CLUSTAL format seed alignment for MF_02065

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

R5L1J0_9CLOT          ------------------------------------------------------------
G8QS85_SPHPG          ------------------------------------------------------------
F0RYF2_SPHGB          ------------------------------------------------------------
H8MKU3_CORCM          ------------------------------------------------------------
A8EUE6_ARCB4          ------------------------------------------------------------
Q0PAY7_CAMJE          ------------------------------------------------------------
D1B1Z4_SULD5          ------------------------------------------------------------
E0USJ7_SULAO          ------------------------------------------------------------
H1FSQ2_SULGG          ------------------------------------------------------------
Q30RQ7_SULDN          ------------------------------------------------------------
D3UGW5_HELM1          ------------------------------------------------------------
F8KP83_HELBC          ------------------------------------------------------------
E6UAM5_RUMA7          ------------------------------------------------------------
A6LSG3_CLOB8          ------------------------------------------------------------
MLTG_STRP2            ------------------------------------------------------------
MLTG_BACSU            ------------------------------------------------------------
Q8Y725_LISMO          ------------------------------------------------------------
G4L8R7_TETHN          ------------------------------------------------------------
Q74IE3_LACJO          ------------------------------------------------------------
E6TVA9_BACCJ          ------------------------------------------------------------
C4L555_EXISA          ------------------------------------------------------------
A0A6N4SMW4_CYTH3      ------------------------------------------------------------
F4KL00_PORAD          ------------------------------------------------------------
Q8AAN3_BACTN          ------------------------------------------------------------
G2Z4P8_FLABF          ------------------------------------------------------------
C7M7P7_CAPOD          ------------------------------------------------------------
L7WC83_NONDD          ------------------------------------------------------------
D5BKJ7_ZUNPS          ------------------------------------------------------------
G0LCU6_ZOBGA          ------------------------------------------------------------
F9YQ52_CAPCC          ------------------------------------------------------------
E4RY37_LEAB4          ------------------------------------------------------------
A0A6N4SPZ0_CYTH3      ------------------------------------------------------------
D2QPT3_SPILD          ------------------------------------------------------------
Q2RZI9_SALRD          ------------------------------------------------------------
D1CC01_THET1          ------------------------------------------------------------
B3EQD0_CHLPB          ------------------------------------------------------------
Q8KAE0_CHLTE          ------------------------------------------------------------
D4H8I5_DENA2          ------------------------------------------------------------
B0SRD8_LEPBP          ------------------------------------------------------------
C6XF53_LIBAP          ------------------------------------------------------------
G2KT77_MICAA          ------------------------------------------------------------
Q2W5G2_MAGSA          ------------------------------------------------------------
Q0AQC6_MARMM          ------------------------------------------------------------
Q9A7P1_CAUVC          ------------------------------------------------------------
Q89MV6_BRADU          ------------------------------------------------------------
Q984T1_RHILO          ------------------------------------------------------------
A0L8T6_MAGMM          ------------------------------------------------------------
Q6F9B4_ACIAD          ------------------------------------------------------------
Q83E36_COXBU          ------------------------------------------------------------
Q4FVE0_PSYA2          ------------------------------------------------------------
MLTG_ECOLI            ------------------------------------------------------------
MLTG_HAEIN            ------------------------------------------------------------
K4KG43_SIMAS          ------------------------------------------------------------
Q5P0G4_AROAE          ------------------------------------------------------------
B2JGP6_PARP8          ------------------------------------------------------------
Q47DZ4_DECAR          ------------------------------------------------------------
Q15U02_PSEA6          ------------------------------------------------------------
B1KQM6_SHEWM          ------------------------------------------------------------
Q081H8_SHEFN          ------------------------------------------------------------
G2LIP6_CHLTF          ------------------------------------------------------------
B2KD01_ELUMP          ------------------------------------------------------------
H6LCJ6_ACEWD          ------------------------------------------------------------
F3YWT8_DESAF          ------------------------------------------------------------
E8V3R9_TERSS          ------------------------------------------------------------
E1QKM5_DESB2          ------------------------------------------------------------
Q2RI00_MOOTA          ------------------------------------------------------------
B1XPB4_SYNP2          ------------------------------------------------------------
Q2JJE1_SYNJB          ------------------------------------------------------------
C5CCG3_MICLC          ------------------------------------------------------------
Q83GD3_TROWT          ------------------------------------------------------------
A8LCW6_FRASN          ------------------------------------------------------------
E3DAS9_GARV3          ------------------------------------------------------------
D7BNS1_ARCHD          ------------------------------------------------------------
F5XH31_MICPN          ------------------------------------------------------------
B1MCF7_MYCA9          ------------------------------------------------------------
A1T8F0_MYCVP          ------------------------------------------------------------
A1UFI5_MYCSK          ------------------------------------------------------------
Q741L1_MYCPA          ------------------------------------------------------------
B2HNC3_MYCMM          ------------------------------------------------------------
C3PGN0_CORA7          ------------------------------------------------------------
B1VDL6_CORU7          ------------------------------------------------------------
F8E313_CORRG          ------------------------------------------------------------
A0A059VSS5_STRA9      MTEYGRGYGSEPWHPDDPLYGDRGPYGGQEQQPQWGGQQPTGYPQQQYPQHPQHDQHPPQ
Q1J1B4_DEIGD          ------------------------------------------------------------
Q9RRE0_DEIRA          ------------------------------------------------------------
H8GUR8_DEIGI          ------------------------------------------------------------
C9ZG10_STRSW          ------------------------------------------------------------
H2K1I7_STRHJ          ------------------------------------------------------------
                                                                                  

R5L1J0_9CLOT          ------------------------------------------------------------
G8QS85_SPHPG          ----------------------------------------------------------MA
F0RYF2_SPHGB          ------------------------------------------------------------
H8MKU3_CORCM          ------------------------------------------------------------
A8EUE6_ARCB4          ------------------------------------------------------------
Q0PAY7_CAMJE          ------------------------------------------------------------
D1B1Z4_SULD5          ------------------------------------------------------------
E0USJ7_SULAO          ------------------------------------------------------------
H1FSQ2_SULGG          ------------------------------------------------------------
Q30RQ7_SULDN          ------------------------------------------------------------
D3UGW5_HELM1          ------------------------------------------------------------
F8KP83_HELBC          ------------------------------------------------------------
E6UAM5_RUMA7          ------------------------------MSDKKFDIDDILGDNKNNTDDISVNDKKTK
A6LSG3_CLOB8          ------------------------------------------------------------
MLTG_STRP2            -----------------MSEKSREEEKLSFKEQILRDLEKVKGYDEVLKEDEAVVRTPAN
MLTG_BACSU            ------------------------------------------------------------
Q8Y725_LISMO          ------------------------------------------------------------
G4L8R7_TETHN          ------------------------------------------------------------
Q74IE3_LACJO          ------------------------------------------------------------
E6TVA9_BACCJ          ------------------------------------------------------------
C4L555_EXISA          ------------------------------------------------------------
A0A6N4SMW4_CYTH3      ------------------------------------------------------------
F4KL00_PORAD          ------------------------------------------------------------
Q8AAN3_BACTN          ------------------------------------------------------------
G2Z4P8_FLABF          ------------------------------------------------------------
C7M7P7_CAPOD          ------------------------------------------------------------
L7WC83_NONDD          ------------------------------------------------------------
D5BKJ7_ZUNPS          ------------------------------------------------------------
G0LCU6_ZOBGA          ------------------------------------------------------------
F9YQ52_CAPCC          ------------------------------------------------------------
E4RY37_LEAB4          ------------------------------------------------------------
A0A6N4SPZ0_CYTH3      ------------------------------------------------------------
D2QPT3_SPILD          ------------------------------------------------------------
Q2RZI9_SALRD          ------------------------------------------------------------
D1CC01_THET1          ------------------------------------------------------------
B3EQD0_CHLPB          ------------------------------------------------------------
Q8KAE0_CHLTE          ------------------------------------------------------------
D4H8I5_DENA2          ------------------------------------------------------------
B0SRD8_LEPBP          ------------------------------------------------------------
C6XF53_LIBAP          ------------------------------------------------------------
G2KT77_MICAA          ------------------------------------------------------------
Q2W5G2_MAGSA          ------------------------------------------------------------
Q0AQC6_MARMM          ------------------------------------------------------------
Q9A7P1_CAUVC          ------------------------------------------------------------
Q89MV6_BRADU          ------------------------------------------------------------
Q984T1_RHILO          ------------------------------------------------------------
A0L8T6_MAGMM          ------------------------------------------------------------
Q6F9B4_ACIAD          ------------------------------------------------------------
Q83E36_COXBU          ------------------------------------------------------------
Q4FVE0_PSYA2          ------------------------------------------------------------
MLTG_ECOLI            ------------------------------------------------------------
MLTG_HAEIN            ------------------------------------------------------------
K4KG43_SIMAS          ------------------------------------------------------------
Q5P0G4_AROAE          ------------------------------------------------------------
B2JGP6_PARP8          ------------------------------------------------------------
Q47DZ4_DECAR          ------------------------------------------------------------
Q15U02_PSEA6          ------------------------------------------------------------
B1KQM6_SHEWM          ------------------------------------------------------------
Q081H8_SHEFN          ------------------------------------------------------------
G2LIP6_CHLTF          ------------------------------------------------------------
B2KD01_ELUMP          ------------------------------------------------------------
H6LCJ6_ACEWD          ------------------------------------------------------------
F3YWT8_DESAF          ------------------------------------------------------------
E8V3R9_TERSS          ------------------------------------------------------------
E1QKM5_DESB2          ------------------------------------------------------------
Q2RI00_MOOTA          ------------------------------------------------------------
B1XPB4_SYNP2          ------------------------------------------------------------
Q2JJE1_SYNJB          ------------------------------------------------------------
C5CCG3_MICLC          ------------------------------------------------------------
Q83GD3_TROWT          ------------------------------------------------------------
A8LCW6_FRASN          ------------------------------------------------------------
E3DAS9_GARV3          ------------------------------------------------------------
D7BNS1_ARCHD          ------------------------------------------------------------
F5XH31_MICPN          ------------------------------------------------------------
B1MCF7_MYCA9          ------------------------------------------------------------
A1T8F0_MYCVP          ------------------------------------------------------------
A1UFI5_MYCSK          ------------------------------------------------------------
Q741L1_MYCPA          ------------------------------------------------------------
B2HNC3_MYCMM          ------------------------------------------------------------
C3PGN0_CORA7          ------------------------------------------------------------
B1VDL6_CORU7          ------------------------------------------------------------
F8E313_CORRG          ------------------------------------------------------------
A0A059VSS5_STRA9      QYPHQQQYPAGHGGWDGNQHAGGQPAYDPYDPYGQPQPADPYLQQGQEYPAPHQTGQNYA
Q1J1B4_DEIGD          ------------------------------------------------------------
Q9RRE0_DEIRA          ------------------------------------------------------------
H8GUR8_DEIGI          ------------------------------------------------------------
C9ZG10_STRSW          ------------------------------------------------------------
H2K1I7_STRHJ          ------------------------------------------------------------
                                                                                  

R5L1J0_9CLOT          ------------------------------------------------------------
G8QS85_SPHPG          NKEDDKQSLLDPKLSATQKDRKPKSTGPTSGKIILKASAKAPVEKPAVRKKPQVSSRKVT
F0RYF2_SPHGB          MAEKQKEPTQLSLDLEETKTAAPSKANTSSYKVVLKDEPDTKAPRPVVRKKTSVTTRSMT
H8MKU3_CORCM          ------------------------------------------------------------
A8EUE6_ARCB4          ------------------------------------------------------------
Q0PAY7_CAMJE          ------------------------------------------------------------
D1B1Z4_SULD5          ------------------------------------------------------------
E0USJ7_SULAO          ------------------------------------------------------------
H1FSQ2_SULGG          ------------------------------------------------------------
Q30RQ7_SULDN          ------------------------------------------------------------
D3UGW5_HELM1          ------------------------------------------------------------
F8KP83_HELBC          ------------------------------------------------------------
E6UAM5_RUMA7          KNTDIDEIDELLASLKNNNRRRRTSSVIIEEEKTESSNNEVPASSDAKEETEKVSDGSAE
A6LSG3_CLOB8          ------------------------------------------------------------
MLTG_STRP2            EPSAEELMADSLSTVEEIMRKAPTVPTHPSQGVPASPADEIQRETPGVPSHPSQDVPSSP
MLTG_BACSU            ------------------------------------------------------------
Q8Y725_LISMO          ------------------------------------------------------------
G4L8R7_TETHN          ------------------------------------------------------------
Q74IE3_LACJO          ------------------------------------------------------------
E6TVA9_BACCJ          ------------------------------------------------------------
C4L555_EXISA          ------------------------------------------------------------
A0A6N4SMW4_CYTH3      ------------------------------------------------------------
F4KL00_PORAD          ------------------------------------------------------------
Q8AAN3_BACTN          ------------------------------------------------------------
G2Z4P8_FLABF          ------------------------------------------------------------
C7M7P7_CAPOD          ------------------------------------------------------------
L7WC83_NONDD          ------------------------------------------------------------
D5BKJ7_ZUNPS          ------------------------------------------------------------
G0LCU6_ZOBGA          ------------------------------------------------------------
F9YQ52_CAPCC          ------------------------------------------------------------
E4RY37_LEAB4          ------------------------------------------------------------
A0A6N4SPZ0_CYTH3      ------------------------------------------------------------
D2QPT3_SPILD          ------------------------------------------------------------
Q2RZI9_SALRD          ------------------------------------------------------------
D1CC01_THET1          ------------------------------------------------------------
B3EQD0_CHLPB          ------------------------------------------------------------
Q8KAE0_CHLTE          ------------------------------------------------------------
D4H8I5_DENA2          ------------------------------------------------------------
B0SRD8_LEPBP          ------------------------------------------------------------
C6XF53_LIBAP          ------------------------------------------------------------
G2KT77_MICAA          ------------------------------------------------------------
Q2W5G2_MAGSA          ------------------------------------------------------------
Q0AQC6_MARMM          ------------------------------------------------------------
Q9A7P1_CAUVC          ------------------------------------------------------------
Q89MV6_BRADU          ------------------------------------------------------------
Q984T1_RHILO          ------------------------------------------------------------
A0L8T6_MAGMM          ------------------------------------------------------------
Q6F9B4_ACIAD          ------------------------------------------------------------
Q83E36_COXBU          ------------------------------------------------------------
Q4FVE0_PSYA2          ------------------------------------------------------------
MLTG_ECOLI            ------------------------------------------------------------
MLTG_HAEIN            ------------------------------------------------------------
K4KG43_SIMAS          ------------------------------------------------------------
Q5P0G4_AROAE          ------------------------------------------------------------
B2JGP6_PARP8          ------------------------------------------------------------
Q47DZ4_DECAR          ------------------------------------------------------------
Q15U02_PSEA6          ------------------------------------------------------------
B1KQM6_SHEWM          ------------------------------------------------------------
Q081H8_SHEFN          ------------------------------------------------------------
G2LIP6_CHLTF          ------------------------------------------------------------
B2KD01_ELUMP          ------------------------------------------------------------
H6LCJ6_ACEWD          ------------------------------------------------------------
F3YWT8_DESAF          ------------------------------------------------------------
E8V3R9_TERSS          ------------------------------------------------------------
E1QKM5_DESB2          ------------------------------------------------------------
Q2RI00_MOOTA          ------------------------------------------------------------
B1XPB4_SYNP2          ------------------------------------------------------------
Q2JJE1_SYNJB          ------------------------------------------------------------
C5CCG3_MICLC          ------------------------------------------------------------
Q83GD3_TROWT          ------------------------------------------------------------
A8LCW6_FRASN          ---------------------MIRDGDGFDELLDGAGYDDYDDRDYNDRAYEEQRRAAAG
E3DAS9_GARV3          ------------------------------------------------------------
D7BNS1_ARCHD          ------------------------------------------------------------
F5XH31_MICPN          ------------------------------------------------------------
B1MCF7_MYCA9          ------------------------------------------------------------
A1T8F0_MYCVP          ------------------------------------------------------------
A1UFI5_MYCSK          ------------------------------------------------------------
Q741L1_MYCPA          ------------------------------------------------------------
B2HNC3_MYCMM          ------------------------------------------------------------
C3PGN0_CORA7          ------------------------------------------------------------
B1VDL6_CORU7          ------------------------------------------------------------
F8E313_CORRG          ------------------------------------------------------------
A0A059VSS5_STRA9      GQGHDYYGAPDGYGLHETQQMPAQPPAPQHHGMAEQALADPHQQQYGQPSHPQRPGDYPP
Q1J1B4_DEIGD          ------------------------------------------------------------
Q9RRE0_DEIRA          ------------------------------------------------------------
H8GUR8_DEIGI          ------------------------------------------------------------
C9ZG10_STRSW          ------------------------------------------------------------
H2K1I7_STRHJ          ------------------------------------------------------------
                                                                                  

