CLUSTAL format seed alignment for MF_02062

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B0VKE7_ACIBS          -------------------MEFVFNGFYTLISAVIVLLLGRFLVNRIDFLERYNIPEPVA
A8ERC1_ARCB4          -------------------MNFTFNPYYTLIVAVIVLLIGKVLVNKIDFLKRYNIPEPVA
A0A0E2GM61_ACIRA      -------------------MNYQIDAFGTLVLAVLVLLLGRFLIQRINFLRQYNIPEPVV
C7M9I0_CAPOD          ----------------MDMKTIIIDPYYTLIVATIVLLVGRLLVHKIKFLRNFNIPEPVA
Q5F5N0_NEIG1          -------------------MEWAFNSYYTLIAATLVLLVGKVLVKKIKILRDFNIPEPVA
GLTS_HAEIN            -------------------MSYTFSTYETLALASLVLLLGYFLVKRINVLKTFNIPEPVV
Q8ZL37_SALTY          --------------------MFELDTLSTLVAATLVLLLGRKLVQSVSLLKKYTIPEPVA
GLTS_ECOLI            --------------------MFHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVA
A6TFR3_KLEP7          --------------------MFHLDTLSTLVAATLVLLLGRKLVQTVPFLKKYTIPEPVA
D3VF80_XENNA          --------------------MYHLDIYGTLVAATLVLLLGRKLVQTVPFLGKYTIPEPVA
Q7NZ17_CHRVO          --------------------MIQLDFYGTLVAASLVLLLGRKLVAHTGALCTYNIPEPVA
D5WFS6_PARAM          ---------------------MTVGVYATLVATSLVLLLGEKLVQWIGVLRTYSIPAPVA
Q7MGE5_VIBVY          -----------------MNHLITVGALESFLVAISVLFLGHFINAKLPILRKFNIPEPIV
Q5E094_ALIF1          -----------------MTNSLSIGALESFLIAIAVLFLGHFINSKIDLFKKYNIPEPIV
Q8ED47_SHEON          -----------------MHTTYTIGELESFLIAIFVLFIGHSINRHVRVFKQYNIPEPIV
Q480V8_COLP3          ---------------MSLAMEINISILETLVVALIILFSGYYCNSKVSFLRNNNIPEPVV
K9RXN2_SYNP3          ------------------MNLIQLDVRQTIISAILVLYFGKYLTKHVRFLREYNIPDAVS
P73275_SYNY3          ------------------METIQFNIRQTIIVAILVLYIGKYLTKKIKFLQSFNIPDAVS
I3Y8U1_THIV6          --------------MELLDGMLRIESFLAVTIGIIVLFIGKRLNEKVGFLREFSIPEPVT
Q7U7U8_SYNPX          --------------------MTELSPLVSTTTGFLVLFVGKRLNRELKALRNFSIPEPVS
F5Z705_ALTNA          ------------------MNQFYADNFLTFTIAILVFFIGVHTNRRIQFLRKYNIPEPVT
B8ELM5_METSB          ------------------MRVIEASGLLTFTLAIVVFFIGAGLNHLIAPLRRWNIPEAVT
A7HYS1_PARL1          ---------------------MKIDAFHGFTLAIVLLFVGKGLVARWGILRRYSIPESLV
B0C9S8_ACAM1          ----------------MIETVVDIDCLTFLLISIFILGIGILLTRTLPLLRTLNIPAAVS
Q4KJT8_PSEF5          ------------------MPTFELDALTTLALALILLGVGAQLKKRSRWLTQLCVPAPVI
A6V2P9_PSEA7          ------------------MPTMHLDALSTTALALLLLAIGSQLKKRSRWLTRLCVPSPVI
I4BY62_ACEMN          ----------MSWETANGIFTISLDGIWTTALAALLLLLGYGLRKRVNFLETFCIPAPVI
Q186V2_CLOD6          ------------------MITLSFDIVQTLTLSIFFFLIGNLLKNKVNFLNNFCIPAPVI
Q6MJZ3_BDEBA          ---------------------MTLTAFQTVALAALVVYFGRYIKSKIHVLDKYNLPSPVI
D9S1G1_THEOJ          -------------------MTVQLDMLQTTALAVIVLFLGELIRNKAPILKKYCIPSPVI
A0Q0M4_CLONN          ---------------MLNIVNIKLDIFSTMALATFVFYFGTYCKNKIQLFSKYCIPAPVI
G4KZK9_OSCVS          ------------------MTAIKLDMFQAGAVAALVYCLGRFLIHKVPILNKYCIPAPVV
A6TLC4_ALKMQ          ------------------MLTIKFDMTQTLFIAVLLLLSGNFIRSKVTFLLKYCIPGPVI
D6GR83_FILAD          -------------------MVIEMNMVKTLMVSILMLLLGKFLRKKISFLVKYSIPEAVV
F2I474_AERUA          ------------------MITINFDIVQTLGLAVLALFFGKWMTNVFPVLEEYSLPPAIV
G4KZ57_OSCVS          MEKILSYFGTYTPAADGAIASFKFEYLSALGFAAIVIFLGRALVRHSKLLRKYAIPAPVV
