------------------------MDDDVLKRIGVLSKFITDEKKARIEKVLNLRTNY
A1QYK2_BORT9      ------------MNWILLFFYIKLYFVSNEILKRIEILSEFITQRRRERIDEVLSNRTNY
F9ZAU0_ODOSD      ---------------------------MKSIKEQVEYLRDFVVDEKNALFDRLIQERTDY
J9R3E9_RIEAN      -------------------MKPELTNNLEDLEKTFQYLAQFLTEERLQKINHYAEESSDF
I4B7Y9_TURPD      -------------------------------MVTGDGDARFLTEKRRERLQAALANRTRR
C7LUN6_DESBD      ------------------------------------MPDRFLTEDRKTRLRSVLARRQPD
F0JKX4_9DELT      -------------------------------------MSKQITEARKRRIDAVLARRQKD
B8DND5_DESVM      ----------------------------------------------MERIRRVLGWRQKD
D1CE78_THET1      -----------------------------------MNTTRKITERRLNRMIQVLKRRQPD
A7MQB1_CROS8      -----------------------------------------MNSQRYARICEMLARRQPD
TRMH_ECOLI        -----------------------------------------MNPTRYARICEMLARRQPD
D8MKB8_ERWBE      -----------------------------------------MNAQRYARILEMLAARQHD
H2IYA4_RAHAC      -----------------------------------------MTPERYARIREMLAARQPD
Q6DB63_PECAS      -----------------------------------------MTPQRYARIKEMLNCRQPD
E1SIV4_PANVC      -----------------------------------------MNDQRFARIQAMLALRQHD
D3VF78_XENNA      -----------------------------------------MNPKRYARICQMMAMRQPD
M1SRC3_MORMO      -------------------------------------------------------MRQPD
A1T0B4_PSYIN      -----------------------------------------MSPERLARITNMLNYRQPD
A0KR25_AERHH      -------------------------------MHTPHDIETDMTPERFKRITDMLAQRQLD
Q5QYH3_IDILO      ----------------------------------------------------MLDKRQPD
A3QIR9_SHELP      -----------------------------------------MSPERFKRINQMLDNRQTD
B1KLV5_SHEWM      -----------------------------------------MSPERFARINKMLDNRQPD
Q8KE14_CHLTE      ---------------------------MPQARLRQTNLIALVSPERFRKIRELLEKRQTD
B4S7D5_PROA2      ----------------------------------------MINPERFHKIRRLLEQRQPD
B4SB16_PELPB      ----------------------------------------------------MLLHRQPD
TRMH_THET8        --------------------------------------MRERTEARRRRIEEVLRRRQPD
A5GMP3_SYNPW      ---------------------------------------MPLLPRRFERLRTVLNQRMAD
Q9RSB4_DEIRA      ---------------------------------------MAPTPERYAKIRRVLSKRQPT
Q1IW56_DEIGD      -----------------------------------------MTPERYQKIRRVLARRQPT
E8U2Y2_DEIML      -----------------------------------------MTPERFEKLKRVLSQRQPT
D7BGA0_MEISD      -----------------------------------------MTPERWQKIQQVLARRQPD
K0C886_ALCDB      -----------------------------------------MTPERYRRLLDTLDRRQPD