R5L1J0_9CLOT          ----------------------MADDFKLDETGINLSETDTRDEEKDVYFTNQDYSGIKT
G8QS85_SPHPG          IKVPAGVAKPIDSEKPVTKTAKASTVKVSKKPTVKKQTIVRTVKRIANPVVQGLPEKPKK
F0RYF2_SPHGB          VKISSSKKAEEPAQKPKATPAKQGGTAVVRRPKAAVQTIRTAEQPNPHLVQTHVIRPKSN
H8MKU3_CORCM          ------------------------------------------------------------
A8EUE6_ARCB4          ------------------------------------------------------------
Q0PAY7_CAMJE          -----------------------------------------------------------M
D1B1Z4_SULD5          ------------------------------------------------------------
E0USJ7_SULAO          ------------------------------------------------------------
H1FSQ2_SULGG          ------------------------------------------------------------
Q30RQ7_SULDN          ----------------------------------------------MYNFSTLMFSNDIF
D3UGW5_HELM1          ------------------------------------------------------------
F8KP83_HELBC          ------------------------------------------------------------
E6UAM5_RUMA7          DNNDVTDDPVISSVNEDLKKHFGKDPDDGFDEEDDEDDEDEIPVRKSSNNRSHPSKERRA
A6LSG3_CLOB8          ------------------------------------------------------------
MLTG_STRP2            AEESGSRPGPGPVRPKKLEREYNETPTRVAVSYTTAEKKAEQAGPETPTPATETVDIIRD
MLTG_BACSU            ------------------------------------------------------------
Q8Y725_LISMO          ------------------------------------------------------------
G4L8R7_TETHN          ---------------------------------------MSDKNQSEDNQTSDKKQKTNN
Q74IE3_LACJO          -----------------------------------------------------------M
E6TVA9_BACCJ          -------------------------------------------------------MSEKK
C4L555_EXISA          ------------------------------------------------------------
A0A6N4SMW4_CYTH3      ------------------------------------------------------------
F4KL00_PORAD          --------------------------------------------------MSRSRRSKSK
Q8AAN3_BACTN          ------------------------------------------------------------
G2Z4P8_FLABF          ------------------------------------------------------------
C7M7P7_CAPOD          ------------------------------------------------------------
L7WC83_NONDD          ------------------------------------------------------------
D5BKJ7_ZUNPS          ------------------------------------------------------------
G0LCU6_ZOBGA          ------------------------------------------------------------
F9YQ52_CAPCC          ------------------------------------------------------------
E4RY37_LEAB4          ------------------------------------------------------------
A0A6N4SPZ0_CYTH3      ------------------------------------------------------------
D2QPT3_SPILD          ------------------------------------------------------------
Q2RZI9_SALRD          ----------------------------------------MGGLVGPETRPRRGEYLWPA
D1CC01_THET1          ------------------------------------------------------------
B3EQD0_CHLPB          ------------------------------------------------------------
Q8KAE0_CHLTE          ------------------------------------------------------------
D4H8I5_DENA2          ------------------------------------------------------------
B0SRD8_LEPBP          ------------------------------------------------------------
C6XF53_LIBAP          ------------------------------------------------------------
G2KT77_MICAA          ------------------------------------------------------------
Q2W5G2_MAGSA          ------------------------------------------------------------
Q0AQC6_MARMM          ------------------------------------------------------------
Q9A7P1_CAUVC          -------------------------------------------------------MSKTS
Q89MV6_BRADU          ---------------------------------------------MSERPPISPRSPRAA
Q984T1_RHILO          ------------------------------------------------------------
A0L8T6_MAGMM          ------------------------------------------------------------
Q6F9B4_ACIAD          ---------------------------------------------------------MID
Q83E36_COXBU          ------------------------------------------------------------
Q4FVE0_PSYA2          --------------MSTPTPETPPERPNDTLSNDQKGTADERVDGTPLNSKPVDETGAKE
MLTG_ECOLI            ------------------------------------------------------------
MLTG_HAEIN            ------------------------------------------------------------
K4KG43_SIMAS          ------------------------------------------------------------
Q5P0G4_AROAE          ------------------------------------------------------------
B2JGP6_PARP8          ------------------------------------------------------------
Q47DZ4_DECAR          ------------------------------------------------------------
Q15U02_PSEA6          ------------------------------------------------------------
B1KQM6_SHEWM          ------------------------------------------------------------
Q081H8_SHEFN          ------------------------------------------------------------
G2LIP6_CHLTF          ------------------------------------------------------------
B2KD01_ELUMP          ------------------------------------------------------------
H6LCJ6_ACEWD          ------------------------------------------------------------
F3YWT8_DESAF          ------------------------------------------------------------
E8V3R9_TERSS          ------------------------------------------------------------
E1QKM5_DESB2          ------------------------------------------------------------
Q2RI00_MOOTA          ------------------------------------------------------------
B1XPB4_SYNP2          ------------------------------------------------------------
Q2JJE1_SYNJB          --------------------MVGLLTAGLLKARSVPPSGWCRVVYVQHSAQKDPVLPKCS
C5CCG3_MICLC          MTGDHQHARREDHWDDLLGDEADVHDDLDVFGFAHDEADEADVGAPSQPVDAAGPRRPRM
Q83GD3_TROWT          ------------------------MIRRSSFIRYLRDPSDGSEDGINGFFDADTDSVNVT
A8LCW6_FRASN          ARRSRRGRAGSVDGRDRAGLAAGEREPAGYEDGFAPDEADAYGAYGGAYDDDDGDPDDGA
E3DAS9_GARV3          -------------------------------------MTENIDDFFDRNAKWSHETPNPP
D7BNS1_ARCHD          --------------------------------------------------------MSEV
F5XH31_MICPN          ------------------------------------------------------------
B1MCF7_MYCA9          ----------------------------MSDWRDWDDRQEHDDDWGGGRRAVPVAVGPRP
A1T8F0_MYCVP          ----------------------------------------MTDDWQTDRAEPLAVGPPRR
A1UFI5_MYCSK          ----------------------------------------MAEDWRHDRAEPVAVGPPRR
Q741L1_MYCPA          ----------------------------------------MVDSARRERAEPEAVGPPRR
B2HNC3_MYCMM          --------------------------------------MAEDVYRSRAEPVAVGPNRHRM
C3PGN0_CORA7          ------------------------------------------------------------
B1VDL6_CORU7          ------------------------------------------------------------
F8E313_CORRG          ------------------------------------------------------------
A0A059VSS5_STRA9      GPVPHQHPPAGAPFEEPAAEGDDWRAAPDADGPEPRKRESDHPFFADEPDAEDDGYDDED
Q1J1B4_DEIGD          ------------------------------------------------------------
Q9RRE0_DEIRA          ------------------------------------------------------------
H8GUR8_DEIGI          ------------------------------------------------------------
C9ZG10_STRSW          ------------------------------------------------------------
H2K1I7_STRHJ          ------------------------------------------------------------
                                                                                  

R5L1J0_9CLOT          GKKPSKAASGKKSKKGKG-KKGGVAST-YWFFIIVIVVSM---IISVY------AIFCIN
G8QS85_SPHPG          EAIRKTIQPPPLGKRKGY-RPSLLTIL-KPIAFILSAIICIICVVLYFETRKPETLLLAE
F0RYF2_SPHGB          TVARPKVQPPPIGKRKGY-RTSKAAMF-LIPLLAATLLFC---FAILW---WVLSDQQEQ
H8MKU3_CORCM          -------------------MKKIL----VALVVLIVLAVAGAGGVFMH------------
A8EUE6_ARCB4          ------MPIYRDENIKNI-KRNDTNIA-ILMFFNIIDFILIGLIVVLF------------
Q0PAY7_CAMJE          TIPFLSTINKANISTTKN-TTIYKIFF-FIRNFFLIFILG-----IFY------------
D1B1Z4_SULD5          ------------------------------------------------------------
E0USJ7_SULAO          -------------------MKVKKLTI-LTYVLAIIFVIVLSLMYYLN------------
H1FSQ2_SULGG          ----------------------------MKWSFEIVLIII---LSFMY------------
Q30RQ7_SULDN          CKKIPFCKNIKRVKRSKK-MNDKILTI-VKWIFDIVLIIV---VSFMY------------
D3UGW5_HELM1          -------------------MTKKNATR-LNIFFDILLLMI---FTAIF------------
F8KP83_HELBC          ----------------------------MVALSMV--------LSLVF------------
E6UAM5_RUMA7          DTNKKKGNSRSGNKKKKKSRVRFNGSI-FGGIILVTIILTLSLLLAVS--------GLTL
A6LSG3_CLOB8          ---------------MNK-YKSFRKLI-LLIILFLFVITLTFVISYSS------------
MLTG_STRP2            TSRRSRREGAKPAKPKKE-KKSHVKAF-VISFLVFLALLS-AGGYFGY------------
MLTG_BACSU            ---------MYINQQKKS-FFNKKRII-LSSIVVLFLIIG---GAFLY-----------G
Q8Y725_LISMO          -----------MKNTKGK-KITIIISI-IILILVIATFSG---YYYVK-----------S
G4L8R7_TETHN          KTNNKPKDVKKRKNRRNK-EDRVVHKI-VLVIILALVVVGLIFGFSTY------------
Q74IE3_LACJO          LNQDKKKNHELEEQASKK-VTRWILSG-LGAILVLVVLIG---GCYVG------------
E6TVA9_BACCJ          EKRRKKHREKLLERQKEA-SLVRKIVF-VCLFLIILTVAGVGYGSYQY------------
C4L555_EXISA          -MNHPSMSDEKRARNRIV-RRITVVIL-AIFLLVIATGSA---LTYVF---------VKR
A0A6N4SMW4_CYTH3      ---MAKKRVIPKPKTPRKPIAKKSTRF-SISAQSWLFLAGFVVLFASW------------
F4KL00_PORAD          QWRPSYFNDTSHRSHHHG-SSRRIRTW-IRLTLLIVILLLLSWAAYLL------------
Q8AAN3_BACTN          -------------------MKKKTRNI-LLSVLTGALLLCAIAGGTVY------------
G2Z4P8_FLABF          -------------------MNKKKLTI-WGLCIAIPLLLL---SIYLY-----------S
C7M7P7_CAPOD          -------------------MKKWI----IGAVIAVIAVLG----FFIY-----------R
L7WC83_NONDD          -------------------MKSNYKKV-ILGIVLLGLVIMGVFAYNVW------------
D5BKJ7_ZUNPS          ---------------------MYIKKI-VVAIAVLGLVAVGGFSYYIY-----------Q
G0LCU6_ZOBGA          ---------------------MYIRRI-LLIIVLAGLVGGGVFAYKVY------------
F9YQ52_CAPCC          ---------------------MYIRRI-LTITALIGLVFMGVFAYYVY------------
E4RY37_LEAB4          -------------------MTKKRKL--FTHFLVLFSTVAASFAFYLW------------
A0A6N4SPZ0_CYTH3      ----------------------------MVCTGIAFVMLS----YYVY------------
D2QPT3_SPILD          -------------------MSRNLQIG-LFLTVSILLTTF---TFYFW------------
Q2RZI9_SALRD          VSVPDGGSSSDLSFPHCF-RSVYARSR-LGIVVAILFVGGLVAGVGGA------------
D1CC01_THET1          ------MNQDINRQSPDD-QPARWPLF-WALVILALAVPA------LW------------
B3EQD0_CHLPB          -------------------MRDTISSR-IVILITSIAIPS---LAFLA------------
Q8KAE0_CHLTE          ------------MPPRKA-PFRATAPR-VILLAIAAVVVT---LLFVP------------
D4H8I5_DENA2          -------------------MYKIFGLA-VILAAFLLTSIA---GYWII------------
B0SRD8_LEPBP          -------------------MNSKVKKY-LVLSGLGAALLFVLALISFF------------
C6XF53_LIBAP          -------------------MLKFL----IPLITIFLLAIG-VHIHVIR------------
G2KT77_MICAA          --------MAEPSKFQNG-FVQFFLGA-LVLGTTLCVVGGTGAFVYGW------------
Q2W5G2_MAGSA          -------------------MKPWMKIV-AAVLAVIVLAAG----WLAW---------DGH
Q0AQC6_MARMM          ---MSDAPAPKAKAKSGL-VRIFIGLI-VILFVLALVAAGTVYGGYKW----------MQ
Q9A7P1_CAUVC          PPRARAPKGAGSRRETATAGRRMMRAL-LGAAATLVVVGMVALLGAAW------------
Q89MV6_BRADU          LEPEQVPPPPKRSDRARN-PFVIVGNA-IITLLLISMIGAGAVYYYGR------------
Q984T1_RHILO          ------------------------MFMNFVISLVMLMVLAAGAALYFG-----------K
A0L8T6_MAGMM          -------------------MKRL-----FFFLLLVLIVAATGAVGFAW-----------M
Q6F9B4_ACIAD          MPKQPTKPKMKKKPQPQT-ESWFKTNK-WLMAALVLLCVV---GIVLW------------
Q83E36_COXBU          -------------------MSFFKKII-LFIGAIVVMILG-MWFAIVW-----------H
Q4FVE0_PSYA2          VPPTDISLISGDNKPRHY-KIDNPSFF-MQRGYQVLLVLGLIAAFFLV-----------M
MLTG_ECOLI            -------------------MKKV-----LLIILLLLVVLGIAAGVGVW---------KVR
MLTG_HAEIN            -------------------MKKF-----LIAILLLILILAGVASFSYY---------KMT
K4KG43_SIMAS          ------------------MIKRWLASL-VVVGFVLVMAGH---FYLQW------------
Q5P0G4_AROAE          -------------------MKSLL----LRLFLVVALGAAASLAAAWW------------
B2JGP6_PARP8          -------------------MSLLKKCL-IACVLLAMLIGAAAYGAYRW------------
Q47DZ4_DECAR          -------------------MRTLTKIL-FAVFVLFAIAAG---GLWWW------------
Q15U02_PSEA6          ----------------------------MTGLHYL------------------------K
B1KQM6_SHEWM          -------------------MKKFIIAF-TAAIFTLLTLAG---GVSLW---------TYN
Q081H8_SHEFN          -------------------MIKTIKTF-FLASLIPLFTVVCLGGYWLV--------SGLI
G2LIP6_CHLTF          ------------------------------------------MGFLSY------------
B2KD01_ELUMP          -------------------MKKYKKLILLISCALLFVIFAAFTHNYYF------------
H6LCJ6_ACEWD          -----------------------------------MLEPV--------------------
F3YWT8_DESAF          --------------MIKR-MLKLLVGL-VAVGLVIGLVAGGWLGWQAW------------
E8V3R9_TERSS          -------------------MK-------FLGFLLLLVVIGAGVAGFLV------------
E1QKM5_DESB2          ------------------MNRGLIAAI-VVIAVCLAAVAGYFGGRTLL------------
Q2RI00_MOOTA          ---MGEELETSHNYIIAF-DRPWRHRV-TLLLALTALLVG---LGWYF------------
B1XPB4_SYNP2          ----------------------------------MAIAFWQSWAWWRW------------
Q2JJE1_SYNJB          AAQGAIPRSPHVATQRLR-ERWGRRLL-QSLIFLLVLVGGL--GYWQW------------
C5CCG3_MICLC          LLRRRGTGSHPASRVDRGAGRRRTALVLGTVLVAFAVVVGLIVRGFLS------------
Q83GD3_TROWT          RKTRRSLLRKTRKSFWYRFCNWLRRRM-LLKILSLSLAALFLFIAAVF------------
A8LCW6_FRASN          APPRRGRDDDRGRPGGRR-PGSALPKL-IGVLVVVAVLVGAGIFGVGK---------VIG
E3DAS9_GARV3          VPPKSRKDLKAQKRRKSK-RKRIIAFI-LTLIFAILFVLGYGLYRVAV---YIKTNNQST
D7BNS1_ARCHD          FTQTELRRKKNNKERRAYHRKKRIRSA-MVLFFTCVLVVAATVVAVPY----VKQVLNAQ
F5XH31_MICPN          -MTSMLDPDLKPSPAREF-VHKGKGCL-AVLIAVAVLAFG---GYFVY-DRASGFLASWG
B1MCF7_MYCA9          RETRRERARRRAAARRRR-NAGILGLA-AVVIITVAAVVG---GATLW----DSLFGADR
A1T8F0_MYCVP          RLTRRERAREERYRRRRK-TALVVTLS-MLVVVVLVAVFL---GSKMW------HSLFGG
A1UFI5_MYCSK          GMSRSDRMRLERGRRKRR-MAGALSLA-LLIVVVVGAVFL---GSKLW------HNMFGG
Q741L1_MYCPA          RSSRMARNRAERGRRRRR-FALRAALA-LLVVVVLAGVFA---GGKLW-------HTVFG
B2HNC3_MYCMM          SRVDRLKRNREQHNRRRR-RRVLGGFV-FGLLVVFVVVVV-VFGTKLW-------NVMLG
C3PGN0_CORA7          -------------MEPQY-VKRRQRGM-AVLIASLVLIIG-GLGYIGF------RLLGGG
B1VDL6_CORU7          ------MTLKRSMQPKYR-RRRQLAVA-LALALTLLLVGI---SGYVW------YQRSVV
F8E313_CORRG          ------------MQPKYRRRRQWAGALSIALVLLLVGTLG-----YIW------YQREVV
A0A059VSS5_STRA9      GGRSGRERRGRKGKNKKN-KRRSGSAC-LVVTLALAGVVG-GVGYFGY--------DFIM
Q1J1B4_DEIGD          -------------------MRVL-----LALLSLLLLAAL---GAFLY------------
Q9RRE0_DEIRA          ---------MTTLNSRRG-LPLWAKLL-LGLIVLGLLAVL---GAFAY------------
H8GUR8_DEIGI          ----------MSRLGRRG-TPAWVKVL-IGLFVLLVVAAA---AAFFY------------
C9ZG10_STRSW          ------------------------------------------------------------
H2K1I7_STRHJ          --------------------------------MTGAVMAGTAVAVPLL------------
                                                                                  