                                                             *         :    :* .: 

B0VKE7_ACIBS          GGLVAAVVSLLVHTFWGYSIVFSSE-LQTSFMLVFFASIGLSANFMKLKE-GGTALVIFL
A8ERC1_ARCB4          GGLVAALCTTAIHYFFGYSISTSTE-LQTSFMLIFFASIGLSANFYKLKE-GGKSLVIFL
A0A0E2GM61_ACIRA      GGLIAALIAYLLHNFLNMSVNFDSN-VQNIFMLMFFSSIGLSASLVKLKK-GGGALLVFL
C7M9I0_CAPOD          GGLLAAVFIYLLYTATGISLEFNTS-LQDAFMLFFFSSIGLSADFSRLKA-GGRGLIIFL
Q5F5N0_NEIG1          GGLIAAIILFALHEAYGVSFKFEKP-LQNAFMLIFFTSIGLSADFSRLKA-GGLPLVVFT
GLTS_HAEIN            GGFIVAIGLLIWHKIDGTSFNFDKN-LQTTMMLVFFTSIGLSANFSRLIK-GGKPLVVFL
Q8ZL37_SALTY          GGLLVAVALLVLKKSVGWEVNFDMT-LRDPLMLAFFATIGLNANLASLRK-GGRVVGVFL
GLTS_ECOLI            GGLLVALALLVLKKSMGWEVNFDMS-LRDPLMLAFFATIGLNANIASLRA-GGRVVGIFL
A6TFR3_KLEP7          GGLLVALALLALKKSMDIEIDFDMS-LKDPLMLAFFATIGLNANLASLRA-GGKVLGTFL
D3VF80_XENNA          GGLLIALVLLAVKQATGWEVSFDSS-LTEPLMLTFFATIGLNANLSSLKA-GGKLLILFV
Q7NZ17_CHRVO          GGLVVAAVLLAWRQFSGVEVRFDAS-LQTPLMLAFFAAIGLNANLASLKH-GGKTVGVFL
D5WFS6_PARAM          GGLIVAICVLIARITTQVQVRFDST-LQAPLMLAFFSTIGLNAHLSNLKA-GGPVLIRFL
Q7MGE5_VIBVY          GGLIVACIITILH-FRGIDLEFNLP-LQNTFMLMFFSTVGLAANYTQLLK-GGAKVFLFL
Q5E094_ALIF1          GGLIVAFAITALH-FQGISLEFSLP-LQNTFMLMFFSTVGLAANYTQLLK-GGTKVFLFL
Q8ED47_SHEON          GGLVVAAVIAFLH-FQDITLAFSLP-MQNTLMLMFFSTIGLSANYKLLLS-GGKKVFIFL
Q480V8_COLP3          GGIIFSILAAIAHSIFDIHFNFDMS-FKNPLMTVFFTTVGLGASYSLLLK-GGPKVVLFL
K9RXN2_SYNP3          GGLIASLFFGICYSLLKTQVEFHLP-IRDILLVVFFTTIGLSAKLQTLLK-GGKPLTILL
P73275_SYNY3          GGVLASLFFGLIYGIFRTEVAFNFP-IRDAFLIIFFTCIGLSSKLKVLLQ-GGKPLLILL
I3Y8U1_THIV6          GGLLFSILFALLYLVSGYAVEFELR-ARDILLVYFFTTIGINASARDLLA-GGRPLLILL
Q7U7U8_SYNPX          RGLLVAVLLTLIHVLGGPELNFNLD-SRDFLLVYFFTTVGMNARFSDLRR-GGPALFILL
F5Z705_ALTNA          GGLIAALVSYFIYITFHTEITYQLD-TRDTLLVYFFTGIGLNAKLSDLIK-GGKPLLIML
B8ELM5_METSB          GGLTAALATLVAYRVFGVEIHFSLD-ARDMLLLYFFTGIGLNAKLGDLVA-GGRPLLVLL
A7HYS1_PARL1          GGLACALVVFALYYGAGIVVSFDLE-ARDALLLYFFAAIGLSTDARTLRH-GGRPLLILS
B0C9S8_ACAM1          GGLIGCGLVAYVNLCTPWHLRFDLS-LRDNLLLIFFSTIGLAARFKQLKE-GGKTLAAVI
Q4KJT8_PSEF5          GGFGFALIVWLLRDQQLLAIKLDTA-IQTPLMVAFFTTVGLGGSLGLLRR-GGKILFVYL
A6V2P9_PSEA7          AGFGFAFLVWLLRDRGWLDIGLDTS-LQTPLMVAFFTTVGLGGSLGLLRK-GGKTLLVYL
I4BY62_ACEMN          GGVLMSLLALALHHQGGSALKFNTA-LQSPLMIAFFTTVGIGGSFGLLKR-GGRALIVYL
Q186V2_CLOD6          GGLLFCFLNLFFKYFNIADISISGN-LMPNFITFFFTTIGLEISINLIKK-GGSVLFRYW
Q6MJZ3_BDEBA          GGFLVAVVISVLKAQGLFVLQFNKA-FEEALMITFFTSVGYSASVRLLKE-GGRAVVFFL
D9S1G1_THEOJ          GGLFFAVLFLVLKQYNILTITFDTT-LQTFFMNMFFTTVGFTASLRLLKK-SGIPVLVFL
A0Q0M4_CLONN          GGLIFSIIVLILKMTNIATITLDTT-LQTVFMTAFFTSVGFTASVKMLKK-GGIKVIIFL
G4KZK9_OSCVS          GGIIFSIVNLILHSTGVAEISFDST-LQTVFMTIFFCTVGFTACFSLLRK-GGLQVLVFL
A6TLC4_ALKMQ          GGLIFSVLALVLRQFGIITFSFDTT-LQQFFMNLFFTASGFGASMILLKK-GGRMVVIFL
D6GR83_FILAD          GGLLFAVFTLIMKQTGIAEFTFDKT-LESYFMNVFFTASGFEAGAALLKK-SGKKVLIFV
F2I474_AERUA          GGLAFALVNMFLRLTNLVTFNLDTS-LSTLFMVVYFTTIGFSASIQALSR-AKGVVMKFL
G4KZ57_OSCVS          SGIIFSLVVSFIKMSGAMAFSFDVTVMKDLCQNLFFLCVGFGFSWKMIRRAGGKLCVMIA
                       *.  .             .              :*   *       :   .        