Q0AB97_ALKEH      -----------------------------------------MTARRLHRMRQTLERRQPD
TRMH_AQUAE        ---------------------------------MVMEYLV--LEKRLKRLREVLEKRQKD
F8AC88_THEID      ----------------------------------MKDFLV--IPERLARIKEVLERRQPD
A6Q996_SULNB      ---------------------------------MKEERRVRSSQERIDRIDQILCCKQPT
F4KTV9_HALH1      -----------------------------------------MEASREQKIRQLAQNRQFD
E1WXK8_HALMS      MRTAVYSTKIMKVVFKAHEEKLEINDKNFDHHTMRSIVEDSLNDQRKELIERILDQRISG
B7GMP7_ANOFW      ------------MSRMRMTKEEELHIEEGLLTDDNRLLWEMILPSRLKRMYDVLSERTRY
D0LNM3_HALO1      -------------MSRSVKPNVDNLIRQYGPERIIEALRPFVTDERAARIDSVLSARLSG
D9SAB1_FIBSS      -----------------------------------------MTERRRELLTSVVNRRTRH
D6YTW0_WADCW      ---------------MSKSPDFIRHLHSLGAKTIIEKLSPYLTDERKRKIDPVVKYRIQS
                                                                              

F4B0W0_DOKS4      FTVAVEDVYQLHNTSAVIRSCESFGVQELHVIEEVNVKRIDRE--------IAMGAQKWV
G2Z155_FLABF      FTVAIEDVYQLHNTSAVMRSCEVFGVQELHVIEQRFGKSIDRE--------IAMGAQKWV
A0M0C5_GRAFK      LTVVAQDVYQLHNTSAVVRSCDVFGIQNIHVIEEKIPRRIDKE--------IAMGAQKWV
TRMH_BORBU        LTFVLEDIFQSQNASATIRTGEILGLSDVHVIEKKNKHTLNPD--------VTLGSSQWI
A1QYK2_BORT9      LTLVLEDIFQPQNASATMRTIEILGLSNIHIIETNNTYTLNPG--------VVLGASKWI
F9ZAU0_ODOSD      VTVVLEDLFQSHNQSAVMRSADCYGIQHVHLIENRNSYDMTST--------VSQGARDWL
J9R3E9_RIEAN      ILPVMEDVYQYRNAAAIVRSVEACAFHKVVALEKDNIFDPNLS--------VTKGADTWV
I4B7Y9_TURPD      LTVLLEDIYDPLNASAVLRTADGLGIQDIHIAENRHAFNAHAK--------VAGRAASWL
C7LUN6_DESBD      LTLVLNNIHDPHNVSAILRSCDAFGVFGVHLYYTKEKFPSLAN-------SSSGSAKKWI
F0JKX4_9DELT      LTLVMDNIWDPHNVSAVLRSCDAFGVAGVHLYYTDSQWPDLAL-------KSSGSATKWV
B8DND5_DESVM      LTLVLANIHDPHNVSAIYRSCDAFGVAQVHLYYTDTAFPVLGR-------KSSASARKWV
D1CE78_THET1      LTVVLENVHDPHNVSAVLRSCDAVGVLAVHLVYTIEEFPDLSK-------NVSGSALKWL
A7MQB1_CROS8      LTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGNRMRTMAS--------SAAGSNSWV
TRMH_ECOLI        LTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGSRMRTMAS--------AAAGSNSWV
D8MKB8_ERWBE      LTVCMEQVHKPHNVAAVIRTADAVGVHEVHAVWPGSRMRTMVS--------SAAGSNSWV
H2IYA4_RAHAC      LTVCMEQVHKPHNVSAVIRTADAVGVHEIHAVWPTTRMKTLVS--------SAAGSNSWV
Q6DB63_PECAS      LTICMEQVHKPHNISAVIRTADAVGVHQVHAIWPTSRMKTLVS--------SAAGSNSWV
E1SIV4_PANVC      LTVCMEQVHKPHNVSAVIRTADAVGIHEVHAVWPSQRMRTQAS--------ASAGSNSWV
D3VF78_XENNA      LTICLEEVHKPHNVSAVIRTADAIGIHQIHAIWPDQSLRTQLS--------SAAGSNSWV
M1SRC3_MORMO      LTLCLEEVHKPHNVSAVIRSADAVGIHDLHAVWP-EKIKTLVS--------SAAGSNSWV
A1T0B4_PSYIN      LTVFLEQVHKAHNLAAIVRTADAVGVSDVHATWENKTTQISGN--------TATGSQNWV