R5L1J0_9CLOT          DIFGMTKS----KSSVTV-NYAQDIESPSDAIDLLADYDLITCKNFCKFYIKLASVVVGD
G8QS85_SPHPG          DHVPSSMQ---SVQREALAIQIIPGMTARQVCSLLEQQGVTL-DGQKLLDFL---VSQNL
F0RYF2_SPHGB          RVEPSSLI----EDRPAIAFTIERGMTARSVSLLLEQLGVVE-DAQALLSYF---VENNL
H8MKU3_CORCM          -FQNATTAPHTAADPAPREFVVKKGASARSLGQQLQAQGFLD-DPNVWRFHL---WRRGS
A8EUE6_ARCB4          -YLTMPVN----STKV---LFIPKGSTSNIISHLNKSGYEMN---ALDEIII---KMTG-
Q0PAY7_CAMJE          -YLTQPLK----SNSV---VFIPQGSISQIITYLKQNKYQMS-NIDKYILFF--------
D1B1Z4_SULD5          ------------MSTASV-AFVPQGSIAQIITYMVEKKFDL--HPYADKYLL---RLIG-
E0USJ7_SULAO          KPIYTPKV-----------LYIPAGSINKIITQLQSKNYDVC-KIDSFIL-----RLLG-
H1FSQ2_SULGG          -YLNQPVR-------TQKVVFIPSGSINQIITQLRERNYNVS-KLDSLLL-----RLIG-
Q30RQ7_SULDN          -YLNEPVN----SPRV---IYIPEGSIGRIITQMDSKNYNV--SKL-DALLL---RIFG-
D3UGW5_HELM1          -YLDIPML----SKRD---ILIPRGSISAIITYLANNHYDVN-KIDKFFLLA--------
F8KP83_HELBC          -YLSIPIK----SYQA---IYVPSGP-----LQKLTHEGLG--LNRLDVFIL---RAMSA
E6UAM5_RUMA7          GMEFYGIG----KSDDVITFNIPKGSDNDDIADLLVENGIIK-NKKLFIYTV---KLMKA
A6LSG3_CLOB8          -TIRKPLK----STEDSIIIEVKQGEGFYDILDKLDKENKLT-NKLLIKVNL---AIDKR
MLTG_STRP2            QYVLDSLLPIDANSKKYVTVGIPEGSNVQEIGTTLEKAGLVK-HGLIFSFYA---KYKNY
MLTG_BACSU            KSLLEPVEK---DSKTTVNINIPSGSSVSAIASILKKNDVIK-SEKAFQYYV---KYKGA
Q8Y725_LISMO          QLEPKDEA----SKEKIT-VEIPAGSSISDISTILEDKKVIN-NASIFSFYV---KYNND
G4L8R7_TETHN          NYVKSSIKPLEPNSEESVAVTIPNGSSNKQIGEILENENVIN-SGMVFNYYT---KFNNQ
Q74IE3_LACJO          -YALQPVNR---HDEDVVSVHIPAGATNSQIAQILQEKKIIR-NAAVFNFWL---KSHSA
E6TVA9_BACCJ          -IMNAIGPVDESDDTDIE-VSIPIGSTTTRIGEILEENGLIS-NASIFRYYV---RFKNE
C4L555_EXISA          SIEPIDPS----STETVE-IEVPLGAGSGYIGELLEENGLVR-SSTIFRFYT---RFKNE
A0A6N4SMW4_CYTH3      -YITFASNTA--FRSSAYYIYISRGTEIEELTDTLVKRNVIK-TGITFKWMA---SVMHL
F4KL00_PORAD          -LRPAGRT----SQQECY-AYITDTTSSEALIATITKELEVK-NPTLLRSVA---RLVRI
Q8AAN3_BACTN          YYLFAPQF----HPSKTVYVYVDRDDTADSIYNKIRQTGHVN-KFTGFQWMA---KYRKF
G2Z4P8_FLABF          QLFASNTN----FSEKEIYIKIPTNATYQQAKQIIAP--YLK-NVAQFEAIA---QKRSY
C7M7P7_CAPOD          AVLVSNTA----FQTKEEIVYIPTGADFSDVLHVMSP--LLK-DRTSFIQVA---KRIGY
L7WC83_NONDD          AVLFAPNTN---FETDTYEVFIPSDADYNEAFLIIAD--AVE-NRDDLHTTA---VKKKY
D5BKJ7_ZUNPS          TIFGINTA----FSSNQKVVLIPTNSDYPAVLDSLKP--LIK-DLNSFNIVA---EKKQY
G0LCU6_ZOBGA          NAVFSPNTS---FNNEKAYVFVPSDASFGDVKELVEP--LLK-NPESFEQIA---IRKGY
F9YQ52_CAPCC          SVVFAPNTA---FQNKEAIVLVRTNATFKDVIEQLEP--LLE-NTDSFIKIA---QKKGY
E4RY37_LEAB4          --QVYSSPNLNVDGKETFVLYIPEGSDYNQVLDSLRSHNIIH-NEIAFGFLT---KRKGY
A0A6N4SPZ0_CYTH3      QIFFTPNFGNNNDAKDFV-LYVRKGATFQDVLDTLDKHNVYE-DKTSFAFIA---KMLGY
D2QPT3_SPILD          -QVFRSPNLLVQDNDKTFALLIPKGATFESVMDTLKTHKVIN-DETSFRFLA---KMMKY
Q2RZI9_SALRD          -LVFGPNTG---GYDAPRSVYIARGATLDTAIDSLAQADVLV-VPAAFRLVA---RATGW
D1CC01_THET1          -WYLDPTPRADASSKPVT-VVVRHGEGWNDLTDRLHRLGIIR-RPLIFKALV---VLSGE
B3EQD0_CHLPB          AFFFLPGWNVTCEGFAQKKIIVHRGASFRSILTSLQDNSVLG-HQRPLMITA---AIFPE
Q8KAE0_CHLTE          -GINSMSP----KEEPAR-IAVHRGEGFRRIVEKLHDAGVIR-FRWPLLAAG---ALVPP
D4H8I5_DENA2          -QCEKFLD----NTIVTVELNIEQNETFNGLYKRLFAH--LD-TPPFFRLYL--IKKVKL
B0SRD8_LEPBP          -VVDEIKGGAVGDGQNKYELIIDSGEPSSSVVRELAASGMIK-SSVYFNYLI---KFTRA
C6XF53_LIBAP          -VYNATGP----LQNDTI-FLVRNNMSLKEISKNLFNGGVIV-NPYIFRYVT---QFYFG
G2KT77_MICAA          SGWTKAGP----LQTETS-IIIPRGSGVSTIAATLEDQGVIE-DALLFKAMA---RITGH
Q2W5G2_MAGSA          RRFTAPGP----LSRPVT-VIIPKGSGTELIAQSLEGAGVIS-SRTVFALGV---KLRRA
Q0AQC6_MARMM          AEFAAPGP----AEEETI-ILLPRGAGLIAIASQLENAGLIS-DRRIFRVAV---TLDGG
Q9A7P1_CAUVC          -VYNGPGPAA--KGDDKTTVVLRKGASLPEIASSLERGGVIR-SSSIFMTAA---KVTGA
Q89MV6_BRADU          QVLEAPGP----LKEDKI-VNIPQRAGKRDIAETLNREGVTDVNPWVFIASV---AALKA
Q984T1_RHILO          QEFIEPGP----SANGDT-FLVKPNTGVQDIADQLERRGLIS-DARVFRLGV---RAFGN
A0L8T6_MAGMM          RYEAFLQQ----QAPVSVDFEVVRGWGVAKTAEQLEARGVLD-SALFFRLLD---RQTPG
Q6F9B4_ACIAD          ANLFKPYP----IDGKRQMLAIAPGDTYTRFIDRMEKDGKIS-LPIVLKIYQ---KFLIH
Q83E36_COXBU          RFIHTPLQSDK-AIQQVSTIKVPPGTGIHYLAKSLHEQGLLQ-NPQFFIWLA---RLKGD
Q4FVE0_PSYA2          VYQTLFGR----IEQPQQMVTIEKGQTYYGLLPQWQQEIPLF-SATIAKLYM----KTQV
MLTG_ECOLI            HLADSKLL----IKEETI-FTLKPGTGRLALGEQLYADKIIN-RPRVFQWLL---RIEPD
MLTG_HAEIN            EFVKTPVN----VQADEL-LTIERGTTSSKLATLFEQEKLIA-DGKLLPYLL---KLKPE
K4KG43_SIMAS          -WITQPLG----LKQEAT-IQVPAGQSLIALANRLEAQGVL--EAKLWLIYA---RLNGR
Q5P0G4_AROAE          -YVTRPLP----LARPVVDFTVQRGFTMRETAAAIAGAGVDV-DPRVLYWVA---RLTGK
B2JGP6_PARP8          --ATTPVQ----LATPQLDVTIKPHSSLRSVTTQLNRGGVPV-EPELFVLMT---RVLGL
Q47DZ4_DECAR          --ANQPLS----LRSSPLDFRIAAGSSLRSAITQMRESGIEV-EPGLLAFLA---RLNRA
Q15U02_PSEA6          QQAERPLT----LNEPLL-LTVKKGQFSNSILKQLKEQSLID-DTLGLKVML---KVMPE
B1KQM6_SHEWM          TVVDFSQSTL--KLEQAQDIELKRGTSFYQLVSLLEQRALIS-DGWKLKILV---KLHPE
Q081H8_SHEFN          AYQKQPL-----QLTEIQTLTVEPGTSVIKLAQQLEQQSLIT-DSWKVKYLV---KLEPK
G2LIP6_CHLTF          RSLHVPFS----HRAADELITIEPGMGAREVVELLYERGIIP-NRYPALVYL---MLNPA
B2KD01_ELUMP          ------------AKGAPVIFEISEGQSGAQIARNLKRQGVIK-SKFMFKMML---KFFFD
H6LCJ6_ACEWD          ------------GQGDTVNVEIEDGAVISDVAELLAKNNLIR-DVFAFELLA---KKENV
F3YWT8_DESAF          KFLNTPSE----SPGREVVLDIQPGETFAHVAVELERKGVIT-DAEKFRLLG---RWRKA
E8V3R9_TERSS          -LAPY-------GPSTETFVDIAVGTSTRGMGQKLAAAGVIR-SEYAFDLVR---VVKRG
E1QKM5_DESB2          -LNHTAGI----GDKDVV-VEIPPGAGVRAVADLLGRADVVS-SPNLFWLTT---RLTSA
Q2RI00_MOOTA          TTLLAPRH----PGGAAIEVSIPPGASSATIAATLAEKGLIR-SPLAFRLVA---MAQGV
B1XPB4_SYNP2          --AIAPGE----NADQAVQLDIPVGTGAAQIGEDLTALGLIQ-SPKAWQIWVKWLRLTDR
Q2JJE1_SYNJB          QTWLQPVG----GPEPIQ-VTIQPGSSSRLIGQKLRQAGVIR-SALAWELWS---RTFGR
C5CCG3_MICLC          ------GPDHTAVEGDEVTFSVEPGEDLGSVAARLDRAGIVG-SARAFERAA---RDTGS
Q83GD3_TROWT          VINVSSVQ----RAGDIVQVTVPSGTSGAKIADILAQNSVIG-DKRGFIDLL---VAQKV
A8LCW6_FRASN          RIGGEPAADYAGSGEGIVVVQVPDGATSSEIAGRLAASDVIA-SRQAFVNLA---SRDQR
E3DAS9_GARV3          IMDDWPGP----GNGFVE-FTIEPGQGSVEVGNNLVKAQVVK-SQSTFSNIV---AANNK
D7BNS1_ARCHD          NVADFPGP----GTGEVL-IEIPEGSTGTTMGEILAEANVVA-SSRAFIDAF---KSDPR
F5XH31_MICPN          EVADYPGP----GKDQIT-VTIPEGATVNQIGGILVDNKVIQ-SAAAWDQAV---KTEER
B1MCF7_MYCA9          PVTDYSGS----GVKDFV-FEVHRGDTTKVIGQRLKDEGVVA-TPSAFTDAA---AGNQA
A1T8F0_MYCVP          PGDDFAGA----GVNDVV-IQVHDGDSTTAIGQTLHDNNVVA-NVKVFVEAA---DGNAA
A1UFI5_MYCSK          NSNDFAGE----GVNDVV-IQVHDGDSTTAIGQTLHDNNVVA-TVKAFVEAA---EGNSG
Q741L1_MYCPA          PGDDYSGS----GKRDLV-IQIQAGDSTTMVGETLHNQHVVK-TVRAFVNAA---HGNSK
B2HNC3_MYCMM          TGGDYAGP----GKRDVV-IHISPGDSTTAVGETLYNNHVVA-TVRAFVDAA---HGNAV
C3PGN0_CORA7          STLDYEGQ----GNGVTQLVQVPEGSSMGELAPELAEKNVVK-TSEAFSSAA---NSNPR
B1VDL6_CORU7          GQRDYEGA----GNGTVVMVKVGEGDSLSSIAPTLVEKKIVG-SRRALMREA---EARDA
F8E313_CORRG          GTRDYAGT----GNGKIVMVRVDEGDSVASLVPELVEKNVVG-SRRALMA-----EVSKQ
A0A059VSS5_STRA9      RHFTSPPDYEGEGSGAVQ-VEIPDGSTILQMGLILKREGVVK-SADAFSEAA---VDGKK
Q1J1B4_DEIGD          -LRSLTQP----AGGGPYTLEVKPGDTLARVARTLQAHGIVK-NADALRFVM---RQKGT
Q9RRE0_DEIRA          -FRSLFGP----AGGAPYTLEVTPGETVPQIARELENKKIVK-NARILRYAM---QQSGA
H8GUR8_DEIGI          -ARSLLGP----AGGAAYTLEVKPGDTVGAIARQLEKRGIVK-NARVLRLVM---DRNGT
C9ZG10_STRSW          -----------------MQMNTPPRSTIR-----LTRRGRAA------------------
H2K1I7_STRHJ          ------------------------------------------------------------
                                                                                  