B0VKE7_ACIBS          ICVASFIVVQNAVGMSLATLLGLDPLIGLIAGSITLTGGHGTAGAWGEILESQHGIQ-GA
A8ERC1_ARCB4          FVIAFFIVVQNFVGISLATILGIDPLIGLIAGSITLTGGHGTAGAWGSILETKYGIE-NA
A0A0E2GM61_ACIRA      VCVAFYVLVQNAIGMSLATLLGLDPLIGLIAGSITLTGGHGTAGAWGEILETEYGIQ-GA
C7M9I0_CAPOD          GVVALFIVVQNSVGVGLASALGQNPVMGLITGSITLTGGHGTAGAWGKILETDYGIK-GA
Q5F5N0_NEIG1          AIVGGFILVQNFVGVGLATALGLDPLIGLITGSVSLTGGHGTSGAWGPNFETQYGLV-GA
GLTS_HAEIN            FIAALLIFGQNVIGIASSMALGIHPAYGLLAGSVTLTGGHGTGAAWADTFAHQFNLQ-GA
Q8ZL37_SALTY          VVVVGLLLMQNAIGIGMASLLGLDPLMGLIAGSITLSGGHGTGAAWSKLFVERYGFA-SA
GLTS_ECOLI            IVVVGLLVMQNAIGIGMASLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFT-NA
A6TFR3_KLEP7          IVVVGLLLLQNALGIGMATLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFVERYGFA-NA
D3VF80_XENNA          FVVVGLLLVQNTVGIVLAKMLGLDPLMGLLAGSITLSGGHGTGAAWGKVFSERYGFE-GA
Q7NZ17_CHRVO          GVVVGLLLVQNTLGVAVASALGLDPLMGLLAGSITLSGGHGTGAAWSGTFADKYGLA-SA
D5WFS6_PARAM          TLVSGLLILQNVIGILLAFALGVDPLLGILGGSVTMSGGHGTGAAWSQVFTERHGLE-SA
Q7MGE5_VIBVY          AVASVYIVIQNGVGVSLASMLGLDPLMGLIAGSITLSGGHGTGAAWSQTFADNYGMS-NT
Q5E094_ALIF1          AVASFYIIIQNAVGVGLASAMGLDPLLGLIAGSITLSGGHGTGAAWSQTFADAYQL--NT
Q8ED47_SHEON          GVASVYIIIQNAVGVSLASLLGLDPILGLIAGSITLSGGHGTGVAWSQTFAENYGI--NT
Q480V8_COLP3          GVATVYLLVQNAIGVSIAIGTGMNPLMGLIGGSVTLSGGHGNGATYADLFITEYNMPANI
K9RXN2_SYNP3          ITAVIYLFLQNITGITVARIIGVDLPIGVLAGSVSLSGGHGTAIAWAPIFQRDYGIV-NA
P73275_SYNY3          ATAVSFLVIQNFVGVGMASLLGQALPVGLLSGSISLSGGHGTAIAWSPVFYDNHGIR-NA
I3Y8U1_THIV6          TITIVFMLAQNLTGIGIASLFDLPAAVGITGGTVSLIGGHGTTIAWAPSIAADFGIA-NA
Q7U7U8_SYNPX          GLTIGYMTLQNIIGVTMAGLLGLHPATGLLVGTVSLIGGHGTTIAWAPTFTENFQID-SA
F5Z705_ALTNA          ALTLSYIVIQNVVGITGATLVGAPPAVGVLAGSTSLIGGHGTTIAWAPEVAA-MGIS-NA
B8ELM5_METSB          AVTLVYLVIQNLIAAGAASALRLPEGITVLLGSASLIGGHGTTIAWAPLITERFGLA-NA
A7HYS1_PARL1          GLAIGFMVLQNLAGMEMARAFGLDPRAGLMVGSISLTGGVGTTLAWSDHFVQNLGIA-QA
B0C9S8_ACAM1          GVMIAFLFLQNAVGIGVACLVGCPPIFGLLGGTIAFVGGHGTAITWGTLLEA-QGWT-GA
Q4KJT8_PSEF5          GACWSLALLQNLVGVGAAKALGIDPLLGIMAGAVSLEGGFGAAAAFGPIAE-NLGAV-GA
A6V2P9_PSEA7          AACWALAILQNLIGVGSAGLFGLDPLLGIMAGAVSLEGGFGAAAAFGPVAE-GLGAQ-GA
I4BY62_ACEMN          VFCWGVAIFQNAFGATLARLLGIHPVLGVMAGAVSLEGGHGAAAAFGPVAE-ELGVV-GA
Q186V2_CLOD6          ILCGVLAFCQNILAITISKIIKLEPLLGLMCGNVSMEGGHGYSAAFGLTIE-NLGIE-GA
Q6MJZ3_BDEBA          LLTIGGLLVQIVAGIGLAKMMGEHPLMGVLTGAVSLTGGPGTALAFGPVFE-AAGVE-GA
D9S1G1_THEOJ          TISIVLIFLQNGLGIALAKVFNLNGLLGLATGSIPLVGGIGTSGAFGPLLE-KAGAE-GA
A0Q0M4_CLONN          GLSILLVVFQNTLGVTLSKLFKLNPLLGLCTSSIAMVGGHGTAGSFGPLLE-EMNVR-GA
G4KZK9_OSCVS          VLAIVMVISQDLIGSGMASVFGLDPKLGLCMGSIPLVGGHGTSGAFGPLLENDFGVA-GA
A6TLC4_ALKMQ          GLAAALAIFQNITALGLSKILGVEPMIGLMTGSIPMTGGHGNAAAFAPIAE-QMGYQ-GA
D6GR83_FILAD          GLAAATAFLQNVIAVGLSPLVGLNAQLGFMTGSIPMTGGHGNAAAYAPIVE-KAGVE-GA
F2I474_AERUA          FIAILAIFIQNILALVLGKFLDIPGPLALLLGSPALVGGPGTAAAVSPTIV-NLGYD-NA
G4KZ57_OSCVS          VAACLLITLQDLLGVAIGNLVGLHPLLALQCSSAAMSGGVGTASAFGTIFEKMGAAD--A
                               *   .   .          .  .  .: ** *   : .             