A0KR25_AERHH      LTVCMEEVHKPHNLAAIVRTADAIGIHRVHAVWPKTWIHKRKG--------TARGSQNWV
Q5QYH3_IDILO      LTVVMENVHKNHNLSAVVRSADAIGVHEMHAIWLTKKARLSGG--------TALGSQNWV
A3QIR9_SHELP      LTVCLDKVHKTNNIAAVIRTADAVGIHQIHAVWPDIEMRVSGN--------TASGSQQWV
B1KLV5_SHEWM      LTLCLDKVHKTNNIAAVIRTADAVGVHQIHAVWPDIEMRVSGN--------TASGSQQWV
Q8KE14_CHLTE      LTLVMDNVNKPHNLAAIIRSCDAVGIHQVHAISYRSSIKTKQH--------TAAGASRWL
B4S7D5_PROA2      LTVVMDNVNKPHNLAAIIRTCDSVGIETIHAVSNRPSIRKKQK--------TAGGSTRWV
B4SB16_PELPB      LTVIMDNVNKAHNLSAIIRSCDGVGIDEIHAVSYRKSIYAKQN--------AAAGASKWL
TRMH_THET8        LTVLLENVHKPHNLSAILRTCDAVGVLEAHAVNPT-GGVPTFN-------ETSGGSHKWV
A5GMP3_SYNPW      LTVLVEHVEKPHNLSAILRSCDAVGVLEAHAVSFS-GRPRTFN-------STAQGSQRWV
Q9RSB4_DEIRA      LTVLMDEVNKPHNLSAIIRTCDAVGVPEAHAVPPKHGTLASFEGHT--YEATSGSAHKWV
Q1IW56_DEIGD      LTVLMDEVNKPHNFSAILRTCDAVGVLTAHAVPPKSGVLPTFD-------ATSGSAHKWV
E8U2Y2_DEIML      LTVLMEEVNKPHNFSAILRSCDAVGVWEAHAVPPKNGKLPTYN-------ATSGSAEKWV
D7BGA0_MEISD      LTVLMERVHKWHNFSAVLRSCDAVGVLEAHLIPAAHGIPTEDQNPSRHTAATSGSAAKWV
K0C886_ALCDB      LTVIMEGVHKPHNIAAVVRTCDAVGILDVHAVLPENRARVAAG--------TAMGSQRWI
Q0AB97_ALKEH      LQVLLDQVHKPHNLSAILRTCDAVGVPRAHAVSRHQDFTVHRA--------ASSGTGQWV
TRMH_AQUAE        LIVFADNVKNEHNFSAIVRTCDAVGVLYLYYYHAEGKKAKINE-------GITQGSHKWV
F8AC88_THEID      LRLFLERVVNYHNVSAILRTADAVGVLHVHYFHEG--ELPIND-------AITCGAHRWL
A6Q996_SULNB      LKVMLDDVHSSQNLSAILRTCDAVGVQHLYYTTSDNRDLRIHK-------TITQGAHRWV
F4KTV9_HALH1      LTVILENVDDPHNVGAVLRSCDSVGIREIFVLYTRPGLQNHKLELG---KRTSAGSRKWI
E1WXK8_HALMS      LSVILESLGDLGNLQAISRTCDNFGVQKLEIIETKGPMKWTNR--------TSQGAHKWV
B7GMP7_ANOFW      ITILTEAVDDPHNQAAVLRSAEAFGIQDVHVVTGAAPFEPNKW--------VTRHADKWL
D0LNM3_HALO1      LTVAIENLHDPHNGAAVVRSVEAVGLTSLHVAEPIERFQFSPA--------VAIGSEKWI
D9SAB1_FIBSS      FCMVLEDLFDPHNISAVIRTAEVFGLQDVHIIEEDNAYSVNKS--------ILKGSYKWM
D6YTW0_WADCW      IQTAAEAPSDIHNALAMVRTAEALGLTDAHLIGKPRKGRGRQT---------MRGSDRWM
                  .        .  *  *  *: :  ..                             :  *:

F4B0W0_DOKS4      DVQRHS-------------------SAKHCIENLRKQ--GYKIVATSPHKDAH--RLEDF
G2Z155_FLABF      DIYKYE-------------------SQQTCIETLRNK--GYQIIATTPHENDC--LLEDF
A0M0C5_GRAFK      DINRYT-------------------STTTCLKNLKKK--GYRIVATSPHDDSQ--LLEDF
TRMH_BORBU        NLNKYK-------------------NAKFAIDRLKSD--GYSIVATSLNPKSI--NLENL
A1QYK2_BORT9      DIIKYQ-------------------CVESAFDNLKGN--GYKIVATSLDNEAI--FLDDF
F9ZAU0_ODOSD      SIHRHKE---------------LENNTQATIDQLRAE--GYRILATTPHANDI--FVDDI
J9R3E9_RIEAN      EVEKMP-------------------RNKASLEKIKER--GYKIVAVSPENNAM--MLPDY