R5L1J0_9CLOT          YDVTGPFKAGVYYL---NGQ-MGLEGMLINMMGEAD----TTETVRIMFPE-GSTVPE--
G8QS85_SPHPG          AS---VLRSGSYLM---QAD-MDNESIANQLTSNS-------LMVSVTIPP-GYTIAA--
F0RYF2_SPHGB          AT---ILKTGSYLM---HSA-LSFPEIGTMLTAEPQ-------MVQLTIPG-AFTLKT--
H8MKU3_CORCM          L----NVKAGRFML---SPT-ASVAELATALEGQPL-----PEDVPFAMIE-GWRLRD--
A8EUE6_ARCB4          -----YIQSGWIDI---DQTRLTKMDFIYKLISSKA------ALKTITLIP-GETSYF--
Q0PAY7_CAMJE          LG---HPQSGWINI---GTKDLNRAEFLHKLTIAKA------ALQTITLIP-GETSVI--
D1B1Z4_SULD5          -----KPQAGWVNF---NQEVLTRGDFLYKLSHSKA------PLKVITYIP-GETKEI--
E0USJ7_SULAO          -----SPQSGWIDM---QTNSNTKADFLYKLTTSKA------ALQNVTLIP-GETTYV--
H1FSQ2_SULGG          -----SPQSGWIDM---GDNYSSRGDFLYKLTTAKA------ALQKVTLIP-GETTYM--
Q30RQ7_SULDN          -----SPQSGWINM---KTTLNSRWDFLYKLTTAKA------ALQNVTLIP-GETTYV--
D3UGW5_HELM1          IG---KPQSGFIHI---GENVLSKGDFLYALSHSKS------TLKEVTLIP-GETMFF--
F8KP83_HELBC          LGVWKRPKSGYIFIPTNNQGYTSKGDFLYALSLSKA------FYQNATLIP-GETLYF--
E6UAM5_RUMA7          N----TIYPGDIQL---KPS-DSYSDIIDKLAEQRE----SFKTVTVTFTE-GEYLID--
A6LSG3_CLOB8          KV---NLTEGIYEI---NTN-SSLEELIKSLENKDG----DKDLVKLTIPE-GYSIED--
MLTG_STRP2            T----DLKAGYYNL---QKS-MSTEDLLKELQKGGTDEPQEPVLATLTIPE-GYTLDQ--
MLTG_BACSU            SG----FQAGFYHL---NKG-MDLDAIIQKLTSGAT-----GYAFQITVTE-GAQLTQ--
Q8Y725_LISMO          T----NLKAGNYEL---SPA-MNTDQIVKKMQEGKT----V-APAKLVIPE-GYTLDQ--
G4L8R7_TETHN          DG----FQAGEYVF---SPS-MSLDEIVNSLKEGES----AFDQARIAVPE-GYDVEE--
Q74IE3_LACJO          T----NFQAGNFYL---SPS-MHNKEIVSQLQGGGG----RPVVGHVLIKE-AQTIDS--
E6TVA9_BACCJ          S----NFQAGDYSL---SRN-MDMDDIILELKEGMV---YQDYQISFTIPE-GRWLER--
C4L555_EXISA          S----SFQAGTYTL---SPS-QSIDELIETLQTGKV---IVVPDIKLVIPE-GFTIDQ--
A0A6N4SMW4_CYTH3      E----TLRPGMYRV---EKG-WGNYQILSVVENTDL-----RSSQLIDLAE-YRSRKR--
F4KL00_PORAD          EE---RLRPGRYRL---SPD-MSILSICKTIKYGAQ------SPVRLSFSS-IRTQEE--
Q8AAN3_BACTN          DQ---NIHTGRYAI---RPN-ENVYHVFSRFFRGYQ------EPMNLTIGS-IRTLDR--
G2Z4P8_FLABF          PE---HVKAGRFLI---QNN-MGNWAIVTALRKNVA--------VKLAFNN-QERLED--
C7M7P7_CAPOD          AD---KVKAGKYII---KKG-ATNIDIVRTLRNRNT-------PVKLKFNN-QERLED--
L7WC83_NONDD          HE---NVKSGRFLI---KKG-SSNNDIINTVRSQNM-------PIKVTFNN-QERLEN--
D5BKJ7_ZUNPS          PN---NIKAGRFIL---KKG-MNNNEIINALRSQNM-------PVNVTFNN-QERIED--
G0LCU6_ZOBGA          AA---NVKGGKYAI---VKG-MNNNDIVNSLRSKNV-------PVRVAFNN-QETIAD--
F9YQ52_CAPCC          IQ---NIKAGRFII---KKG-SSNNEIVNVLRSKNT-------PIKLAFNN-QETLSD--
E4RY37_LEAB4          RE---EIKAGRYEI---PPN-SSNNTIISKLLAGRQ------DPVKLTFNN-IRTKED--
A0A6N4SPZ0_CYTH3      QD---QVKAGRYVL---PVK-TTNLQVVRKLRSGAQ------DPIKVTFNS-IRLKSE--
D2QPT3_SPILD          PE---RVKEGRYEI---KPK-MGNREALVKLRSGSQ------DAMPVTFNS-MRQKSD--
Q2RZI9_SALRD          GQ---QIKSGHYRI---APR-RSNYALLDKLRRGLQ------DPVRITLPP-GVQPGA--
D1CC01_THET1          RG---HLLPGRYLI---KRG-TSARDLIATFTDASN-------QSKITIPE-GFRLGQ--
B3EQD0_CHLPB          LR---NIKPGRYSI---PSG-LSNHTLLTYLHNHPQ------DEERVMIPE-GVRKER--
Q8KAE0_CHLTE          LH---KIKPGRYTI---SGN-HSVFGLLWYLHSRPQ------DEVRVMIPN-GVEQRK--
D4H8I5_DENA2          DR---NIKYGYY-----RADKLPVRRIVDAIMKGRQ------STIKVTIPE-GYNMYD--
B0SRD8_LEPBP          GN---KIKQGVYDI---NDG-MSSRKILDVIISGKV------KLVTFTIPE-GYNNRQ--
C6XF53_LIBAP          SR---GLKTGEYEI---EKG-SSMSQIAEKIMYGKV------LMHSISFPE-GFTVKQ--
G2KT77_MICAA          HT---NLKAGEYAF---APQ-ISMRSVIDKIERGDV------VQRRVTVPE-GLTSHQ--
Q2W5G2_MAGSA          -----TLKAGEYAF---PAQ-VSPEEAMRIIAEGKV------VIHKLTVAE-GLTVRQ--
Q0AQC6_MARMM          EG---VLRAGEYRI---PAQ-ASMAQIYEQLRVGQT------VQYPVTFAE-GLTSAM--
Q9A7P1_CAUVC          AR---TLKAGEYEF---NSR-ASMAQVLDAVRRGRI------VRHWITIPE-GLTSDM--
Q89MV6_BRADU          SS---DLKPGEYSF---QKN-ASLRDVIATIVEGKV------VQHAVTIPE-GLTSEQ--
Q984T1_RHILO          DS---ALKAGEYEI---KPR-ASMRDIMELLKSGKS------VMYSLTIPE-GLTVEQ--
A0L8T6_MAGMM          T----ALKAGTFAI---EAG-MTPLQILEKLRSSQV------VQRSITFPE-GITLIH--
Q6F9B4_ACIAD          D----SLKAGVYEI---RQG-MSIRQVMVMLSNAEN-----AQMNRILVIE-GTTFKQ--
Q83E36_COXBU          AP---LLKAGEYEI---TPT-MTPLELLRNVVAGKV------KQRSITFIE-GWTFRE--
Q4FVE0_PSYA2          DG---PLHAGIYQL---PEN-PTIAEALHVLGQGVK-----AAMVKVQIIE-GKTSKD--
MLTG_ECOLI            LS---HFKAGTYRF---TPQ-MTVREMLKLLESGKE------AQFPLRLVE-GMRLSD--
MLTG_HAEIN            LN---KIKAGTYSL---ENV-KTVQDLLDLLNSGKE------VQFNVKWIE-GKTFKD--
K4KG43_SIMAS          T----AIKAGEYEI---EPA-LSRLALLEKLIAGDV------VQYRAQILE-GWTYAQ--
Q5P0G4_AROAE          AD---RILAGSYEV---HTG-VTPWLLILKLSSGDV------SQAQLRLVE-GWNFRQ--
B2JGP6_PARP8          QT---ALKSGNYEF---KQG-ITPYDVLQKIARGDV------NEYVATIIE-GWTFKH--
Q47DZ4_DECAR          DT---AIKAGSYAV---KDG-VTPIRLLDKLLKGKV------TQGELTLVE-GWTFRQ--
Q15U02_PSEA6          IA---NVKAGTYEI---EPG-MNGIDVFQLIASGKE------KQFALTLVE-GLRWQD--
B1KQM6_SHEWM          LA---KIRTGLYEI---KPG-ETVSGLLEKLNQGKE------KVFAVTLVE-GQSIKE--
Q081H8_SHEFN          LA---HIKTGLYQM---IPG-DTLEALLKRLYLGQQ------VVFSITLIE-GKTITE--
G2LIP6_CHLTF          GR---RLQAGDYEF---ESP-IAPLAALEKIRRGAV------ATRRIMFRP-GLTIYE--
B2KD01_ELUMP          PK---GLKAGVFDL---RQN-TSPEEVISCISSGKC-----QHLEKVTILE-GWRIEE--
H6LCJ6_ACEWD          AN---QIQSGYYAF---NPA-ESAQQILDRLVSGDV------ADASVTIPE-GRNISE--
F3YWT8_DESAF          TG---HVRAGEFAL---NTG-MVPDEVLKTLTTGTE------MLHRLVVRE-GLAWWE--
E8V3R9_TERSS          -----RLKAGEYRF---DHP-ATAVEVYERIARGDV------YTRAVTVPE-GYNLWD--
E1QKM5_DESB2          DG---PILAGEYKL---SPA-MTYGGILRVLRQGKV------LLHTVVLPE-GLTMAQ--
Q2RI00_MOOTA          DR---QLKSGSYLI---SPG-LPLPAITRLLASGNT------LEIEFTVPE-GYTVRQ--
B1XPB4_SYNP2          GG---SLKAGTYQF---PPN-QDLPAIAQQIWSGDV------VQTSVTIPE-GWTIQQ--
Q2JJE1_SYNJB          DW---VFQAGTYAL---DPN-QDMLAVAQQLRQGRI------LQRRLTIPE-GWRIEQ--
C5CCG3_MICLC          G----LVRSGDFVL---RER-MPAAEALAVLQGATD------GAVHYVLVERGRRLTE--
Q83GD3_TROWT          -----SLRAGVYRL---KRG-MSPREALLAMLNPEN-----RTSNTVVIIE-GATLTG--
A8LCW6_FRASN          AL---SIQPGTYRL---RSK-MSAAAALDALLDDAS-----SALFRYTISP-GDTVRQ--
E3DAS9_GARV3          -----ILYPGIYAL---KKY-MNSIDVVNILSDQSK------AGGFLDVKA-GERSTD--
D7BNS1_ARCHD          SA---SIQPGSYKL---KLK-MSGQGAVSALLDPAS-----KAELKITIPE-GFAQAQ--
F5XH31_MICPN          ST---SIQPGKYLM---QTE-MSAIDALTLLINPGE----SRIRSQFTVPE-GLRLTA--
B1MCF7_MYCA9          IA---AIQPGFYKL---RTK-IAGKEAVARLAEQDN------RVGLLVIPE-GRQLDDVS
A1T8F0_MYCVP          IS---AIQPGFYKV---RTE-IPAADAVDRLADPGN------RVGKLVIPE-GRQLDDVR
A1UFI5_MYCSK          IT---AIQPGFYKV---RTE-IPAANAVERLTDPQS------RVGKLVIPE-GRQLDDVS
Q741L1_MYCPA          ID---SIQPGFYRM---RTE-IPASDAVARLADPNS------RVGRLVIPE-GRQLDDTT
B2HNC3_MYCMM          IA---AIQPGFYLV---RTE-IPAADAVARLADPKN------RVGKLVIPE-GRQLDDTT
C3PGN0_CORA7          AS---QIKPGFYRL---QEE-MSAKAAVEALLDEAN------MVDLLDVQG-GATLLD-V
B1VDL6_CORU7          -----SLQTGYYPL---QEK-MSASAALDALTDDAN------RRGVVDIPN-GLPLEDVT
F8E313_CORRG          AP---TLQAGYYPL---QEE-MSAKSALEKLSDEKS------RRGVVDIPT-GLTLENVT
A0A059VSS5_STRA9      DK---LLQPGSYSL---RKQ-MSAASAVALMSDPRS-------RNGLTIQE-GLRASA--
Q1J1B4_DEIGD          AG---RLKEGLYDL---NGQ-MNVYQVADTLAGPAR-----IPTVNATIPE-GWRLKD--
Q9RRE0_DEIRA          AA---RLKEGAYDL---NGQ-MTVDEVVKTLDGPAR-----VPVVNVTVPE-GRRIKD--
H8GUR8_DEIGI          AG---SLKEGLYDL---NGQ-MSAQQVAETLAGPAR-----IPTVNVTIPE-GRRIKD--
C9ZG10_STRSW          -----LIAAGAVVA---ATAVAVPLLSVESGGGADE------RPTSLVIPE-GWRSGQ--
H2K1I7_STRHJ          -----TLATGR------EQD----------------------KPATLVIPE-GWRASQ--
                               *                                                  

R5L1J0_9CLOT          ----------IVDLLVE-N--EVCDRA-----SLLSVIESTDFTYSL--VSDL-------
G8QS85_SPHPG          ----------IDIYLAN-R--GYAKSG-------EFFQASEDLKV----AYGLS------
F0RYF2_SPHGB          ----------IDDYLVN-R--LGFAEG---------TFLQSAHDLAT--AYGLG------
H8MKU3_CORCM          ----------TDQVLAA-Q--GLIKPG------EYIAAASRTSNFAA--PFPLPTR----
A8EUE6_ARCB4          ----------FLKKIAQ-E--FSLSEE-------ILTKIYNEHAY---------------
Q0PAY7_CAMJE          ----------FLEQAAK-Q--LGLDKD----------------ILLK--EFQAQAP----
D1B1Z4_SULD5          ----------LFAELAL-A--FELSYE----------------KLHQ--EYAAATP----
E0USJ7_SULAO          ----------FLNQLAN-N--LHLNRT----------------KLQN--EFERYAP----
H1FSQ2_SULGG          ----------FLNELSQ-K--LLLDRE----------------KLES--EYLRQTN----
Q30RQ7_SULDN          ----------FLNQLAE-Q--LRLNRD----------------ILEK--EYALQTS----
D3UGW5_HELM1          ----------FNEILAQ-N--FPVSIK----------------NLQK--AYEKYAP----
F8KP83_HELBC          ----------FLQKLAQ-T--FHLKVS----------------DLQK--AYEIHAP----
E6UAM5_RUMA7          ----------IAKKLEE-N--KVCPAG----------------DFLF--EFNKDMGYKFE
A6LSG3_CLOB8          ----------IAKSVED-K--GICSKD----EFIKDVKDYKLPSFVK--NNNKKRY----
MLTG_STRP2            ----------IAQTVGQLQ--GDFKES---LTAEAFLAKVQDETFIS--QAVAKYPTLLE
MLTG_BACSU            ----------IAAAIAD-E--TKYSKK-------QVIAKLDDETFIN--QLKKEFPDTVT
Q8Y725_LISMO          ----------IADRIVAYQ--PKLKKA-------DVLKTMDDPEFVA--SMIKAYPETVT
G4L8R7_TETHN          ----------IAEEIDQ-Q--TEFSED-------EFLDLMKDEDFFD--ELHDSYPELLD
Q74IE3_LACJO          ----------IATTVSK-N--TKYSRQ-------DFLKLMKDKSFMK--SLEKQYPKLLT
E6TVA9_BACCJ          ----------VIELAEE-N--TNLSEE-------DILEVITDEEYLE--ELIERYEILEE
C4L555_EXISA          ----------VIARLAK-V--AEIPKE-------EISEQLSDREYIQ--SLVNEHEMLTE
A0A6N4SMW4_CYTH3      ----------TIKELCK-L--TGIDEK-------EFLELLKDEDEVD--DLGGFTTE---
F4KL00_PORAD          ----------LIDKLTA-P--LEMSAD-------ELRTLLRDSVYCD--SLGFTTE----
Q8AAN3_BACTN          ----------LARSIGK-Q--LMIDSA-------EIARQLFDSAFQT--EMGYTPV----
G2Z4P8_FLABF          ----------LVGRVSH-Q--IEADST-------ALLNTIKDPGFLQ--QNGFTPD----
C7M7P7_CAPOD          ----------FAGRIAA-Q--IEPDST-------TLMRAFLNPNFLK--ENGFTDA----
L7WC83_NONDD          ----------LAGRIAD-Q--IEPDSL-------ALLNAMRDPEFLN--KNGLDAN----
D5BKJ7_ZUNPS          ----------LAGRVAA-Q--IEADSL-------SLLEAMQSKDFLA--DNSFDDA----
G0LCU6_ZOBGA          ----------LAGRIAM-Q--IEPDSL-------TLLEAFTDEAFLK--ANGFGEE----
F9YQ52_CAPCC          ----------LAKRIAE-Q--IEADSL-------SLIQAFTDIHFLK--ENDFTIS----
E4RY37_LEAB4          ----------LVRKIGS-R--LAFNGE-------ELLAKLQDEDTAN--KYGFKSE----
A0A6N4SPZ0_CYTH3      ----------FAERIGS-K--FSFGSD-------TLRKLLADEAVCK--KYGFDTS----
D2QPT3_SPILD          ----------LIQRLGS-K--FEFGPD-------ALGKLLNDPATCQ--KFGFDTT----
Q2RZI9_SALRD          ----------LTSVLGR-R--LERDAG-------AFRAALRDTSLAE--ALDSTPA----
D1CC01_THET1          ----------IEDRMLQ-L--GLTTPQ----QWQEAINNPPKSPLLASKPKGV-------
B3EQD0_CHLPB          ----------IAAIVSS-H--LDIDSL-------SFINSATDRALLD--SLGIQAG----
Q8KAE0_CHLTE          ----------IARIIAA-N--LDIDST-------AFIAASRDPRLLA--SLGIKGE----
D4H8I5_DENA2          ----------VANRMSE-R--IVESPG-------EFLKTVKDKTYIKN-LTGMGYQ----
B0SRD8_LEPBP          ----------IGDLLVTKK--LSPSRE-------EFLKVTQSPALLT--KYNIPAK----
C6XF53_LIBAP          ----------MARRLKD-N--PLLVGE-------------------L--PLEL-------
G2KT77_MICAA          ----------IVKIVNG-T--DGLSGT----------------------ITDI-------
Q2W5G2_MAGSA          ----------VLDLVRE----ADFLSG----------------------PVSRK------
Q0AQC6_MARMM          ----------IVETLNA-A--DVLTGE----------------------ISDI-------
Q9A7P1_CAUVC          ----------VMDILNK-S--AVLTG----------------SAAT--------------
Q89MV6_BRADU          ----------IVARLSD-N--DIFTGS----------------------VREL-------
Q984T1_RHILO          ----------ALQRIAD-E--PALSG---------------DMPATT-------------
A0L8T6_MAGMM          ----------IADKFRQ-A--GWPQVG----------DALLTPEGVQ--RLGVAQP----
Q6F9B4_ACIAD          ----------LIENLKK-D--PLVTKT---------VVNLPYSEMLK--ALDIPYQ----
Q83E36_COXBU          ----------MKQTLEE-N--PYIHHT---------IDRLSDQKILA--KLGCTNL----
Q4FVE0_PSYA2          ----------LYQALRD-N--KGIKKE-------VLTADSTNASIAQALDLVGILPDTVA
MLTG_ECOLI            ----------YLKQLRE-A--PYIKHT---------LSDDKYATVAQ--ALELENPE---
MLTG_HAEIN            ----------WRKDLEN-A--PHLVQTLKDKSNEEIFALLDLPDIGQ--NLELK------
K4KG43_SIMAS          ----------TLDYLQS-L--DYLQIK-------LSGLS--WQAQRQ--LLGM---EWAA
Q5P0G4_AROAE          ----------VRAALEA-S--PELIQD---------TVGLSEAEILQ--RIGATES----
B2JGP6_PARP8          ----------MRAELDA-N--PALKHD---------TAGMADADLLK--AIGAPETPTG-
Q47DZ4_DECAR          ----------WRARLDKHPDLKHE------------LLGLSEAEIIE--KLGLSVA----
Q15U02_PSEA6          ----------WEKQLTS-H--PYVKVG------------DDFSENVKRFSHDIEGQ----
B1KQM6_SHEWM          ----------WTAILNT-L--PHTET-----------TEDVFNLVLS--EQGDDSA----
Q081H8_SHEFN          ----------WQQTLST-T--EHLAK-----------NTDDFNQVLL--QNGDTSG----
G2LIP6_CHLTF          ----------VNDLLPN-R--PANGK---------LDPALLDVRLIA--DLDPQAT----
B2KD01_ELUMP          ----------IAMALQD-K--NICDAM----------------DFTK--MAKER------
H6LCJ6_ACEWD          ----------FAQILED-Q--NICDADAFIEETKKVSVYQKEYPILSSIPLEQKDGVSR-
F3YWT8_DESAF          ----------TAKLVEQ-A--GLGSFE-------SFKAAVHDPELLA--KHNIQAD----
E8V3R9_TERSS          ----------IAAAVETAG--LGKQAD-------FLKAAKANTKLIA--QWSPAAT----
E1QKM5_DESB2          ----------AVGRLAQ-A--GLIDEQ-------KALALCGDKGFVT--AMGLAGP----
Q2RI00_MOOTA          ----------IASLLQQKG--LVKEED-------FLKAAAGDYPFSFLQGLPSGPE----
B1XPB4_SYNP2          ----------MANRFEA-L--GFFPAT-------EFIAATQTIPREQFPWLPADLT----
Q2JJE1_SYNJB          ----------MAEALAQ-R--NWLAAD-------AFIAVTRVIPPLDWLPPNLS------
C5CCG3_MICLC          ----------VLDAVAE-A--TGLPRE----ELEAAAQDPTRYGVPG--EAG--------
Q83GD3_TROWT          ----------IFSALSK-K--TGIPIV---------EFEKVASDLSNFPDLPRQAS----
A8LCW6_FRASN          ----------VFKELST-R--TGTPVA-------DLEAIARKPSTLGLPDYAT-------
E3DAS9_GARV3          ----------VIRKAAQ-I--SGIDIA----QFNAIQKTDGAGILPP--EAGG-------
D7BNS1_ARCHD          ----------IVERVAN-I--MNVPTS----DVEAVLKDPAQIGLPA--EANG-------
F5XH31_MICPN          ----------QVDTLVK-T--TKIKRA------------SYEKALAN--PKKLGLPSYAK
B1MCF7_MYCA9          AVSNGAVTEGIFTLIAR-ASCVDLDGD---KHCVAASDLRQAATTAS--QGELDVPDWAS
A1T8F0_MYCVP          DVKTNAVTEGILTLISK-ASCVDLDGD---RHCVSADDLRNTAAGAD--PAELGVPQWAT
A1UFI5_MYCSK          DVKTNAVTEGIFTLISK-ATCVDLDGE---RQCVPVDELKRVAETAA--PSALGVPEWAV
Q741L1_MYCPA          DMKTNKVNPGIFTLISQ-ATCVDLDGN---RRCVPVQQLRAAATNST--TAALSVPPWAL
B2HNC3_MYCMM          DMKTNVVTPGILTLISR-ATCVDLDGK---KHCISMADLRTAATKST--PATLAVPSWAV
C3PGN0_CORA7          NVLGGDVRFGIYSLISQ----VSCKEG----GCVSAEELEKIAATVD--PAELGAPEWAL
B1VDL6_CORU7          -VVGGKTREGIYSLISA-Q--TCSSQD----ECITSDTLRDAVVSST--PEELEVPQWAK
F8E313_CORRG          -VVGGKPREGIYSLVSK-Q--TCQDNN------TCVSPEKLREAVARTSPADLGVPQWAQ
A0A059VSS5_STRA9      ----------VYTLIDK-K--LKLAAGTTKEIAHNQAKNLGLPSWAD--DSPKIKD----
Q1J1B4_DEIGD          ----------IPPILAR----AGFDAA-------AVKAALNDPSLS---PYTAGQQK---
Q9RRE0_DEIRA          ----------LPEIFQK----AGFDAA-------AITAALNDASLSR--YARGKQK----
H8GUR8_DEIGI          ----------LPAIFEK----AGFSA--------QGIRAALNDTALS--PYASGKQK---
C9ZG10_STRSW          ----------VYEAVDK-A--LALPAG-------STRKSLPKARLTL--PDDAEG-----
H2K1I7_STRHJ          ----------IYDAIDK-A--LKLSPG-------STRTAVGKASLKL--PNEARG-----
                                                                                  