B0VKE7_ACIBS          LALGMASATFGLIMC-VIGGPLAKLLINRYSL-------AQAKTNAEIQQRDTHVEQNSD
A8ERC1_ARCB4          TALGMAGATFGLVMGGIIGGPLAKLLINRYKI-------KNGHLQKD--ESDTGNKKVID
A0A0E2GM61_ACIRA      IVLGMASATFGLIIGGVMGGPVAKFLIRRHQL-------AEEIPYNQ--RDDETPPGLET
C7M9I0_CAPOD          TDLGMASATFGLVLGGLIGGPIARKLVNNIGK-------KPITEKQS------TDTVADN
Q5F5N0_NEIG1          TGLGIASVTFGLVFGGLIGGPVARRLINKMGR-------KPVENTK--------QDQDDN
GLTS_HAEIN            TEIAIACATFGLVFGGIIGGPVARFLLNRQKQ-------GENPENDE----------VDD
Q8ZL37_SALTY          TEVAMACATFGLVLGGLIGGPVARYLVKHSTT-------PDGMPDDQ----------AVP
GLTS_ECOLI            TEVAMACATFGLVLGGLIGGPVARYLVKHSTT-------PNGIPDDQ----------EVP
A6TFR3_KLEP7          TEVAMACATFGLVLGGLIGGPVARYLVKHSSS-------PDGTPDDQ----------VAP
D3VF80_XENNA          TEVAMACATFGLVLGGLIGGPVARFLVKNTKT-------PGLGADDN----------EIP
Q7NZ17_CHRVO          AELAMACATFGLVLGGLIGGPVARFLVKRVKA-------PGAEHNAD----------QPP
D5WFS6_PARAM          TEIAIGCATFGLVMGGVLGGPVARLLMRRISA-------DELLRVQQ----------LAD
Q7MGE5_VIBVY          LEIAMASATFGLIIGGLIGSPVAQRLVDKHNV-------ESEYGRGS-------KTHEKF
Q5E094_ALIF1          LELAMASATFGLIMGGLIGSPIAQRLIQKHKL-------ESEYGAGT-------NTHDRF
Q8ED47_SHEON          LEFAMAAATFGLVMGGIIGGPVAQRLISKHNL-------VSSYGVGR-------KHHATH
Q480V8_COLP3          FELAMAAATMGLVLGGLVGGPVSKRLITRYNL-------KADE------------YHEEL
K9RXN2_SYNP3          SEIGIASATFGLVLGGIIGGPVARFLIKRHRL-------KADCIDQE-------------
P73275_SYNY3          SEIAIACATFGLVFGGIVGGPIAKFLIIRNKL-------EPDCDTKD-------------
I3Y8U1_THIV6          MEIGIASATFGLILASIMGGPIAKFLIARHRL-----TPAPQVVEEV-------------
Q7U7U8_SYNPX          LEIGITAATFGLVLASASGGPIAQFLLRRFKIPCPSTTPEDQTLKHP-------------
F5Z705_ALTNA          LEIGVACATIGLILASLIGGPIAHTLINRFKL-------NADKDDTP-------------
B8ELM5_METSB          MEIGVASATLGLVIASLIGGPVAGVLISRYKL-------VGPMNEAP-------------
A7HYS1_PARL1          QELGLAANMIGLIAACTIGGPIASLLMRRYQL-------RASGDSTL-------------
B0C9S8_ACAM1          LEFSLAAATLGLIVGGVFAGPISQHLIRRFEL----------ESLSP-------------
Q4KJT8_PSEF5          TTAALASATFGMVAGGLLGSPLARWLIERNRLQ-------IQADQVS----------TLQ
A6V2P9_PSEA7          TTVALASATFGMVAGGLLGSPVARWLIERNRLL-------VRAESDS----------ELE
I4BY62_ACEMN          QVVAIASATYGLIAGGLLGGPVARWLIERYNVT-------IRASED-----------DIY
Q186V2_CLOD6          VGVGLSAATIGLIMGGILGCPVAKFLINKYKLK-------PSSNIDL----------SIP
Q6MJZ3_BDEBA          SVIGVTTAMGGIVLGGLIGTPLATYLINKKKLK-------HPVDHDR----------GAQ
D9S1G1_THEOJ          TTVAVAAATFGMIMGSIIGNPLAKNLIEKHGLM-------KNHKTAA----------FEP
A0Q0M4_CLONN          TTVSFASATFGLIMGSVIGGFVAKSLIERYNLK-------TPKISK------------DK
G4KZK9_OSCVS          TTVAIAAATYGLVAGGVMGGPIARRRIMKLQLH-------STAKKE--------------
A6TLC4_ALKMQ          LTVAVAAATFGLVAGSMLGGPVANNLIEKKGLF-------DKTTQQEK---TEEVHTESG
D6GR83_FILAD          VAIAIAAATFGLVAGSLIGGPVGNFLIKKYDLY-------SDTPAE----------VSDD
F2I474_AERUA          TSVGIIAATLGIVLGSLSGGPIASGIAKKYSLS-------AKDENAS----------ANT
G4KZ57_OSCVS          TTIGVAAGTLGNILGSLIGGPVAAFLISRHGLK-------SDPNDKP-------------
                         ..     * :     .  :.     .                               