I4B7Y9_TURPD      TIKKYRENFANTKVDFRIKPEGVQHSTAAAFAALKKD--GYTVLATSPRGRST--PLREL
C7LUN6_DESBD      DLTRHR-------------------EAGPMIQGLRGR--GMQIVGTGFSPTAR--PIMDI
F0JKX4_9DELT      ERTEHV-------------------DAAEMVAELKGR--GMRVLRTGFSDSAR--PVMDF
B8DND5_DESVM      DTVRHS-------------------DAQSLMRTLKEG--GHRVLATSCTPAAK--PLGDY
D1CE78_THET1      EIIKHK-------------------DIQDCYDTLRSQ--GMTIYTTYLADPQRSHDLYSL
A7MQB1_CROS8      EVKTHR-------------------NISDAVNHLKAR--GMQILATHLSDKAV--DFREI
TRMH_ECOLI        QVKTHR-------------------TIGDAVAHLKGQ--GMQILATHLSDNAV--DFREI
D8MKB8_ERWBE      QVKTHS-------------------NIADAVGHLKGQ--GMQILATHLSDKAV--DFREI
H2IYA4_RAHAC      QVRTHK-------------------TIQDAVAKMKAK--GMQILATNLSEKAV--DFRAI
Q6DB63_PECAS      QVKTHR-------------------TIQDAVGHLKNE--GMQVLATNLSEHAV--DFREI
E1SIV4_PANVC      KVVTHP-------------------TIGDAVKQLKQQ--KMQVLATHLSDDAV--DFREI
D3VF78_XENNA      QVQTHS-------------------TIQQAIEQFKSD--GMQVLATHLSDKAV--DFRQI
M1SRC3_MORMO      NVHNHD-------------------TLAGAVTLLKSQ--GMQILATHLSDSAV--DFRAI
A1T0B4_PSYIN      NLHSHE-------------------TLEDAVKALRAQ--GMQIIATNLSDSAI--DFREV
A0KR25_AERHH      DVKLHP-------------------DIGSAVAELKAS--GMQILATHLSDSSV--DFRAI
Q5QYH3_IDILO      KIHNHK-------------------TVGEALEATQGR--GMQVVVTHLSEHSV--DFREV
A3QIR9_SHELP      KTIKHY-------------------HMDEAAAQFKAA--GMQILATNFSENAV--DFRDI
B1KLV5_SHEWM      KTIKHY-------------------HMDDAQQAFRAQ--NMQVLATTFSETAV--DFREI
Q8KE14_CHLTE      KVHLNE-------------------SFVPVGEKLRQS--GMQILVAHYCPEAV--NFRSI
B4S7D5_PROA2      QLSLHE-------------------SMENLANTLKSN--GTRLLAAHYSSTSV--DFRSI
B4SB16_PELPB      TLTLHP-------------------DIASAYRKVSAC--GMQILVATGKEGSR--DFRAI
TRMH_THET8        YLRVHP-------------------DLHEAFRFLKER--GFTVYATALREDAR--DFREV
A5GMP3_SYNPW      PLRDHA-------------------TIASAVHHLKDR--GFKLYGTNLGVDAR--DYRDC
Q9RSB4_DEIRA      KVHPHA-------------------DAVSAVRELQAQ--GFQVLATHLSQRSV--DYREP
Q1IW56_DEIGD      AVQRQP-------------------DAVTAVRQLQAA--GMQVLATHLSQRSL--DYREP
E8U2Y2_DEIML      RVQSHA-------------------DAPSAVRELQGR--GFQVLATHLSARSV--DYREL
D7BGA0_MEISD      GLRTYP-------------------DTPSAFADLRSR--GFVIYAAHFSHKAI--DYREV
K0C886_ALCDB      NLHKHN-------------------DGVAAIDQVRTQ--GMQVLAAHFSDTAL--PYREV
Q0AB97_ALKEH      AVETHA-------------------DLPAAVRAVQGQ--GMKVYAAHLSEQAV--DYRQV
TRMH_AQUAE        FIEKVD-------------------NPVQKLLEFKNR--GFQIVATWLSKESV--NFREV
F8AC88_THEID      LLHREE-------------------KVKEALTKLRDQ--GFQLVATGLFPETI--DFREV
A6Q996_SULNB      ERTRIS-------------------TEEQRVFLQKKQKEGYQVVVTHLEERAV--PFREV