R5L1J0_9CLOT          ---QSKETAPYRLEGYLFPDTYDFY-IGQ---------SASSVIETFLNHGEEVITEE-L
G8QS85_SPHPG          -----------FSEGWLLSGTYSIK-QDA---------AAKNLALSMFEAMLQGLKPY-L
F0RYF2_SPHGB          -----------FAEGWLLGGTYTVN-RQR---------AANDLALAMYEAMLNEIQKH-L
H8MKU3_CORCM          -----------SLEGYLYPETYGIIADNF---------KVEAFIQRQIDTFRARFYDA-H
A8EUE6_ARCB4          -----------KADGNILADTYSIP-IGM---------KEDYIIFYLFSQTNRKYEEF-S
Q0PAY7_CAMJE          -----------YDEGVFLPETYKIP-KGI---------TENLLIQMLLNHAEISNKKT-S
D1B1Z4_SULD5          -----------YVEGLIVPETYYIP-VGI---------SEKHLIHFLLAHAKSYHKSV-F
E0USJ7_SULAO          -----------VKEGVFIPDTYKLP-VGI---------TEKELIRVLLNISHKKMKEL-S
H1FSQ2_SULGG          -----------QLEGALVPNTYKMP-IGI---------TERELIRILLYNSHNQMKDL-S
Q30RQ7_SULDN          -----------WVEGAFVPNTYRLP-IGI---------TEKVVIRVLLNESDAQMRSL-S
D3UGW5_HELM1          -----------YDDGVIFADTYKLP-LGA---------DADFLMQFLVQKSLKRHKEL-S
F8KP83_HELBC          -----------YKEAGIVPDTYRFA-VGV---------SADKLIEHLIKHASNYYQNL-S
E6UAM5_RUMA7          GYLTDSKNTLFPREGYLFPDTYEFY-VDD---------TPYNITKILRDHYDSKINDA-L
A6LSG3_CLOB8          -----------NLEGYLYPDTYLIE-KGS---------NANDVIKSMLDRFEDVLKQA-E
MLTG_STRP2            SLPVKDSGARYRLEGYLFPATYSIK-EST---------TIESLIDEMLAAMDKNLSPY-Y
MLTG_BACSU            NDVFNKNIKH-PLEGYLFPATYPFNDPDT---------SLEDIIKAMIKQTNSYVETY-K
Q8Y725_LISMO          NDVLNKSIKH-PLEGYLYPATYTFKGTDV---------SAEQIITEMVKATDVNIAKY-R
G4L8R7_TETHN          DAAEAEDVRY-RLEGYLFPATYDYQ-PDM---------SLEELVEQMVATTDSTLEGH-Y
Q74IE3_LACJO          SSMNSKGVRY-HLEGYLFPAKYDVY-QGA---------SLKELVNQMVDKTDQVLQPY-Y
E6TVA9_BACCJ          VILTEEIRY--PLEGYLFPARYDFVEEEI---------TVEQLIETMINRTSSVLIDN--
C4L555_EXISA          EVLQEGIYH--PLEGYLFPATYEFN-KGV---------TLNEIIDEMLLPTESMYQE--Y
A0A6N4SMW4_CYTH3      -----------SVYCIFRPGRYRIY-KNT---------TPKEVLEYLACQYTQLWNEE-R
F4KL00_PORAD          -----------TIRCMFLPDTHEVY-WTV---------SPKELLHKYEQSYHKFWDQK-R
Q8AAN3_BACTN          -----------TMPCLFIPETYQVY-WDM---------SVDDFFKRMQTEHKRFWNDE-R
G2Z4P8_FLABF          -----------NVLVMFIPNTYEMY-WNT---------SAEKFRDKMIKEYHKYWTKD-R
C7M7P7_CAPOD          -----------TALAMYIPNTYEFY-WNT---------SAEEFRDRMLKEYERFWTPE-R
L7WC83_NONDD          -----------TALSIYLPNSYETY-WNT---------TAAGFRDKMLAYHQQFWNKE-R
D5BKJ7_ZUNPS          -----------TALGMYIPNKYEFF-WNT---------SAEEFRSRMKKEYDRFWTDT-R
G0LCU6_ZOBGA          -----------TRLAMYIPNSYEFF-WNS---------SAEEFRDRMLKEYRRFWTEE-R
F9YQ52_CAPCC          -----------DAIGMYVPNTYEFF-WNT---------SAEKFRDRMLKEYHRFWNET-R
E4RY37_LEAB4          -----------TFMNMFLPDTYFIY-WTV---------TPDAFLDRMHSEYKKFWTEE-R
A0A6N4SPZ0_CYTH3      -----------TILAMFIPNTYEFY-WTL---------SAETFMNRMQNEYTQFWTVK-R
D2QPT3_SPILD          -----------TIVCLFLPNTYEFF-WTI---------KPEALLERMGSEYKKFWTPE-R
Q2RZI9_SALRD          -----------RLFGYMLPETYEFY-WQT---------PPEAVVRRVKQGFDRFYERE-L
D1CC01_THET1          -----------SIEGYIFPDTYIFT-EEN---------AAQQLVREGIANMQKHLSKD-I
B3EQD0_CHLPB          -----------SFEGYFFPGTYNFP-WAS---------TSEEVIRFLVGRFHTFYHDS-L
Q8KAE0_CHLTE          -----------STEGYLFPGTYNFA-WAS---------TPKEVITFLTRRFRAFYSDS-L
D4H8I5_DENA2          -----------TLEGFLYPDTYFFS-PKS---------EPQYVISAMYQAFLKSLPEH-F
B0SRD8_LEPBP          -----------TLEGYLFPETYSVP-LNY---------PLERITEMMIKRFYKKLETI--
C6XF53_LIBAP          -----------PLEGTLCPSTYNFP-LGT---------HRSEILNQAMLKQKQVVDEV-W
G2KT77_MICAA          -----------PAEGSLLPETYSFL-KDQ---------DRTEIITQMQTAMTDAITQM-W
Q2W5G2_MAGSA          -----------VAEGRLLPETWHMT-RDE---------MRDDVIARMEKAMAQTLDVL-W
Q0AQC6_MARMM          -----------PAEGTLLPETYLVT-RGT---------ARQEVLDRMAAAQTELLDRL-W
Q9A7P1_CAUVC          -----------PPEGAILPETYEVQ-RGE---------DRAAVLQRMMDDRDAVLNAL-W
Q89MV6_BRADU          -----------PREGTLLPETYKFP-RGT---------TREQVIQRMQQAHKRVLTEI-W
Q984T1_RHILO          -----------PPEGSLATDTLRFT-RGA---------TRQQMIDKLVADQKKLVDEV-W
A0L8T6_MAGMM          -----------SLEGMLFPDTYFYT-LEE---------EGWVVAQRMAQRMQQVLQQQ-W
Q6F9B4_ACIAD          -----------HPEGLFEPNTYFFA-KGE---------TDKKILTDLYRYQMKTLNEE-W
Q83E36_COXBU          -----------RPEGLFFPDTYSFT-WGD---------NDIKILRQAYQRMQTILNEA-W
Q4FVE0_PSYA2          NSNDPIVNH--NLEGWFAPDTYYYG-EGT---------TDKKVLTDLYKRQQQALTKA-W
MLTG_ECOLI            -----------WIEGWFWPDTWMYT-ANT---------TDVALLKRAHKKMVKAVDSA-W
MLTG_HAEIN            -----------NVEGWLYPDTYNYT-PKS---------TDLELLKRSAERMKKALNKA-W
K4KG43_SIMAS          HP-----------EGWFFPDTYHYQ-RGD---------SDVNILVQAHNKQATLLDQL-W
Q5P0G4_AROAE          -----------HPEGLFFPDTYLFD-KQS---------SALALLARTYRAMHERLAQA-W
B2JGP6_PARP8          -----------TGEGLFFPDTYLFD-KDT---------SDLDVYRRAYRLMKLRIDEA-W
Q47DZ4_DECAR          -----------GLEGQLFPDTYLFD-KQS---------SDLELLARAQRAMQRKLDAE-W
Q15U02_PSEA6          -----------SLEGWLMPDTYHFV-AGT---------SAFTIVKWAYSAMQKELALQ-W
B1KQM6_SHEWM          -----------LPEGKFYPDTYHYR-AGD---------NIKLLVTQSYNKMQQELEAA-W
Q081H8_SHEFN          -----------LPEGKFYPETFHYH-ADD---------NLQTILNRSYTMMQLSLAQA-W
G2LIP6_CHLTF          -----------SLEGYIFPDTYIVP-KRA---------TNAEILAEAVARFRRAWTPE-L
B2KD01_ELUMP          -----------NLEGYLYPSTYMFP-QKM---------QTAKVIDAMVAEFNKRVRPL-F
H6LCJ6_ACEWD          -----------SLEGYLYPDTYRFS-PNT---------EPSEVVKAMLDRFVEVYDKD-Y
F3YWT8_DESAF          -----------SAEGYLFPETYMLPKPKG--------NDARAVVEVMLGHFATAAGKV-W
E8V3R9_TERSS          -----------SMEGYLFPDTYRFS-RHT---------TDEQMLAAMVRRFGRAMAEL-G
E1QKM5_DESB2          -----------NMEGYLFPDTYHLA-KGL---------GERRILGLLARRFLTAWR-V-V
Q2RI00_MOOTA          -----------HVQGFLFPDTYQVA-PGT---------PAREIIMMMLNRFNQVYQEI-A
B1XPB4_SYNP2          -----------SLEGFLFPDTYFLDTAQP---------SPPAIIEQMLGQFEAVVLPL-Y
Q2JJE1_SYNJB          -----------SLEGYLFPDTYLFP-IEQVEGSLPDREKAQMVVDAMLQRFVAVALPL-F
C5CCG3_MICLC          -----------TLEGWLDAGEYRLP-VDA---------TAGQVLDALIRPTLTELEAL-N
Q83GD3_TROWT          -----------SVEGFLFPATYDIE-EGA---------TAKSLLLAMYKRMWAEIRTL--
A8LCW6_FRASN          -----------GLEGYLFPSTYDVA-PGT---------DPVDVLKEAVARFRANAEEI-D
E3DAS9_GARV3          -----------SFEGWLEPGVYNVK-SMK---------SATKILAKMVDKRIQKLDSL-G
D7BNS1_ARCHD          -----------HPEGWLAPATYTVA-PKA---------TVKDILSDMVANRVKGLEKT-K
F5XH31_MICPN          N----------KPEGFLFPDTYELT-EQA---------TAASVLKQMSGRFKDVAKEV-K
B1MCF7_MYCA9          NGVNAVRDDHRRIEGLIAAGRWDFD-PMA---------EPEQILASLIRESNAQYQQL-G
A1T8F0_MYCVP          EPVEALGSDLRRLEGLIAPGSWNID-PSA---------QPQDILSTLISASATLYEQN-G
A1UFI5_MYCSK          QPVTAMGDDHRRLEGLIAPGSWNID-PSA---------TPQDTLATLIRASANQYAQS-G
Q741L1_MYCPA          EPVNELGRDHRRIEGLIAPGTFNVD-PSA---------SPESILAGLISAGAEEYLKS-G
B2HNC3_MYCMM          EPVLELGADHRRIEGLIAPGTFNID-PAG---------SADKILASLISAGAVEYLKSGL
C3PGN0_CORA7          EAVRARGEDPKRLEGLIAPGQYVLD-PNM---------DAQEILTDLITRSTKKYNDTNI
B1VDL6_CORU7          GAVASRADDPRRIEGLISPGVHLFD-PTA---------TPQEIMRELISNSAAEYEAT-G
F8E313_CORRG          EPVSRRGEDPKRIEGLISPGIHVFN-PTS---------NPVEIMKSLISASAKQYENT-G
A0A059VSS5_STRA9      -----------PLEGFLYPSTYSVG-EHA---------KPADVLRQMVSRATQEYQKYDL
Q1J1B4_DEIGD          -----------NLEGFVFPATYTFR-VGE---------TPRDAVQEMVDRMNEEFTPA-N
Q9RRE0_DEIRA          -----------NLEGFVFPATYEFR-PKD---------SATDVVKKMVERMETEFTPG-N
H8GUR8_DEIGI          -----------NLEGFVFPATYEFR-PAE---------APEDVVKEMVGRMNTEFTPA-N
C9ZG10_STRSW          -----------NPEGYLFPATYPVR-EKA---------TPESLLASMVETANKRFNGG-Q
H2K1I7_STRHJ          -----------NPEGYLFPATYPVR-KGA---------TPESMLQLMIDAADQKFNGA-P
                                                                                  