B0VKE7_ACIBS          DLAPFENPHQVRL---------------ITADNAITTLGMFAACLAFAEFMTGFSKGTWF
A8ERC1_ARCB4          EFVPFEYPKAVRL---------------ITTNSAITTLGLFAACLAFADFMTGFSKGTSF
A0A0E2GM61_ACIRA      DVAPFEYPRKTRL---------------ITASNAVTTLGMFAFCIYAANWMTDISAGQWF
C7M9I0_CAPOD          VVEVFENAIKQRL---------------ITSKSAIETMALFAACLSFSAIMVSPTVTAFF
Q5F5N0_NEIG1          ADDVFEQAKRTRL---------------ITAESAVETLAMFAACLAFAEIMDGFDKEYLF
GLTS_HAEIN            IQEAFEHPTYKRK---------------ITARSLIETIAMISVCLLIGQYLDVQTKGTAL
Q8ZL37_SALTY          TA--FEKPDVGRM---------------ITSLVLIETIALIAICLTVGKIVAQLLAGTVL
GLTS_ECOLI            TA--FEKPDVGRM---------------ITSLVLIETIALIAICLTVGKIVAQLLAGTAF
A6TFR3_KLEP7          TA--FEKPDVGRV---------------ITSLVLIESIALIAICLTLGKVVAQLLAGSVF
D3VF80_XENNA          TA--FEKPYTGRL---------------ITPLVMLETIAMISICLLAGRFIAEQLQGTSF
Q7NZ17_CHRVO          QG--FEQPDAQRL---------------ITPHSFIETLALIAVCLLGGTFIASLLKGTAF
D5WFS6_PARAM          ETLVFEEPKAEQA---------------TTPAAIITTLALISICLAGGEVFADWIADTVF
Q7MGE5_VIBVY          PELVTYNEYEEDK---------------VTAKKVIEKLFFLIICVTGAKYVEQWVSTYEI
Q5E094_ALIF1          PELITYNEREEDK---------------VTAKKVIEILFILLICVTGSKHLSNFVNSFDI
Q8ED47_SHEON          PQLVTYDQLEEDQ---------------VTAKTIIETLFVLLFCVAGAKWFTVLVSEYGL
Q480V8_COLP3          DDTITFNPEDHDL---------------VTPKKMMETLFIILLCMTVGHIVYLNLKAADI
K9RXN2_SYNP3          LTVGIRQDQENVQ---------------INYNTMLNAVFVIGLTVGLGIQINGITDALGL
P73275_SYNY3          LTIGIRRDQDNVQ---------------IDYNTMLHTILVIGVTIGLGYEINDLVAKLGL
I3Y8U1_THIV6          QDIGLSETQKKSG---------------IDHLDFLSAILAIHLCIILGFLLNEAIADLGL
Q7U7U8_SYNPX          VNDVQDHVSGKRN---------------IDMTSFLAALLAINICIISGMVLNGGIAAIGL
F5Z705_ALTNA          VMGIPFDEEERGN---------------IDHLNLMSVFLTLHITIIIGWFLNHAVTDLGL
B8ELM5_METSB          SVGLP-DDTKLDD---------------LNHVNLLRTILVLNIVILIGFLAHEALVEAGV
A7HYS1_PARL1          EIGTLHSDEQHAR---------------LDYYGVLLALLWLNLALMLGSGVNALVALTPV
B0C9S8_ACAM1          PPDVVAESPVTMP---------------TSLEGMFGIVMLIATSLSVGLGIHLFTLDWGI
Q4KJT8_PSEF5          HL--ESAAQGSV--------------APLDAPTLLRLLTCILLIMVLGFWIGS-ALNEHL
A6V2P9_PSEA7          ALGQQEQRQHAV--------------TALDGNLLLRLLTCVLLVMVLGFWLGD-ALQERL
I4BY62_ACEMN          TKHLAKGQEEDE--------------QTFSNFDFIKMLALVLVIMALGSLITT-KIKELY
Q186V2_CLOD6          RYNRNLNRFGSKFFRNKNRIKNNNFSKTITPSVFLEQVLLIFICINTGEIISR-CFYITF
Q6MJZ3_BDEBA          HESMMLKSFAGR--------------------DLLMHLLALTLIMGIGTTISS-WIS-SL
D9S1G1_THEOJ          GLSAELAVSDEV--------------GEVKAENFYPAFAQILLAMGIGTIISSFFTKV--
A0Q0M4_CLONN          SIPVSDFHEDNA--------------AVLCHSRLMNAVSWIFFAMGIGCLISKFIQSM--
G4KZK9_OSCVS          --NIYDQQAEKA--------------VTIDPQRFVNASLFIAVAIGAGTLLVPLFKSW--
A6TLC4_ALKMQ          STAVAAILENKA--------------HLFDAKRLSKGFYLIFIGLGLGSILHIIFKTALP
D6GR83_FILAD          LNALALETTSRP--------------KELNPNTFMLANILIFIALGLGAYIMDLFKILLP
F2I474_AERUA          SNRYHRHPQHQRL------------TAERIGYMLYGTLLVIFVGTFVTEIINTVVGKLVG
G4KZ57_OSCVS          -ESIASGEAPRLD-----------------NSRMISMFAMCLLLAALGMPIYMLLDSIPK
                                                                                  