F4KTV9_HALH1      DVYLYR-------------------EVDACMEHVRRN--YQRVYATHLAHDAK--SLYEL
E1WXK8_HALMS      TMQKWY-------------------ETKDCLQYFKDR--GVQIVSTAFSDKAI--PYTEV
B7GMP7_ANOFW      NVHKHS-------------------SIEQAIRHLQQN--GYQVYASYLGEGTI--PLEQI
D0LNM3_HALO1      RVLRHQ-------------------GFTACARILRGA--GFRMYAACPDAEMS---MDDI
D9SAB1_FIBSS      SLYLYK-------------------KRMLCMEKLREK--GYKIAVASTNTTNS---VLDL
D6YTW0_WADCW      NLHSHS-----------------------SLDTFQKSMKGFVIYGATPHGNTP---LHAL
                                                            :                 

F4B0W0_DOKS4      DITE-KAAIFFGRETEGLSDTVLDMADDFIYIPMVGFTESLNISVSAAITLQHIMTKLKQ
G2Z155_FLABF      DISK-PSALFFGTERAGLSEEIIKNADGFLKIPMVGFTESLNISVSAAIILQNLTSRLRK
A0M0C5_GRAFK      DIST-PAALFFGTEKDGLSEEVMREADATVKIPMVGFTESLNISVSAAIILQSLTTKLRK
TRMH_BORBU        TINN-KMAIFFGTELTGLSAEVLGAADLYVKIPMYGFTQSYNISVAVAIVMYSLLMRLRK
A1QYK2_BORT9      PIDD-KMAIFFGTELTGLSNTVLENADLHLKIPMYGFTQSYNLSVAVSIVFYSLISRLRK
F9ZAU0_ODOSD      DLEKGKMAFFFGTELTGLSDLVIGQADEFVKIPMYGFTESLNVSVCAAITMYSVTRRLRG
J9R3E9_RIEAN      KVET-PIALVFGTEWEGVSDELLDFADETLAIPMYGFTKSFNVSVAAAICMYELKQKLLN
I4B7Y9_TURPD      DITK-KYAIVLGSEHWGLSDWAIENADAAIALPMLGFTESYNISVTAAMILFYLSDRLRS
C7LUN6_DESBD      DFTR-PTAIILGNEHRGMDPDVKIHVPDEIYIPMFGMVQSLNVSVAAATILYEAMRQRLA
F0JKX4_9DELT      DFTK-PTAIILSNEHRGTSPDLAALVPDEIYIPMQGMVQSFNVSVAAAIILYQAFTQRDA
B8DND5_DESVM      DMTQ-PTAIIMGNEHSGVAPELVELVDGEVYIPMYGMIQSFNVSVAAAVLLAEASRQRVL
D1CE78_THET1      DLTK-PTALVFGNEQRGVSEEASRLADGNFVIPMMGMVQSLNISVACAVTLYEALRQRRA
A7MQB1_CROS8      DYTR-PTCILMGQEKTGITEEALSLADQDIIIPMTGMVQSLNVSVASALILYEAQRQRQN
TRMH_ECOLI        DYTR-PTCILMGQEKTGITQEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQN
D8MKB8_ERWBE      DYTR-PTCILMGQEKTGITQQALDLADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQN
H2IYA4_RAHAC      DYTR-PTCILLGQEKTGITPEALALADSDIIIPMIGMVQSLNVSVASALILYEAQRQREN
Q6DB63_PECAS      DYTR-PTCILLGQEKTGITAEALKLADRDIIIPMTGMVQSLNVSVASALILYEAQRQRQI
E1SIV4_PANVC      DYTL-PTCILMGQEKTGITEEALALADRKIVIPMVGMVQSLNVSVACALILYEAQRQRQN
D3VF78_XENNA      DYTK-PTCIIMGQEKKGISKQAVALADHDIIIPMAGMVQSLNVSVASALILYEAQRQRQL
M1SRC3_MORMO      DFTR-PTCIIMGSEKTGISQEAIRLADQHIMIPMSGMVQSLNVSVAAAVILYEAQRQREA
A1T0B4_PSYIN      DYTK-PTAILMGQEKHGISPEALALADQDVIIPMVGMCQSLNVSVASALILYEAQRQREL
A0KR25_AERHH      DYTK-PTAILVGQEKHGIGEEALALADHHIVIPMVGMVQSLNVSVAAAAILYEAQRQREL
Q5QYH3_IDILO      DYTK-PTAILLGQEKYGVTDEALDIADYHVMIPMVGMVQSLNVSVAGAVMLYEAQRQREQ
A3QIR9_SHELP      DYTK-PTVVIMGNERDGVSEEGLAIADQQIIIPMIGMVQSLNVSVASALVMYEAQRQRAE