R5L1J0_9CLOT          RTKAQQMGY-SMHDVITIASIVQAEAGSEDQMKTIASVIENRL-----ADTTN-YPSLGC
G8QS85_SPHPG          DS--ERVSLYGVDAVLIVASMIQAETQDPREMPLIASVIYNRL-----DA----DQPLGI
F0RYF2_SPHGB          SS--PQLEVYSIQELLIIASMIQAETQEAGQMQEISSVIFNRL-----KN----EEPLGI
H8MKU3_CORCM          KDEIAKSGR-SLHDIVVMASMLEREEPVPSQRALVAGILWKRV-----DK----GFPLGV
A8EUE6_ARCB4          KKIFGVYDKKKWYNYITLASVIQKEAATTNEMPIVASVVHNRL-----KK----GMRLQM
Q0PAY7_CAMJE          EKIFGDYNPKKWHQYIIIASVIQKEAANDNEMPIVASVIYNRL-----KK----GMKLQM
D1B1Z4_SULD5          EKIFGEFNETKWQKFIIIASIIQKEAANAEEMPLVSSVIYNRL-----KK----DMKLQM
E0USJ7_SULAO          AKFFGTYNEKKWFQYVAIASVIQKESANTAEMPLVSSVIYNRI-----KK----GMKLQM
H1FSQ2_SULGG          LKLFGTYNEKKWFHFVAIASVIQKESANIEEMPLVSSVIYNRI-----KK----GMKLQM
Q30RQ7_SULDN          QKVFGLYNEKKWFQFVTIASIIEKESANAEEMPLVSSVIYNRI-----KK----GMKLQM
D3UGW5_HELM1          LKVLGIYDEEQWFKYITIASIIQKEAANDKEMPLISAVIYNRI-----KK----GMPLQM
F8KP83_HELBC          HKLLGHYDPKQWEKTLIIASIIQKEAANTQEMPLIAGVIFNRL-----HK----NMPLQM
E6UAM5_RUMA7          YKKMNDRGL-SLNQTITLASIVQQEAANVQEMPKVASVFLNRL-----KDSDTFPM-LQS
A6LSG3_CLOB8          DETKVEISDEDVEKIVTIASMIEREARVPGDRPLISSVIYNRL-----EK----DMKLQI
MLTG_STRP2            ST--IKSKNLTVNELLTIASLVEKEGAKTEDRKLIAGVFYNRL-----NR----DMPLQS
MLTG_BACSU            SEMKKNKV--SVHKLLTMASLIEEEATEKADRHKIASVFYNRL-----KK----KMPLQT
Q8Y725_LISMO          DELTKQKM--SVHKFLTMSSIIEKEATENVDRKMIASVFYNRL-----AK----DMRLQT
G4L8R7_TETHN          DE--IKNSDLNVQETMTVASLVEKEGVTEEDRKDIAQVFFNRT-----EA----DMPLQS
Q74IE3_LACJO          SS--IKKKHLTVQEVLTLASLVEREGVKTKDRRMIAGVFFNRL-----KA----NMPLQS
E6TVA9_BACCJ          ---GAAGSQYTYHEILTLASIIEGEARNDEERYRISGVIKNRL-----DR----GMPLQM
C4L555_EXISA          KDRLADSGR-TFHETLALASVVEKEAVSTEDRKEIAGVFENRL-----ND----GMKLQS
A0A6N4SMW4_CYTH3      RDACNRLDL-TEDEVVILSSIVYSETKQRSEMSTIAGVYINRL-----HD----NMKLQS
F4KL00_PORAD          TALAQEIGL-TPVEVSIVASIVEEESSKTDEYSDIAGLYINRL-----RK----GMALQA
Q8AAN3_BACTN          LAQATAIGM-TPEEVCTLASIVEEETNNNEEKPMVAGLYINRL-----HT----GMPLQA
G2Z4P8_FLABF          IAKAQQQQL-TPIQATILASIVHKESVKKDERPRIAAVYLNRL-----KL----EMPLQA
C7M7P7_CAPOD          KAQAQKQGL-TPIEVSILASIVQKETAKVDERPRIAGVYLNRL-----RI----NMKLQA
L7WC83_NONDD          RAKAAKQDL-TPTEVYTLASIVQKETAKVDEMPRVAGVYLNRL-----SR----GIKLDA
D5BKJ7_ZUNPS          LQRAEEIGL-TPAQVITMASIVQKETAKVDERPRVAGVYMNRY-----KN----GWKLDA
G0LCU6_ZOBGA          LAKAKKLGL-SPEEVITLASVVHKETAKVDERPRVAGVYLNRL-----QR----GILLQA
F9YQ52_CAPCC          IEKAKKQSL-TPKQATVLASIVQKETAQVSERKRVAGVYLNRL-----KM----NMLLQA
E4RY37_LEAB4          KAKAESIAL-SPDQVGILASIVQSETNKKDEMPVVAGVYMNRL-----RI----GMPLQA
A0A6N4SPZ0_CYTH3      KEQAQAAGL-TPIQVSILASIVEAETNMNTEKPTVAGVYINRL-----NI----NMPLQA
D2QPT3_SPILD          QAKAKALGL-SQTQTQILASIVAAETNKRDEQPRVAGVYLNRL-----KR----GIKLEA
Q2RZI9_SALRD          AAGADSLGL-TKREVVTLASIVEWEALVDAEKPAIAGVYLNRL-----TR----GWPLQA
D1CC01_THET1          IQGFKRQGL-TINEGLTLASIVEREAQIPSERPIIASVYLNRL-----RK----GMPLQA
B3EQD0_CHLPB          KAVSSLKGL-DELALLTLASIVEAETPLDAEKPLIAGVYLNRL-----RK----NMKIQA
Q8KAE0_CHLTE          KQEAKQAGL-DEHQLLTLASIVEAETPLDEEKPVIASVYLNRL-----KK----NMRLQA
D4H8I5_DENA2          DEKAEKLGL-TRYQAVILASIIQKETYDPLEAPLIASVFHNRM-----KY----RMRLQA
B0SRD8_LEPBP          -PEAKGIKPADLHFRVVLASIVEREAVRKEERPMMAGVFLTRI-----EK----NINLES
C6XF53_LIBAP          EIRDVDHPIKSKEDLVILASIVEKETSRADERAHVASVFINRF-----SK----SIRLQS
G2KT77_MICAA          PTRDPGLPFDTIEQAVTLASIVEKETGIGDERKRVAGVFINRL-----RM----NMPLQS
Q2W5G2_MAGSA          VARAPGLPLKSKDEALILASMVERETAVDAERAKVAAVFYNRL-----AK----GMRLQS
Q0AQC6_MARMM          ETRAENLPVTSREEAIILASVVEKETGVASERPEVAAVFVNRL-----RR----GMRLES
Q9A7P1_CAUVC          ADRASNLPFSTKEEAVILASIVEKETGLAEERPRVAAVFVNRL-----RT----GMRLGS
Q89MV6_BRADU          ERRSQDIPVKTPEQLVTLASIVEKETGKPDERSRVAAVFVNRL-----KQ----KIKLQS
Q984T1_RHILO          QRRAPDLPLANIEDFVTLASIVEKETGKGDERSRVAAVFLNRL-----AK----GMRLQS
A0L8T6_MAGMM          QKRPAEHPL-SAYESLILASIVEKETAAAAERPQIAGVFFNRL-----AR----KMRLQS
Q6F9B4_ACIAD          QKRARDLPYKNKYEALIMASIIEKETSIDSELEQVSGVFVRRL-----RL----GMRLQT
Q83E36_COXBU          QQRADNLPYKNPYQALILASLVEKETALPKERPKIAGVILRRL-----KK----GMPLQV
Q4FVE0_PSYA2          ENRAPNLPYQSPYEALVMASIIEKETSVEEERPLVSAVFNNRL-----NK----SMRMQT
MLTG_ECOLI            EGRADGLPYKDKNQLVTMASIIEKETAVASERDKVASVFINRL-----RI----GMRLQT
MLTG_HAEIN            NERDEDLPLANPYEMLILASIVEKETGIANERAKVASVFINRL-----KA----KMKLQT
K4KG43_SIMAS          EDRAPDLPYQSPYEALIMASIVEKETAIDAEREEIAGVFVRRL-----KK----NMRLQT
Q5P0G4_AROAE          ETRNPDLPLASPYEALILASIVEKETGRAEDRTLIASVFVNRL-----RS----GMRLQT
B2JGP6_PARP8          AARAPGLPYKTPYDALTMASIVEKETGKASDRAMVAGVFANRL-----RA----GMPLQT
Q47DZ4_DECAR          AGRAAGLPYKTSNDALIMASIVEKETGRESDRELVAAVFVNRL-----RK----GMLLQT
Q15U02_PSEA6          QHRDQNVPYATPYEALIMASIIEKETALGEERSRIAGVFVNRL-----RL----NMRLQT
B1KQM6_SHEWM          AGRADNLPLKSPYELLIMASIIEKETGKASERPWISAVFINRL-----NK----GMRLQT
Q081H8_SHEFN          EGRDPDLALSSPYELLIIASIIEKETGKPEERDWVSAVFNNRL-----KK----GMRLQT
G2LIP6_CHLTF          RQQAEARRL-TLREVVTLASMIEKEAADDAERPLVASVFHNRL-----RK----GMRLEC
B2KD01_ELUMP          QPEFMG-GL-TERQVITIASIVEREAVVHDERPKIAAVYLNRV-----KT----GMRLEA
H6LCJ6_ACEWD          LARTKEMNK-TVDEIVIMASIVELETKLVEDKANAASVFYNRI-----AD----GMPLQS
F3YWT8_DESAF          PQGLPEPR--KLHELVVLASLVEKETGAPAERPRIAGVYANRI-----ER----GMRLQC
E8V3R9_TERSS          VTG-------NVSRMVTMASLVEKEVHIDSERPMVAGVFENRL-----RV----GMPLAT
E1QKM5_DESB2          EQRASAQKL-GMAQTVTLASIIEAEAKLANERPLISAVYHNRL-----RA----GMLLQA
Q2RI00_MOOTA          PQKDKDVEF-NIRQIVTLASIVEREAKLDNERPLIAGVFINRL-----RR----GMRLES
B1XPB4_SYNP2          DAEIVPLDL-SLTEWVTLASIVEKEAVIPEERPLIAGVFVNRL-----EQ----GMRLET
Q2JJE1_SYNJB          RQHTTS--L-SLHEWVTLASIVEREAVVPEERALIAGVFLNRL-----KK----GIPLGA
C5CCG3_MICLC          VRDPAEQ-----QRVLTIASILEAEALP-QDYQQVAGAIVNRLAPDNTET----HGLLQI
Q83GD3_TROWT          -----GIPSENVWRTVVLAALIQKE-GIPSDFARVSRVFVNRL-----ER----GMNLQS
A8LCW6_FRASN          LVGRAEAGHVKPQDVVIIASIIEKEVANEGEGPKVARVIYNRL-----NDTSGRFRRIDM
E3DAS9_GARV3          VPKGK-----LRQDILKIASIAEAEVNNREYYGKVSRVILNRL-----AK----DMPLGM
D7BNS1_ARCHD          IPRD------RWQRTLIVASIVEREVNWPDYYGQVARIIENRL-----VDTSQVNGKLQM
F5XH31_MICPN          LTSQAKKLKRSPRDLVIVASILEAEVRGEGDRAKAARVIYNRL-----DK----GEPLGL
B1MCF7_MYCA9          LLSSDAAGL-SPYQVLVVASLLQREA-KPRDFAKVARVVYNRL-----AK----HQKLEF
A1T8F0_MYCVP          LLDAAAAVNMSPYQILTVASLVQREA-TPEDFSKVARVIYNRL-----AE----RRTLEF
A1UFI5_MYCSK          LLETATAMNLSPYQVLTVASLVQRES-KPEDFAKVARVIYNRL-----AE----NRTLEF
Q741L1_MYCPA          LVDTAQAMGLSPYDILVVASLVQQESNTP-DFAKVAQVIYNRL-----HA----HHTLEF
B2HNC3_MYCMM          VDNAKSLGL-SPYDILVVASLVQQES-NAQDFPKVARVIYNRL-----NE----HRALEF
C3PGN0_CORA7          VDRAQAIGL-KPYELLTAASLVERESPA-GEFDKVARVILNRL-----DE----PMRLEL
B1VDL6_CORU7          LLKAADAVGLSAYEMITAASLVEREAPA-GAFDKVARVILNRL-----KE----DQRLEF
F8E313_CORRG          LVSAASKIGLNPYEMVTAASLIEREAPA-NDFDKVGRVILNRL-----KI----NQKLEF
A0A059VSS5_STRA9      ESNAKKFHLDSPLQLITVASLTQAEGMTHDDFRKMAAVVYNRLAPTNTAT----NQKLEF
Q1J1B4_DEIGD          RAKARSLGL-SVREWVILASMVQAEAAGDSEMPVIAGVFLNRL-----EE----GIPLGS
Q9RRE0_DEIRA          VAKAKALGL-DVRDWVTLASMVQAEAANNEEMPVIAGVFLNRL-----RD----GIPLGS
H8GUR8_DEIGI          VAKAKALNL-SVRDWVILASMVQAEAANDGEMPVIAGVFVNRL-----RD----GIALGS
C9ZG10_STRSW          VTAGAQRNAMNVYQAVTIASIVQAEAATEKDMGRVARVIFNRL-----ER----GMPLQM
H2K1I7_STRHJ          VAAGAQRNAMNVYQAVTVASIVQAEASTKADMGKVARVIFNRL-----NS----GMPLQM
                                        :::   *          .     *               :  