B0VKE7_ACIBS          ----ELPTFVWALGGGVILRNILESVLKV--------DIFDRAIDVFGNASLSLYLAMAL
A8ERC1_ARCB4          ----ELPTFVWALGGGVILRNVLENILKV--------EIFDRAIDVFGNASLSLFLAMAL
A0A0E2GM61_ACIRA      ----ELPTFVWALATGVLLRNILENVFKV--------NIFDRAIDVFGNASLSVFLAIAL
C7M9I0_CAPOD          PERFTIPQFVWALFFGVLLRNVLTRGFSV--------NMFDRAIDVFGNASLSLFLGIAL
Q5F5N0_NEIG1          ----DLPKFVWCLFGGVVIRNILTAAFKV--------NMFDRAIDVFGNASLSLFLAMAL
GLTS_HAEIN            ----QLPTFVWCLFTGVIVRNILTNIFRF--------QVAESAIDVLGSVGLSIFLAIAL
Q8ZL37_SALTY          ----ELPVFVCVLFVGVILSNGLALVGFY--------RVFERAVSVLGNVSLSLFLAMAL
GLTS_ECOLI            ----ELPTFVCVLFVGVILSNGLSIMGFY--------RVFERAVSVLGNVSLSLFLAMAL
A6TFR3_KLEP7          ----ELPTFVCVLFIGVILSNSLALAGLY--------RVFDRAVSVLGNVSLSLFLAMAL
D3VF80_XENNA          ----ELPTFVCVLFIGVILSNSLSLLGFY--------RVFDRAVSILGNVSLSLFLAMAL
Q7NZ17_CHRVO          ----ELPTFVCVLFVGVLISNGLAALGWY--------RIFEREVSVVGNVSLSLFLALAL
D5WFS6_PARAM          ----ELPTFVCTLFIGVILNNVLALVRV---------RIDQHAVALVGNVALALFLAMAL
Q7MGE5_VIBVY          K-WLMIPDFVYALFIGVIITNFLEVTKIR--------KLDAETVDMLGTVSLSLFLAMAL
Q5E094_ALIF1          A-WLKIPDFVYALFIGVFITNICEVTKVK--------KIDNETVDILGTVSLSLFLAMAL
Q8ED47_SHEON          N-WLKMPDFVYALFLGVVIANITEVTRGY--------KPHTESIDVIGTVALSLFLSMAL
Q480V8_COLP3          ----VLPAFLMPLLFGVVATNLCEVSKRY--------TISRACIDLWGTMALSIFLALAL
K9RXN2_SYNP3          ----KLPLFVACLLAGIILTNTMPYLFKR-----LPWPAGTSSLALIADVSLGLFLAMSL
P73275_SYNY3          ----MLPAFVSCLLAGIVLTNTIPLAFKK-----FPWPAETPSLALISDVSLGLFLAISL
I3Y8U1_THIV6          ----KLPLFVTCLFAGILITNLMPRKLPTLSG--MPWPTRTPAIALIADVSLGAFLAMSL
Q7U7U8_SYNPX          ----KLPLFVPCLLVGILYSNLLPERRSERAV--FHWPKQSTSLDLISELSLGIFLAMSL
F5Z705_ALTNA          ----KLPLFVTCLLTGIVLSNTIPSIFPN-----IRWPAKTKALAVISDFSLSVFLTMSL
B8ELM5_METSB          ----RMPRFVVCLLVAILFTNTIPRLLPR-----LDWPSRSRSLALISDLSLNVFLVMSL
A7HYS1_PARL1          ----TLPAFVGCLLAGILLRMIGDWMRPSGRGRLWNWPSMQPGIALISDMSLGLFLTMAL
B0C9S8_ACAM1          ----VLPRFLPIMLVAILLINLLDW---------GNISINDTALSFWNDVSLQLFLVMSL
Q4KJT8_PSEF5          --GIVLPSYVGAMFVAIILRNLNDR--ARII------DIPDSAVSTLGDVCLGVFLTMAM
A6V2P9_PSEA7          --GLVLPSYVGAMFIAIVLRNLDDR--LGWL------RIPDHAIGTLGDVCLGIFLTMAM
I4BY62_ACEMN          --NFSLPGYVAAMFVAVVFRNINDH--ISII------KLRGKAIDLIADVSLGIFLTMAM
Q186V2_CLOD6          --NILLPSVVTCMFSAVIFRNLNDK--INIL------ELNFKLIDFLKELSLGIFLTLSL
Q6MJZ3_BDEBA          --QITLPIYIGSMVVAALFRNIEDI--KPVF------KISPEWIEEIGSVALTLFIAMAI
D9S1G1_THEOJ          --GFTFPPYIGAMFAAAIIRNLADF--TGMY------KVPEDEIKVVGDISLSIYLAIAL
A0Q0M4_CLONN          --GLTFPSYIGAMMAAAIIRNICDF--KNK-------KLEEKEIETIGGISLSFFLSMAL
G4KZK9_OSCVS          --HITVPGYMGAMLVAVAIRNIFDG--MKK-------DVPMPEIDSLGNLSLQLFLAMAL
A6TLC4_ALKMQ          --TVTLPIHVMGMLGGVIMRITLDI---KKI------QVPEEEIDTIGNVCLGVFVSMAV
D6GR83_FILAD          --NVTLPIHVMGMLGGAIIRNAYDAITGDTN------ATPLEEIDMIGNVSLSIFVSMAI
F2I474_AERUA          --GITFPVYIGPMIVAATARNISDA--KEHS------ILDDAALDVTSDISLNLFLALTM
G4KZ57_OSCVS          ---IEMPKFIGCLFAGAIARNVMEAFHIK---------FYVPEVDAIEHMFLELYLALVL
                           .*  :  :  .                           :       *  :: : :