B1KLV5_SHEWM      DYTR-PTAIILGNERDGVSQEGIAAAGQHIIIPMIGMVQSLNVSVASALVMYEAQRQRTA
Q8KE14_CHLTE      DYTR-PTAIVMGEELKGPSQEALGLADNFIYIPMMGMVESLNVSVAAALILFEAQRQRQA
B4S7D5_PROA2      DYTR-PTAIVMGAEKLGPSSDTISLVDQAIHIPMQGMAESLNVSVAAAVILFEAQRQRLA
B4SB16_PELPB      DYTV-PTALVMGAEWDGISEEAIKGADHAITVPMFGMVESLNVSVATAVILFEAQRQRAE
TRMH_THET8        DYTK-PTAVLFGAEKWGVSEEALALADGAIKIPMLGMVQSLNVSVAAAVILFEAQRQRLK
A5GMP3_SYNPW      DFTG-PCAFVLGAEKWGLTEEATGLMDQAVFIPMRGMVQSLNVSVATATLLFEALRQRQA
Q9RSB4_DEIRA      DYTK-PTCVLLGAEKWGVSDEAAEAADANIVIPMFGMVQSLNVSVAAATILFEAQRQRLA
Q1IW56_DEIGD      DYTR-PTCVLLGAEKWGVSDEAAEIADANIVIPMFGMVQSLNVSVAAATILFEAQRQRLS
E8U2Y2_DEIML      DYTR-PTCVLLGAEKWGVSEEAADAADANVVIPMLGMVQSLNVSVACATILFEAQRQRLA
D7BGA0_MEISD      DYTR-PTCILLGTEKWGVTEEAATLADGHIVIPMMGMVQSLNVSVAAAVILFEAQRQRIQ
K0C886_ALCDB      DFTK-PTALLLGTERFGVSEAAGAAVDGHVIVPMMGMVASFNVSVAAAIILSEACEQRRA
Q0AB97_ALKEH      DYTK-PCCLLLGAEKEGVSEEGAALADGHVIIPMFGLGASLNVSVAAAVILFEAQRQRLA
TRMH_AQUAE        DYTK-PTVLVVGNELQGVSPEIVEIADKKIVIPMYGMAQSLNVSVATGIILYEAQRQREE
F8AC88_THEID      DYTR-PTVIIVGHELEGISETVRELAHAVVKIPMHGMVQSLNVSVATGIILYEAERQRKE
A6Q996_SULNB      DYTK-PTIIVMGNEKDGVSSETVELADTVIIIPMQGMVQSLNVSVAAALILYEAERQLAE
F4KTV9_HALH1      DLAQ-SAALMFGNEADGLSELALSQADGNFIIPQVGMAQSLNVSVACAVSLYEAFRQRSA
E1WXK8_HALMS      DFTK-PTALLMGNESFGISEVAREMSDVECIIPSYGYSQSLNVSVAAAIVIEHATSQIRK
B7GMP7_ANOFW      DVSK-PTVLLFGNEHRGVSEEALALADGKFVIPMNGFVQSFNISVAAAISLYEITKRAKQ
D0LNM3_HALO1      DVSQ-PSAVVFGNEHEGLSRRAIDACDAKVAIPMHGFTQSLNLSVSVAVSIFQLAARRRA
D9SAB1_FIBSS      DLSQ-PMAFYLGSEFHGNHPDTLAHADYEFKLPQYGITESMNVSVAGGVLMTYLDVFMQK
D6YTW0_WADCW      SLDR-PCCFLFGNEKNGLTDAALNICTSHFTIPMYGFCESFNLSVAAAITLHHAVTEKRK
                          . .. *  *              :*  *   * *:**  .  :         

F4B0W0_DOKS4      SSNSWQ----FTEQELFDKKLEWTRKMIKDVEGIEQRFLEERG-----------------
G2Z155_FLABF      STIDWQ----LNEAVLLEKRLNWTKNSIKDIKRIESRYYNENIK----------------
A0M0C5_GRAFK      SGVEWQ----FSEEEKNLIRMNWTKKTVKNSEEIIEHFLNQ-------------------
TRMH_BORBU        SSIDYL----LNEAEKSNLRLKYYRQVVKNYQFIENLINS--------------------
A1QYK2_BORT9      SSIKYL----LNEDEKLVLKLDYYRKIVKKYQTIEKLKLF--------------------
F9ZAU0_ODOSD      SGIDWH----LSDRAKDEILFKWYKNAIKASGEILERFNEE-------------------
J9R3E9_RIEAN      STIDYK----LSPDEKWHTKIRWAVNSIRSGEEIYHKFLRENFNNP--------------
I4B7Y9_TURPD      ETVDWG----LSEEEKEQLWSDWTRLKR--------------------------------
C7LUN6_DESBD      AGMYDQ--SPLDTDEFEDVYADWCKRGKDY------------------------------
F0JKX4_9DELT      AGMYDE--PSFSREELESLKPQWYMR----------------------------------