R5L1J0_9CLOT          QSTTDY----------INNK-VAPALS--STSAHTA-----DYYLQYYNTNSDSTVVGLP
G8QS85_SPHPG          DATTRY----------ELND-W-------EKPIPSS-----A-LEQQ-TPYNTRRKTGLP
F0RYF2_SPHGB          DATTRY----------ELDD-W-------VNPIPTH-----A-LETK-TPYNTRRKVGLP
H8MKU3_CORCM          DATSRY----------ELAE-WN------DRKAFLK-----R-LRDNSDPWNSRTRAGLP
A8EUE6_ARCB4          DGTLNY----------GKYS---------NSVVTAD-----R-IREDTSSYNTYLNAGLP
Q0PAY7_CAMJE          DGTLNY----------GIYS---------HVKVTPQ-----R-IRQDNSSYNTYKFTGLP
D1B1Z4_SULD5          DGTLNY----------GEYS---------HTKVTPK-----R-IKEDTSPYNTYMHKGLP
E0USJ7_SULAO          DGTLNY----------GKYS---------HQRVTSY-----R-IKNDTTSYNTYKHRGLP
H1FSQ2_SULGG          DGTLNY----------GEYS---------HIKITPK-----R-IREDDSIYNTYKNRGVP
Q30RQ7_SULDN          DGTLNY----------GQYS---------HVKVTPA-----R-IKEDTSTYNTYLNSGLP
D3UGW5_HELM1          DGSLNY----------DKYS---------HQKITPD-----R-IRQDNSTFNTYKNKGVP
F8KP83_HELBC          DGSLNY----------GKYS---------HTKVTRE-----R-ILEDTSSYNTYKHKGLP
E6UAM5_RUMA7          DTTYNY--------------------I--EKVIKTQESNEAT-IDHYIEYYDTYAIDGLP
A6LSG3_CLOB8          DAAVIY----------ALGY-H-------VDVVLNK-----H-LEVD-SPYNVYKYKGLP
MLTG_STRP2            NIAILY----------AQGK-L-------GQNISLAEDVAID-TNID-SPYNVYKNVGLM
MLTG_BACSU            DPTVLY----------AAGK-H-------KDRVLYK-----D-LEID-SPYNTYKNTGLT
Q8Y725_LISMO          DPTVLY----------ALGE-H-------KSKTTYK-----D-LEVD-SPYNTYKNNGLP
G4L8R7_TETHN          DISILY----------ALGE-H-------KETVTYE-----D-LEVD-SPYNLYQNVGYG
Q74IE3_LACJO          DISVMY----------ALNK-H-------KHSLSLK-----D-IKVK-SPYNLYVHKGYG
E6TVA9_BACCJ          DPTVAY----------AHGE-H-------LSRTTYD-----H-LEIE-SPYNTYHVTGIP
C4L555_EXISA          DPTVWY----------GTGE-T-------SIFTSFA-----D-LEND-SLYNTYRYEGIP
A0A6N4SMW4_CYTH3      DPTVLF----------AHTS-M----D--SRRVSNK-----H-LAIE-SDYNTYLKKGLP
F4KL00_PORAD          DPTLKF----------ASGNFT-------AQRIGGE-----L-LKAD-SPYNTYKYKGLP
Q8AAN3_BACTN          DPTIKF----------ALQD-FG------LRRITNE-----H-LKVN-SPYNTYINSGLP
G2Z4P8_FLABF          DPTVIF----------ALKK-NANDFDQVIKRVLYD-----D-LKMA-SPYNTYLNLGLP
C7M7P7_CAPOD          DPTAIF----------AMKN-HTGDYNMVIKRVTEV-----H-TSLQ-NPYNTYRNYGLP
L7WC83_NONDD          DPTVIY----------AKKK-SENDFDQQIKQVLYK-----H-LEID-NPYNTYKYSSLP
D5BKJ7_ZUNPS          DPTVIY----------AIKE-KTQNFDTIIKRVLYK-----D-LELD-SPYNTYKYATIP
G0LCU6_ZOBGA          DPTVIY----------ALKK-HTGNFKAVIKRVLYK-----D-LELD-SPYNTYKYAGLP
F9YQ52_CAPCC          DPTVIF----------AIKE-HTGNYDTIIKRVLYK-----D-LEIN-SPYNTYKYPGLP
E4RY37_LEAB4          DPTVKF----------AVGD-FS------LKRILHK-----H-LSID-SPYNTYKNTGLP
A0A6N4SPZ0_CYTH3      DPTVKF----------ALGD-FS------IKRINHD---LID-AAGN-SPYNTYRVTGLP
D2QPT3_SPILD          DPTVIF----------ALRD-FT------IRRLLNK-----Q-LTVD-SPYNTYRYAGLP
Q2RZI9_SALRD          DPTIQYVLLD------TKGA-R-------VTRVLYE-----H-LEID-HPYNTYQNQGLP
D1CC01_THET1          DPTVQYAVG-------KRGE-W----W--KSPLTRQ-----D-LKSD-SPYNTYVHKGLP
B3EQD0_CHLPB          DPTVQY----------ALGG-E-------PRRLLYK-----D-LSID-SPYNTYKYKGLP
Q8KAE0_CHLTE          DPTVQY----------AIPG-E-------SRPLHYK-----D-LAID-SPYNTYRHAGLP
D4H8I5_DENA2          DPTIIY----------GLYP-E----F--DGNIRKT-----D-LRDRSNPYNTYKINGLP
B0SRD8_LEPBP          CATIQY----------LFDK-P-------KKRLFES-----D-LKIV-SPYNTYINGGWP
C6XF53_LIBAP          DSTVIY----------GILE-GDYDLT--NRKISRS-----D-FSIK-TPYNSYLMNGLP
G2KT77_MICAA          DPTVIYAITKGDMKDDGMGP------L--GRRLLRK-----D-LTDTDSPYNTYKYPGLP
Q2W5G2_MAGSA          DPTVIYGVSE------GLGE-L-------DHPLTRA-----E-LQTN-HPWNTYTIDGMP
Q0AQC6_MARMM          DPTIIY----------GISQ-G----RPLGRGLRRS-----E-IDNTENAWNTYQIPRLP
Q9A7P1_CAUVC          DPTIIY----------GISR-G----RPLGRGIFLS-----E-LRRL-TPYNTYLIDGLP
Q89MV6_BRADU          DPTIIY----------GLVGGK----GTLGRPIKRS-----E-ITQP-SPYNTYVIEGLP
Q984T1_RHILO          DPTIIYGLFG------GKGK-P----A--DRPIYQS-----D-IQKQ-TPYNTYVISGLP
A0L8T6_MAGMM          DPTVIY----------GIAD-Y-------RGNITRT-----H-LRTL-TPYNTYMIQGLT
Q6F9B4_ACIAD          DPTVIY----------GMGD-R----Y--QGKISRE-----D-LRTA-TAYNTYTMAGLP
Q83E36_COXBU          DPTVLY----------GLGR-P----Y--GSPITKE-----D-LVSN-SPYNTYQHYGLP
Q4FVE0_PSYA2          DPTIIY----------GMGS-R----Y--EGNIRRK-----D-IDEK-TRYNTYQIDGLP
MLTG_ECOLI            DPTVIY----------GMGE-R----Y--NGKLSRA-----D-LETP-TAYNTYTITGLP
MLTG_HAEIN            DPTVIY----------GMGE-N----Y--NGNIRKK-----D-LETK-TPYNTYVIDGLP
K4KG43_SIMAS          DPTVIY----------GMGS-R----Y--QGNLRKK-----D-LQTA-TPYNTYVIKGLP
Q5P0G4_AROAE          DPTVIY----------GQGN-A----F--DGNLRKR-----D-LETD-HAYNTYTRTGLP
B2JGP6_PARP8          DPTVIY----------GMGD-S----Y--TGHLRKK-----D-LQTD-TPYNTYMRMGLP
Q47DZ4_DECAR          DPTVIY----------GIGE-K----F--DGNLRKR-----D-LLTD-TPYNTYTRPGLP
Q15U02_PSEA6          DPTVIY----------GIED-F-------DGNITRK-----D-LRQA-TPYNTYVIKGLT
B1KQM6_SHEWM          DPTVIY----------GMGE-S----Y--KGDITRK-----A-LREM-TPFNTYRINGLT
Q081H8_SHEFN          DPTVIY----------GMGE-R----Y--KGNITRK-----D-LREA-TAFNTYKIDGLP
G2LIP6_CHLTF          DPTFIYAA--------KLNG-T----W--DDNVNNP-----A-HRRLLSPYNTYLSPGLP
B2KD01_ELUMP          DPTVQY----------ALGY-TPSENRFWKKGLTLA-----D-LRKD-MPYNTYKRKGIP
H6LCJ6_ACEWD          DITVDY----------ARGE-K-------TAVLTTA-----E-TQYE-SPYNTYLHTGLP
F3YWT8_DESAF          DPTIIY----------GLGE-S----F--DGNIRKA-----HLLDAD-NPYNTYRINGLP
E8V3R9_TERSS          DPAVAYAA--------MLDG-R----W--RGTIYAS-----D-LANL-NPYNTYRHAGLP
E1QKM5_DESB2          DPTVIY----------GLGG-L-------KRPLNRA-----D-LAVD-TPYNTYLRPGLP
Q2RI00_MOOTA          CATVEY----------LLPA-P-------KPVLSYQ-----D-LQID-SPYNTYRVKGLP
B1XPB4_SYNP2          DPTVEY----------GLGI-R----QTKEQPLTLE-----Q-VRTP-NPYNTYLNEGLP
Q2JJE1_SYNJB          DPTLEY----------ALNI-R----QTPDRRLTLT-----E-VRTP-SPYNTYLNPGLP
C5CCG3_MICLC          DATVTY----------GLGV-R-------SLSFTSG-----Q-RQDASNPYNTYVHPGLP
Q83GD3_TROWT          DATVLY----------GLKL-S-------GQVVTTD-----EQREDKGNPYNTYVHAGLP
A8LCW6_FRASN          DSTTRY----------ALDE-Y-------EGPLTQD-----Q-LRQN-NPYNTRAVEGLP
E3DAS9_GARV3          DTTVAY----------GIGI-K-------AINLTQA-----Q-LDDASNPYNTRIRKGLP
D7BNS1_ARCHD          DSTTMY----------GVGK-F-------GGIPTEA-----E-LKND-NPYNTYIHAGLP
F5XH31_MICPN          DSTVIY----------AENL-K-------TNTTTPK-----D-RASN-SPYNTYKVKGLP
B1MCF7_MYCA9          DSTVNY----------PLDR-Q-------EVATTDE-----D-RERK-TLWNTYVSQGLP
A1T8F0_MYCVP          DSTVNY----------PLDR---------IEVATTD-----G-DRAQLTPWNTYVRPGLP
A1UFI5_MYCSK          DSTVNY----------PLDR---------IEVATTD-----G-DRGQMTPWNTYVRPGLP
Q741L1_MYCPA          DSTVNY----------PLDR-R-------EVATSDA-----D-RGQK-TPWNTYVSQGLP
B2HNC3_MYCMM          DSTVNY----------SLDR-R-------EVATSDA-----D-RAMR-TPWNTYMSEGLP
C3PGN0_CORA7          DSTVNY----------GLED---------VELATTD-----E-DRHRETPWNTYAKDGLP
B1VDL6_CORU7          DSTVNY----------DVAE---------QEVATTD-----D-DRARRTPWNTYAKKGLP
F8E313_CORRG          DSTVNY----------SLSE---------QEVATTD-----A-DRKRITPWNTYAKQGLP
A0A059VSS5_STRA9      DSTFNY----------LKNQ-S-------KINISTQ-----E-IRHYDDPYNTYFYRGLP
Q1J1B4_DEIGD          DPTVAY----------GLGK------NLPQLDRSAG-----D-FTRD-TPYNTYTRQGLP
Q9RRE0_DEIRA          DPTVAY----------GLGK------DLPELDRSAG-----D-FKVD-TPYSTYTRQGLP
H8GUR8_DEIGI          DPTVAY----------GLGK------DLPDLDRSAG-----D-FTKD-TPYSTYTRMGLP
C9ZG10_STRSW          DSTINY----------ALNR-S-------TLDTSVN-----D-TKID-SPYNSYRRMGLP
H2K1I7_STRHJ          DSTLHY----------ALNR-N-------TADTSQS-----G-TQEE-NPYNSHQRTGLP
                        :  :                                             .        

R5L1J0_9CLOT          EGPICNPGLAAIEAVLNPA-----DT-DDYFFFHD-MD------GNLYTAETYSEFRTLI
G8QS85_SPHPG          PSGISSPSLQAIEAACFPQ-----ST-DYFYYLHG-TD------KAIHLAKTYEEHKRNI
F0RYF2_SPHGB          PSGICSPSPEAVHAAFFPA-----DT-PYFYYLHD-EN------KQIHFALTYEQHKENI
H8MKU3_CORCM          PGPIGAPTVDSLLAALRPV-----KS-DYWYYLHD-AQ------KVLHPSRNAQEHEALR
A8EUE6_ARCB4          KDPICAVSLDSIKAAIFPV-----KS-NYLYFVRD-NRT-----GLHKFASTFEEHQVNI
Q0PAY7_CAMJE          KEAVCNVSLAAIRAAIFPL-----KT-DYLYFVRD-KNT-----GVHIFSTNIDDHNKAI
D1B1Z4_SULD5          PYPVCSVSKEAIFAAIFPK-----TT-NYLYFVKN-KN------GTHTFSQNYETHLENI
E0USJ7_SULAO          DTPVCNVSIEAIKAAIFPK-----KT-NYLYFMKS-KN------GMHDFACNYSTHLRNI
H1FSQ2_SULGG          EIPVCNVSFDAIRAAVFPA-----NT-DYLYFMKS-KS------GGHDFSCNYSTHLSNI
Q30RQ7_SULDN          ESPVCNVSINAIRAAIFPA-----KS-DYLYFMRS-KK------GTHDFSCNYSTHLDNI
D3UGW5_HELM1          KSPVGSVSIQAIKAAIHPA-----KV-DYLYFVKN-KE------GTHTFSKTYEEHKNHI
F8KP83_HELBC          KDPVGSVSEPAIKAALFPA-----KT-KYLYFVKN-KA------GVHVFSQHYRDHVRNI
E6UAM5_RUMA7          AGPICNPGMDAIKAVLDPA-----ET-NYYYFCND-LET-----GETFYAETLDEHEKNL
A6LSG3_CLOB8          VGPIANPGLDCIKAALLPE-----KT-DYLYYIMK-DD------GSHYFTNNYEDFLNKK
MLTG_STRP2            PGPVDSPSLDAIESSINQT-----KS-DNLYFVAD-VTE-----GKVYYANNQEDHDRNV
MLTG_BACSU            PGPIANAGMSSWEAALHPD-----KT-DYLYFLAK-SN------GEVVFTKTLKEHNKAK
Q8Y725_LISMO          PGPISNSGDSSMEAALYPE-----KS-DYLYFLANTKT------GKVYFSKTLEEHNKLK
G4L8R7_TETHN          PGPFDNPSEDSIDAVLNPT-----DN-DYYYFVADVST------GEVYYAETYEEHNELI
Q74IE3_LACJO          PGPFNNPSLDSISAVLNPI-----KS-NYLYFVAN-LKT-----GKVYYNENYDEHLKRN
E6TVA9_BACCJ          IGPINNPGEASIRAALLPE-----DH-FYLYFYHS-PN------GDVYFTETLAEHEAVV
C4L555_EXISA          IGPIAAVSRDAFEAVLNPN-----DT-ENIYFYAR-PPREGFPNGEVLFEVDYEDHQQNV
A0A6N4SMW4_CYTH3      PGPICIVPTFVIDEVLKYD-----SH-KYYYFCAK-GDK----SGCHNFATNYNEHMANA
F4KL00_PORAD          PGPIRYPQMTTLDAVLHHT-----AH-DYLYMCAR-ADF----SGYHAFAANYADHMRNA
Q8AAN3_BACTN          PGPIRIPSKKGLDSVLNYT-----KH-NYIYMCAK-EDF----SGTHNFASNYADHMANA
G2Z4P8_FLABF          PGPIAMPDITALEAVLNPE-----KN-DYLFFCAS-VSR----FGYHEFATTLAEHDVNR
C7M7P7_CAPOD          VGLITMPDISSIEAVLNPE-----QH-DYLFFVAD-TEN----YGYHKFSRTYMQHLQGK
L7WC83_NONDD          PGPIVTPDLTAVNAVLNPE-----KH-NYLYFVAD-VEN----FGYHKFAKTLAQHNRNA
D5BKJ7_ZUNPS          PGPISMPDISSIEAVLNYE-----DH-DYFYFVAN-VEN----FGYHKFAKTLAQHNRNK
G0LCU6_ZOBGA          PGPIAMPDISAIDAVLNPE-----KH-DYLYFVAN-VEN----FGYHKFAKTLAQHNRNK
F9YQ52_CAPCC          PAPIAMPDISSIEAVLDPE-----KH-DFLFFVAD-PEN----FGFHKFARTLAQHNKNK
E4RY37_LEAB4          PGPIALPERVALDAVLNYQ-----KH-NYTYFSAK-EDF----SGYHNFAENFNEHIKNA
A0A6N4SPZ0_CYTH3      PGPINMPSITTIDKVLNYE-----SH-NYLFFVAD-PKK----PGYHIFNADYRSHVNKA
D2QPT3_SPILD          PGPINLPAPGTIDAVLNAE-----QH-DYLYFVVN-ASF----NGYHTFSKTLAEHLANA
Q2RZI9_SALRD          PGPITNPSPSSLRAAARPE-----RH-EYLYFAAD-GT------GGHTFSRTLREHNRAA
D1CC01_THET1          PGPICSPGLPSIKAVAYPA-----HT-DYLYFVAK-GD------GSHAFAKTLQEHEQNI
B3EQD0_CHLPB          PAPIGSPGAASIMAVLYPA-----ET-DYLYFVAT-GN------GGHNFAKTAGEHAENV
Q8KAE0_CHLTE          PGPICNPGAASIRAVLSPA-----NT-GYLYFVAT-GQ------GGHAFATTLAEHARNV
D4H8I5_DENA2          PTPICSPSIVALEAAVNPA-----DT-KYLYFVAD-KE------RKHIFSTNYDEHMRQV
B0SRD8_LEPBP          PGPISNPGLPALEASFKPM-----KS-DKLFFLLK-PD------GSHYFSSTFKEHLDAK
C6XF53_LIBAP          PTAISNPGRLSLEAVAKPL-----HT-EDLYFVGD-GK------GGHFFSTNFKDHTINV
G2KT77_MICAA          PGPIANPGKASIDAVLHPE-----QH-NYIYFVAD-GE------GGHVFARTLTEHQNNV
Q2W5G2_MAGSA          KTPIANPGRASLEAVLHPA-----KT-DALYFVAD-GT------GGHAFARTLDEHNANV
Q0AQC6_MARMM          PTPIANPGAESIAAVLNPA-----ES-TALFFVAD-GS------GGHAFADTYAQHQRNV
Q9A7P1_CAUVC          PTPIANPGRAALAAVMNPP-----KS-EDLYFVAD-GT------GGHVFARTLEEHNANV
Q89MV6_BRADU          PGPISNPGRASLEAAANPA-----RT-RDLYFVAD-GT------GGHAFTETYDAHQKNV
Q984T1_RHILO          PTPIANPGRAALEAVANPS-----KT-DDLYFVAD-GA------GGHVFAATLDEHNENV
A0L8T6_MAGMM          PTPICSPGADAITAVFHPL-----KS-RALYFVAR-GDG----SGTHMFAQSVAEHNRNV
Q6F9B4_ACIAD          PTPIALPGKKAIAAAMHPD-----QS-DNIYFVAT-GN------GGHKFSANLQDHNQAV
Q83E36_COXBU          PTPIDMPSRASILAALKPE-----SG-DALYYVAR-GD------GSHIFSATYKEHKEAI
Q4FVE0_PSYA2          PTPIALPSAASIEATLHPA-----KS-EALYFVAT-GN------GGHKFTNSLTEHNQAV
MLTG_ECOLI            PGAIATPGADSLKAAAHPA-----KT-PYLYFVAD-GK------GGHTFNTNLASHNKSV
MLTG_HAEIN            PTPIAMPSESSLQAVANPE-----KT-DFYYFVAD-GS------GGHKFTRNLNEHNKAV
K4KG43_SIMAS          PTPIALAGARSLYAALHPD-----AG-SSLYFVAK-GD------GYHQFSDTLEEHNRAV
Q5P0G4_AROAE          PTPIAMPGLDALLAAVRPP-----TT-DYLYFVSR-GD------GTSEFSTNLNDHNKAV
B2JGP6_PARP8          PSPIALPGVASLQAALNPA-----PT-SALYFVSR-GD------GSSIFSDTLGDHNKAV
Q47DZ4_DECAR          PTPIAMPGQASIRAALNPA-----PS-DVIYFVAR-GD------GSSEFSRTLDEHNRAV
Q15U02_PSEA6          PTPIAMPSKLAINAALNPL-----AT-DELYFVSK-GD------GSHHFSETLQEHNRAV
B1KQM6_SHEWM          PTPIAAPSGAALLAAAHPA-----EV-NYLYFVSK-ND------GSHIFSRTLVEHNRAV
Q081H8_SHEFN          PTPIAAPSRASLFAAANPA-----KV-NYLYFVSR-ND------GSHVFSSTLKAHNNAV
G2LIP6_CHLTF          PGPIASPGEKSLRAALQPA-----QT-EYLYFVLG-PG------GRHRFSRNEAEHQVAV
B2KD01_ELUMP          PGPICSPSMESVYAVLHPE-----ENFDKLFFVAE-NDE-----GRHVFSKTYDEHVRNI
H6LCJ6_ACEWD          FGPICSFGETSLEAALYPA-----NT-NYLYFVAD-MET-----GKIHFNETYEEHLADV
F3YWT8_DESAF          PGPIASPGLESLKAAAEPE-----KH-AYLYFVSR-QD------GTHQFSKTLEEHNAAV
E8V3R9_TERSS          PGPICSPGMAALRAALHPM-----QT-DNLYFVAD-AA------GHTRFSATLQEHAAQV
E1QKM5_DESB2          PGPICNPGLASLEAAVAPA-----TV-DYLYFVAK-GD------GGHAFSADYRDQVKAI
Q2RI00_MOOTA          PGPIANPGRASLLAVLKPN-----QT-DYLYFVAK-PD------GSHYFSSTLAEHNQAT
B1XPB4_SYNP2          PGAIASPGLASFRATSNPE-----AT-DFLFFVAN-YD------GTHVFSETLAEHEAAT
Q2JJE1_SYNJB          PGPIASPGLASLKAVLQPE-----QT-DYLYFVAR-YD------GTHVFSKTLAEHEAAQ
C5CCG3_MICLC          PGPIGMPSDAAVEAALDPA-----ET-DAYYWVTT-DIG----TGHTEFSRTYEEHQQHV
Q83GD3_TROWT          PGAISNPGAAALKAAIYPA-----PG-KWLFFVTW-NEC----TGETIFSETFSEHQKGV
A8LCW6_FRASN          PGAISNPSTWAIESALSPA-----QG-SWFYFVSM-PQT-----HETVFATTDAEFQDAL
E3DAS9_GARV3          PTPISIPGDNAILASLNPE-----KG-SWIYFVTT-NLK----TGETKFADNYDDFLKIR
D7BNS1_ARCHD          PYPISNPSQEVIEASANPP-----AG-DWLFFVTT-NLE----TGETLFANNIDDHSKNV
F5XH31_MICPN          PGPINAPGKAALESAANPA-----DG-DWMYWVTV-NYD----TGETKFAKTLAEHNKYV
B1MCF7_MYCA9          GTPISSPSPEALQAAERPE-----SG-DWLYFVTI-DAE-----GTTLFTADYNEHLANI
A1T8F0_MYCVP          ATPICSPSQAALVAAENPE-----PG-DWLYFVTV-DMQ-----GTTLFTREYEQHLANI
A1UFI5_MYCSK          ATPICSPSQPALVAAEKPA-----EG-DWLYFVTI-DLQ-----GTTLFTRDYNEHLANI
Q741L1_MYCPA          ATAICSPGIDALHAAEHPA-----PG-DWLYFVTI-DAA-----GTTLFTKDYQQHLANI
B2HNC3_MYCMM          ATAICSPGVEALHAAEHPQ-----PG-DWLYFVTI-DSQ-----GTTLFTRDYQQHLANI
C3PGN0_CORA7          DSPIASPSEEAIQAMENPA-----EG-NWLFFVTV-DDK-----GTTVFTDNYDEHLANV
B1VDL6_CORU7          ETPIASPGIQALQAMEHPA-----EG-DWLYFVTI-NKD-----GETVFNRDFDAHEAAI
F8E313_CORRG          DTPIASPGLKALHAIENPA-----PG-DWLYFVTI-DKD-----GTTVFNRDFAEHEKAI
A0A059VSS5_STRA9      PGPIGNPGADALKATINPD-----NSDKWLYFISV-DG------KKTDFTTNYADHEKLV
Q1J1B4_DEIGD          PTPINNPGQAALLSVLNPQRKLPDGR-AALYFLHG-LN------GKIYVNHDYAAHLRDV
Q9RRE0_DEIRA          AGPINNPGEAALLSIVNPQRKMADGR-DALYFLHA-G-------GKIYVNHTYAEHLRDN
H8GUR8_DEIGI          AGPINNPGQAALLSVINPKRTMQDGR-DALYFLHA-G-------GKIYVNHTYAEHLSDN
C9ZG10_STRSW          PTPIANPGVAAMRAAVSPT-----SG-DWLYFVTV-KP------GDTRFTANYQEHLRNV
H2K1I7_STRHJ          PTPIDNPGEDAMRAALNPT-----PG-DWLYFVTI-AP------GETRFTADYNTHLRNV
                         .                          :                             