B0VKE7_ACIBS          LSLKLWQLADLAGPLVVILVAQTLTMALYAAFVTFRVMGKNYDAAVLAASHCGFGMGATP
A8ERC1_ARCB4          LSLKLWQLSNLAGALSVILVTQVVVMILYAYFVTFRAMGKNYDASVLAAGHCGFGLGATP
A0A0E2GM61_ACIRA      LSLQLWLLADLAGALVVILIAQTAGLALFTIFVTYRFMGKNYDAAVLSAGHCGFGMGATP
C7M9I0_CAPOD          LNLKLWQLLDLALPMLIILAVQTFVMCSYAYFVTFRLMGSNYDAAVLSAGHCGFGMGATP
Q5F5N0_NEIG1          LNLKLWELTGLAGSVTVILAVQTAVMVLYATFVTYVFMGRDYDAAVLAAGHCGFGLGATP
GLTS_HAEIN            MSLRLWELAGLAIDVLIVLAIQVAFMAAFAIFITYRAMGKDYDAVVLSAGHCGFGLGATP
Q8ZL37_SALTY          MSLKLWELASLALPMLAILVVQTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATP
GLTS_ECOLI            MGLKLWELASLALPMLAILVVQTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATP
A6TFR3_KLEP7          MSLKLWELASLALPMIIILAVQALAMALYAVFVTYRMMGKNYDAAVLAAGHCGFGLGATP
D3VF80_XENNA          MSLKLWQLASLALPMLVILSVQSVVMALYAVFVTYRVMGKNYDAAVLSAGHCGFGLGATP
Q7NZ17_CHRVO          MSLRLWDLAALALPIFALLLLQTLAMALYAVFVTFRVMGRNYDAAVLAAGHCGFGLGATP
D5WFS6_PARAM          MRLDLWELAALALPIISILAAQTLLMALYAIFITFPAMGRNYDAVVLCAAQCGLGLGATP
Q7MGE5_VIBVY          MSLKLWNIFDLAIPFLVILAVQSVVLALFTYYVTFKVMGSNYDAAVIAGGHCGFGLGATP
Q5E094_ALIF1          MSLKLWNIFDLAIPFLIILTIQTIVLALFSYFITFRVMGSNYDAAVMVGGHCGFGLGATP
Q8ED47_SHEON          MNLKLWEILDLAIPLLIILVVQTAVLAVFAYFVTFKVMGSNYDAAVITGGHCGFGMGATP
Q480V8_COLP3          MSLKVWQLASLAGPMVVIILIQTVMLMMFAYFVTFRIMGKNYNAAIIAGGHCGFGLGATP
K9RXN2_SYNP3          MSLQLWTLAGVAGPVTILLLVQFGLSTVYTIFVVFPVMGKNYNAAVIAAGYSGLTLGATP
P73275_SYNY3          MSLQLWTLADIGGVIALILLVQFMATVLYSIAVVFPLMGRDYNAAVVCSGYSGLTLGATP
I3Y8U1_THIV6          MSMQLWTLADLAGPIFAILAGQFVLAVSVTVFILFPLMGRNYDAAVVAAGFGGVSLGSTP
Q7U7U8_SYNPX          MSLQLWTLVGLALPLLAILLTQFIIALAINLLLVFRLMGRSYDAAVICAGFGGIALGSTP
F5Z705_ALTNA          MSMQLWTVASLAGPLMLILLMQTLAAVLFILFILFPLMGKNYQAAVLSSGFGGFALGATP
B8ELM5_METSB          MSMQLWTLGGLGPALVAVLAAQTIVAVIYMLFVVFPAMGRNYEAAVIAAGFGGISLGATP
A7HYS1_PARL1          MGLRLWELQPVLAFITVAMLVQIILVIAFVLLIVFRAMGRDYQAAVMCAGFGGIALGSTA
B0C9S8_ACAM1          MNLQILSWMQTAGPLLIILGVQTLCAGLFAYFVVFWAAGHDYDASVICAGFTGMVLGAMP
Q4KJT8_PSEF5          MSLKFWELEQLGLPLLVILVVQVLVMVLLCVFLLFRLFGGNYDAAVLCAGFMGHGLGATP
A6V2P9_PSEA7          MSLKFWELENLGLPLLGVLFIQVVALLLLTIFVLFRLLGRNYDAAVLCAGFLGHGLGATP
I4BY62_ACEMN          MSLRIWELYDLAVPLVVILVLQTIALLLGTVFLLFRLLGKDYDAAVMCAGLMGHGLGATP
Q186V2_CLOD6          MNIDLFELSTLLPPILLIVTFQVIFIILFSIFICFRVLGKDFDSAIIISGLIGHGIGATP
Q6MJZ3_BDEBA          MSLRLEELKNAALPILVFLTVQAILVAVTALGPVFWVGGKDYEASVMSAGYVGFMMGTTA
D9S1G1_THEOJ          MGLKLWQLADLALPLVVMLVAQTILMMLMAYFITFNLMGRDYEAAVLTSGFCGFGMGATS
A0Q0M4_CLONN          MGLKLWELFDLAIPMVVMLIAQSILMFLFSYFIVFKVLGKNYESAVFASANCGFGMGATP
G4KZK9_OSCVS          MGLQLWQLAALAVPMIVILLVQTIWMALYANFAVFNILGRDYEAAAMTTAFCGFGMGATP
A6TLC4_ALKMQ          YTMRLWELAELALPLIILLFAQVLLIFLFVRFITFNVMGRNYDAAVICAGHIGFGMGAVP
D6GR83_FILAD          MTMQLWTLIDLAGPLLILLLAQCVFIILFA-FITFKMMGADYDAAIMVSGHIGFSMGAVP
F2I474_AERUA          VGLELWTIIDMALPMLLIILAETVVTLAFARYIVFHTMGKNYDSAVMTAGFIGFGMGSSS
G4KZ57_OSCVS          MTIDITKLAPVAGQMGLILVGQAVLMTLFGIFISFNLFGRDYGAAVMTAGNCGWGCGSGP
                        : .         .   :  :            :   * .: :  .  .  *   *: .