B8DND5_DESVM      AGMYDR--PSWPEEELEARIAAWAEK----------------------------------
D1CE78_THET1      AGHYDH--PKLSREEISTRLHNWLQREKRSIEELQKLI----------------------
A7MQB1_CROS8      AGMYQRANSTLPEKEQQRLLFEGGYPVLAKVAKRKGLPYPRVNEHGE-------------
TRMH_ECOLI        AGMYLRENSMLPEAEQQRLLFEGGYPVLAKVAKRKGLPYPHVNQQGE-------------
D8MKB8_ERWBE      AGMYQRRESTLEYSEQQRLLFEGGYPVLARVAKHKGLPYPEISDVGE-------------
H2IYA4_RAHAC      AGMYRRDSSLLSEKEQQRLLFEGGYPVLSNVAKRKKLPRPFIDDHGQ-------------
Q6DB63_PECAS      AGMYQREDSPLDEEEQQRLLFEGGYPVLARVAKHKGLPRPYIDHQGQ-------------
E1SIV4_PANVC      AGLYLRDYSLLDDDEQQRLLFEGGFPVLARVAKQKGLPYPRINAQGE-------------
D3VF78_XENNA      VGMYQREESILSEEEQQKLLFEGGYPVLAAVSRRKGLAQPLIDQQGQ-------------
M1SRC3_MORMO      AGLYEHPRCALAQDEQQRLLFERGYPVLAQVAREKKLPRPQIDEQGH-------------
A1T0B4_PSYIN      AGMYNGE-CRLPEEEAHRILFEGGHPIFTQLCKERNLPYPPLDDKGQ-------------
A0KR25_AERHH      AGCYQRG-CPLDLEEQNSILFEGGYPIYAQLCKEKEMPYPQLGPAGE-------------
Q5QYH3_IDILO      AGLYDK--THISAEERHRVLFEGGHPIYAKACKRKNMPYPELDENGQ-------------
A3QIR9_SHELP      AGMYGQ--RTLDDAYCQTMLFEQGHPVYAKACRRKKIPYPAIDEKGQ-------------
B1KLV5_SHEWM      AGMYGT--RKLDEAYCQKMLFEQGHPIYAKACRRKSIPYPAVDMEGQ-------------
Q8KE14_CHLTE      AGLYDT--RHFSDSDIERLLFEYTYPRLAAVLRDQGKPYPKLNENGA-------------
B4S7D5_PROA2      AGCYEK--IALEKETLEKRLFELAYPSIAEKLAMQAKPYPPLDEEGR-------------
B4SB16_PELPB      KGMYKR--QQLEENCFERMLFEHAYPRLSREFREKECAYPRLDADGR-------------
TRMH_THET8        AGLYDR--PRLDPELYQKVLADWLRK----------------------------------
A5GMP3_SYNPW      AGVAPHNGEGIPAEQYGDLLFEWAYPQVAAWCREQGRSYPALSGDGE-------------
Q9RSB4_DEIRA      AGMYEE--PQLSPEELHRLSFEWGYPDLAPGYRERGEAYPALGEEGE-------------
Q1IW56_DEIGD      AGMYDT--PQLAPAELDRLAFEWAYPDLAAGYRERGERYPALDEAGQ-------------
E8U2Y2_DEIML      AGLYGQ--APFPPDEFDRVLFEWAYPDLADTYRERGEPYPALDEHGE-------------
D7BGA0_MEISD      AGMYDR--PRLEPALHQRLLFEWAYPDWAERCRKEGRDYPALSPEGE-------------
K0C886_ALCDB      AGFYDR--PRLAPETYRHTLFRWAHPKLAGYCDRYGLPYPELNDNGEVRHATRFNAELAA
Q0AB97_ALKEH      AGQYET--PRMAEAEITRTLVEWLHPRIAERCRKEGRPYPALDEDG--------------
TRMH_AQUAE        KGMYSR--PSLSEEEIQKILKKWAYEDVIKERKRTLSTS---------------------
F8AC88_THEID      KGLYEI--SHLSEEEIESILEDWAYHRVIKDKARGRLSS---------------------
A6Q996_SULNB      AGKYDT--PQLSKEEREKIKSGWLYRDNIARRSKGKIPLR--------------------
F4KTV9_HALH1      KGLYGV--GNPASTDQQAALLEDYFRRQEDLEEAWKTTK---------------------
E1WXK8_HALMS      AHQGGGDFNEEQREFFKSFFYFQANQYSRALMREHFKKKAL-------------------
B7GMP7_ANOFW      VAGERY---HLSLAEKKEIYEHWMKLSLSPRLRKMVESQMGGSND---------------
D0LNM3_HALO1      LLGRLG---DLEDQERAILQARWYSLSVRGVQSILERVVS--------------------
D9SAB1_FIBSS      QGREKF---ALPQAERDALLLDWLDRHVNGIETNSPIVRVGE------------------
D6YTW0_WADCW      LLASPG---DLSIEEKQAEIAWFYFKSAGKQLSNLILNR---------------------
                                                                              

F4B0W0_DOKS4      -------------------------------
G2Z155_FLABF      -------------------------------
A0M0C5_GRAFK      -------------------------------
TRMH_BORBU        -------------------------------
A1QYK2_BORT9      -------------------------------
F9ZAU0_ODOSD      -------------------------------
J9R3E9_RIEAN      -------------------------------
I4B7Y9_TURPD      -------------------------------
C7LUN6_DESBD      -------------------------------
F0JKX4_9DELT      -------------------------------
B8DND5_DESVM      -------------------------------
D1CE78_THET1      -------------------------------
A7MQB1_CROS8      -IDAPQDWWATMQAAE---------------
TRMH_ECOLI        -IEADADWWATMQAAG---------------
D8MKB8_ERWBE      -VIADAEWWDSMQASVRRK------------
H2IYA4_RAHAC      -IIANDEWWSAMQMTVKKR------------
Q6DB63_PECAS      -IVADTPWWAAMQSSGC--------------
E1SIV4_PANVC      -VDADPSWWATMQSTGKKR------------
D3VF78_XENNA      -IIASETWWAEMQSTTAPSKRT---------
M1SRC3_MORMO      -IIAPDSWWAAMQQKKPSA------------
A1T0B4_PSYIN      -IDASDDWWLAVRSSVKSLKTK---------
A0KR25_AERHH      -ILADEQWWQQMQLTRKGWAAQQEEDEWQDQ
Q5QYH3_IDILO      -IVADEAWWLAMRAR----------------
A3QIR9_SHELP      -IVADETWWQRMRAPDPDAEPEA--------
B1KLV5_SHEWM      -IVASDEWWERMRAPEVESA-----------
Q8KE14_CHLTE      -FTE---------------------------
B4S7D5_PROA2      -LLD---------------------------
B4SB16_PELPB      -ICSNEQKNAGQ-------------------
TRMH_THET8        -------------------------------
A5GMP3_SYNPW      -ILEDLPRTAKLRC-----------------
Q9RSB4_DEIRA      -LLREPVSRPE--------------------
Q1IW56_DEIGD      -LVR---------------------------
E8U2Y2_DEIML      -IIRA--------------------------
D7BGA0_MEISD      -ILWGDAKP----------------------
K0C886_ALCDB      AKARQEAAS----------------------
Q0AB97_ALKEH      GVIWTHAPS----------------------
TRMH_AQUAE        -------------------------------
F8AC88_THEID      -------------------------------
A6Q996_SULNB      -------------------------------
F4KTV9_HALH1      -------------------------------
E1WXK8_HALMS      -------------------------------
B7GMP7_ANOFW      -------------------------------
D0LNM3_HALO1      -------------------------------
D9SAB1_FIBSS      -------------------------------
D6YTW0_WADCW      -------------------------------