B0VKE7_ACIBS          TAVANMQAITNMYGP-SHKAFLIVPLCGAFFVDLINATVIQLMLKFIA------
A8ERC1_ARCB4          TAVANMQAITNVYGV-SHKAFLIVPLCGAFFVDLINATIIQVILKLL-------
A0A0E2GM61_ACIRA      TAIANIQAVTNTYGP-SHKAFLVVPLCGAFFVDIINAVVIQGILSFF-------
C7M9I0_CAPOD          TAVANMQSVTERFGP-SHKAFLIVPMVGAFFIDFINAFILTTFISLLQ------
Q5F5N0_NEIG1          TAVANMQSVTHTFGA-SHKAFLIVPMVGAFFVDLINAAILTGFVNFFKG-----
GLTS_HAEIN            TAIANMQAVTSRFGP-SHKAFLIVPMVGAFFIDLINAALLKVSFAVVNILA---
Q8ZL37_SALTY          TAIANMQAITDRFGP-SHMAFLVVPMVGAFFIDIVNALVIKLYLMLPMFAG---
GLTS_ECOLI            TAIANMQAITERFGP-SHMAFLVVPMVGAFFIDIVNALVIKLYLMLPIFAG---
A6TFR3_KLEP7          TAIANMQAITDRFGP-SHMAFLVVPMVGAFFIDIVNALVIKLYLLLPMFG----
D3VF80_XENNA          TAIANMQAITDRFGP-SHVAFLLVPMVGAFFIDIVNAAVIKLYLLLPVFPSIAG
Q7NZ17_CHRVO          TAIANMQAVTERFGP-SHLAFLVVPMVGAFFIDIVNAIVIKLYLALPFIG----
D5WFS6_PARAM          TAIANMQAITNRFGH-SHIAFLIVPMTGAFFMDIVNAIVIKLFLTLPFFH----
Q7MGE5_VIBVY          TAVMNMGSIVNRFGP-SPQAFMVVPIVGAFFIDIVNLIVLQGFISFMG------
Q5E094_ALIF1          TAVMNMGSLVSRFGP-SPQAFMVVPIVGAFFIDITNLIILQAYISFIG------
Q8ED47_SHEON          TAVMNMGALVSRTGP-SPQAFMVVPIVGAFFIDIVNLIVLQGYLSFIM------
Q480V8_COLP3          TAVANMESLVARHGP-SPQAFLVVPLVGAFFIDITNALVIQLYLSLPFVSP---
K9RXN2_SYNP3          TAIANMTAVTERFGA-SPQAFIILPLVGAFFIDLVNAFAIQRFLSFMG------
P73275_SYNY3          TAIANMTAVTEKFGA-APQAFIVVPLVGAFFIDIANAFVIQQFLNFLG------
I3Y8U1_THIV6          TAMANMAAVTQRFGP-SHRAFIIVPLVSAFFIDLVNAMVIPFFLRTF-------
Q7U7U8_SYNPX          TAMANMTAVTQQYGA-STRAFLIVPLVSAFFLDLVNAILIPGFIGQL-------
F5Z705_ALTNA          TAIANMTAVTKSHGP-APLAFIILPLVAAFFVDVTNSFVIRFALSF--------
B8ELM5_METSB          TAIANMTAITKVHGA-APTAFIILPLVSAFFIDIANAGAIGFLVR---------
A7HYS1_PARL1          TAIANMTAITREHGA-AREAFIVVPLVCGFVIDIANALVISLMAG---------
B0C9S8_ACAM1          VGMANMTTITQRYGP-SPKALLVIPLLGACCMDIANAVVIQFFLMLSP------
Q4KJT8_PSEF5          NAVANMGAICDHYKVFSYKAFIIVPLCGAVLIDIVAIPLITWFINAFA------
A6V2P9_PSEA7          NAVANMGAVCEHYRVFSRKAFIIVPLCGAVLIDLVAIPAITWFINAFS------
I4BY62_ACEMN          NAVANMGAVCEHYKVMSYKAFLIVPLCGAVLIDLVGIPSIVWFINYFTR-----
Q186V2_CLOD6          NALANMSSLTQKYGD-SPKAFLVVPLVSGFLLDAISIPCILFFINILT------
Q6MJZ3_BDEBA          NAMANMHSLSQRYGH-AYKAFLVVPLVGSCFIDFINAALVTFCINMFGN-----
D9S1G1_THEOJ          NAMANMRALVEQYAP-APRAFFIVPLVGSLFIDFFNGILIVVFMNMIK------
A0Q0M4_CLONN          NAVANMDALTDKFGF-APTPYLVVPIVGCLFIDFVNSAIITVFINFIN------
G4KZK9_OSCVS          NAMANMGVLADKYGP-CPRAYFIVPLVGSLFIDMFNSTILLALLNILH------
A6TLC4_ALKMQ          VSMANMKTVSDKFAY-SKIAFFVVPIIGGLFSNFTNAAIITFFMNATG------
D6GR83_FILAD          VSVANMKAICDRYRF-SKIAFFIVPVVGGLFSNFTNAAIITGFMNFLGIH----
F2I474_AERUA          NAMACMRQITHEYGA-SPLAFLAVSIVGALFIDFINIFAIYGFIHLIA------
G4KZ57_OSCVS          NAVANEKAVMDQYGW-HNVAWVLYPSFAVIIDDIYNPIFLSLFGNFLVH-----
                       .:     :          . .  .       :      :