R5L1J0_9CLOT          QR-Y----APYLSY----------------------------------------------
G8QS85_SPHPG          EK-Y----L---------------------------------------------------
F0RYF2_SPHGB          KQ-Y----R---------------------------------------------------
H8MKU3_CORCM          AK-Y----NVY-------------------------------------------------
A8EUE6_ARCB4          QA-NVGVAKTYTKVKAVETQIDEEAQNIMKTDISNQKPTSIKDLFNNIN-----------
Q0PAY7_CAMJE          NL------QKGK------------------------------------------------
D1B1Z4_SULD5          RN----------------------------------------------------------
E0USJ7_SULAO          RR-A----TK--------------------------------------------------
H1FSQ2_SULGG          KH-V----TK--------------------------------------------------
Q30RQ7_SULDN          SR-A----TK--------------------------------------------------
D3UGW5_HELM1          ---H--------------------------------------------------------
F8KP83_HELBC          HL-S----NP--------------------------------------------------
E6UAM5_RUMA7          VKAG----RSDQVVDDNVEDNNE-------------------------------------
A6LSG3_CLOB8          KE-L----GY--------------------------------------------------
MLTG_STRP2            AE-H----VNSKLN----------------------------------------------
MLTG_BACSU            EK-Y----ISSKNEK---------------------------------------------
Q8Y725_LISMO          EE-H----ITKNN-----------------------------------------------
G4L8R7_TETHN          DE-H----MDN-------------------------------------------------
Q74IE3_LACJO          SS-L----GQ--------------------------------------------------
E6TVA9_BACCJ          GQ-Y----Q---------------------------------------------------
C4L555_EXISA          NK-Y---RSEWEAFEEANSN----------------------------------------
A0A6N4SMW4_CYTH3      KK-Y----RNGLDKKKIYK-----------------------------------------
F4KL00_PORAD          RA-Y----QKALDERGITE-----------------------------------------
Q8AAN3_BACTN          RK-Y----WKALNERKIFK-----------------------------------------
G2Z4P8_FLABF          KK-Y----TDWVSSKGINR-----------------------------------------
C7M7P7_CAPOD          KQ-Y----TRWVDDKGIK------------------------------------------
L7WC83_NONDD          AA-Y----RRWIAKNNR-------------------------------------------
D5BKJ7_ZUNPS          QE-Y----IRWINKKGIKR-----------------------------------------
G0LCU6_ZOBGA          AQ-Y----VQWINSQKIKR-----------------------------------------
F9YQ52_CAPCC          EV-Y----VKWIQSQGIKR-----------------------------------------
E4RY37_LEAB4          QR-Y----QTALNQRGIR------------------------------------------
A0A6N4SPZ0_CYTH3      NQ-Y----RKSLNTRNIH------------------------------------------
D2QPT3_SPILD          RL-Y----QQALTRMQIMK-----------------------------------------
Q2RZI9_SALRD          EK-Y----QRMLDERRSDGRP---------------------------------------
D1CC01_THET1          QR-Y----LRR-------------------------------------------------
B3EQD0_CHLPB          KK-Y----RRARRKP---------------------------------------------
Q8KAE0_CHLTE          QR-Y----RAARKEQQKNPGGGTP------------------------------------
D4H8I5_DENA2          YY-H----QKLNR-----------------------------------------------
B0SRD8_LEPBP          KK-F----IDVLYQ----------------------------------------------
C6XF53_LIBAP          QK-W----RKMSLESKP-------------------------------------------
G2KT77_MICAA          NE-W----RKVRKAKGK-------------------------------------------
Q2W5G2_MAGSA          AR-W----RQIEKAGK--------------------------------------------
Q0AQC6_MARMM          AV-W----RRVERQRRNGGN----------------------------------------
Q9A7P1_CAUVC          VK-W----RQIERERAGKAPAKPAAAPLAGG-----------------------------
Q89MV6_BRADU          AK-L----RAMEKQIQNDTVEPAEDAQPPAAAAPGAADTPTATTPARPNQQKKPPAAPRP
Q984T1_RHILO          AR-Y----RALQKKQADDAAKAAAAAGTNGNADKPATDKPAADKPADGSTGGDNGDAGGD
A0L8T6_MAGMM          KK-Y----LAQLRKNRKP------------------------------------------
Q6F9B4_ACIAD          QQ-Y----LSVLRSKN--------------------------------------------
Q83E36_COXBU          KKVF----RRWRKTWELNAAVSFLLKELKEWGRQPHLIGCGSN-----------------
Q4FVE0_PSYA2          KE-Y----LGVMREKKAQTPPQ--------------------------------------
MLTG_ECOLI            QD-Y----LKVLKEKNAQ------------------------------------------
MLTG_HAEIN            QE-Y----LRWYRSQKNAK-----------------------------------------
K4KG43_SIMAS          KN-Y----QLKRKADYRSVPKNP-------------------------------------
Q5P0G4_AROAE          SQ-Y----QRRTGS----------------------------------------------
B2JGP6_PARP8          DK-Y----IRGQ------------------------------------------------
Q47DZ4_DECAR          NK-Y----QRGGK-----------------------------------------------
Q15U02_PSEA6          RQ-Y----QLNR------------------------------------------------
B1KQM6_SHEWM          NK-Y----QRNR------------------------------------------------
Q081H8_SHEFN          NE-F----QRKRK-----------------------------------------------
G2LIP6_CHLTF          AE-Y----RRLQRAQRPGLHTQLINKK---------------------------------
B2KD01_ELUMP          RR-I----RSNRK-----------------------------------------------
H6LCJ6_ACEWD          KT-Y----MGN-------------------------------------------------
F3YWT8_DESAF          RE-Y----QLRRH-----------------------------------------------
E8V3R9_TERSS          QA-Y----RKATR-----------------------------------------------
E1QKM5_DESB2          NR-Y----RRR-------------------------------------------------
Q2RI00_MOOTA          AR-Y----ESGNGN----------------------------------------------
B1XPB4_SYNP2          QR-I----RATIDGETE-------------------------------------------
Q2JJE1_SYNJB          LQ-IIQERRQAAQGSHHSPQPSP-------------------------------------
C5CCG3_MICLC          RT-L----QRYCASNPGVC-----------------------------------------
Q83GD3_TROWT          DK-W----LRWRKNHPDGKC----------------------------------------
A8LCW6_FRASN          DE-Y----HRQGGAE---------------------------------------------
E3DAS9_GARV3          DE-Y----KRSNENAN--------------------------------------------
D7BNS1_ARCHD          EI-L----RKWYADHQKN------------------------------------------
F5XH31_MICPN          KE-F----QAWCQAKQGRCDS---------------------------------------
B1MCF7_MYCA9          EL-A----KKNGILDSA-R-----------------------------------------
A1T8F0_MYCVP          EV-A----QRNGVLDSA-R-----------------------------------------
A1UFI5_MYCSK          EL-A----QRNGVLDSA-R-----------------------------------------
Q741L1_MYCPA          EL-A----KHNGVLDSTPR-----------------------------------------
B2HNC3_MYCMM          EL-A----KRNGVLDSAR------------------------------------------
C3PGN0_CORA7          DD-A----VRSGILDSQREAVGEQPAEEQ-------------------------------
B1VDL6_CORU7          EK-A----RANGVLDSAR------------------------------------------
F8E313_CORRG          ER-S----RANGVLDSG-R-----------------------------------------
A0A059VSS5_STRA9      QE-F----NKRQQEQKQNGN----------------------------------------
Q1J1B4_DEIGD          AR-Y----R---------------------------------------------------
Q9RRE0_DEIRA          DR-Y----R---------------------------------------------------
H8GUR8_DEIGI          AR-Y----R---------------------------------------------------
C9ZG10_STRSW          AE-F----NQNRRKPSPSLASTPPPSRAAG------------------------------
H2K1I7_STRHJ          AE-Y----QALHQNTGTAQPTGDGPPAPPSAPADAQPALR--------------------
                                                                                  

R5L1J0_9CLOT          --------------------
G8QS85_SPHPG          --------------------
F0RYF2_SPHGB          --------------------
H8MKU3_CORCM          --------------------
A8EUE6_ARCB4          --------------------
Q0PAY7_CAMJE          --------------------
D1B1Z4_SULD5          --------------------
E0USJ7_SULAO          --------------------
H1FSQ2_SULGG          --------------------
Q30RQ7_SULDN          --------------------
D3UGW5_HELM1          --------------------
F8KP83_HELBC          --------------------
E6UAM5_RUMA7          --------------------
A6LSG3_CLOB8          --------------------
MLTG_STRP2            --------------------
MLTG_BACSU            --------------------
Q8Y725_LISMO          --------------------
G4L8R7_TETHN          --------------------
Q74IE3_LACJO          --------------------
E6TVA9_BACCJ          --------------------
C4L555_EXISA          --------------------
A0A6N4SMW4_CYTH3      --------------------
F4KL00_PORAD          --------------------
Q8AAN3_BACTN          --------------------
G2Z4P8_FLABF          --------------------
C7M7P7_CAPOD          --------------------
L7WC83_NONDD          --------------------
D5BKJ7_ZUNPS          --------------------
G0LCU6_ZOBGA          --------------------
F9YQ52_CAPCC          --------------------
E4RY37_LEAB4          --------------------
A0A6N4SPZ0_CYTH3      --------------------
D2QPT3_SPILD          --------------------
Q2RZI9_SALRD          --------------------
D1CC01_THET1          --------------------
B3EQD0_CHLPB          --------------------
Q8KAE0_CHLTE          --------------------
D4H8I5_DENA2          --------------------
B0SRD8_LEPBP          --------------------
C6XF53_LIBAP          --------------------
G2KT77_MICAA          --------------------
Q2W5G2_MAGSA          --------------------
Q0AQC6_MARMM          --------------------
Q9A7P1_CAUVC          --------------------
Q89MV6_BRADU          AGPAPARQGAVQPSPPVIQR
Q984T1_RHILO          AGDAQ---------------
A0L8T6_MAGMM          --------------------
Q6F9B4_ACIAD          --------------------
Q83E36_COXBU          --------------------
Q4FVE0_PSYA2          --------------------
MLTG_ECOLI            --------------------
MLTG_HAEIN            --------------------
K4KG43_SIMAS          --------------------
Q5P0G4_AROAE          --------------------
B2JGP6_PARP8          --------------------
Q47DZ4_DECAR          --------------------
Q15U02_PSEA6          --------------------
B1KQM6_SHEWM          --------------------
Q081H8_SHEFN          --------------------
G2LIP6_CHLTF          --------------------
B2KD01_ELUMP          --------------------
H6LCJ6_ACEWD          --------------------
F3YWT8_DESAF          --------------------
E8V3R9_TERSS          --------------------
E1QKM5_DESB2          --------------------
Q2RI00_MOOTA          --------------------
B1XPB4_SYNP2          --------------------
Q2JJE1_SYNJB          --------------------
C5CCG3_MICLC          --------------------
Q83GD3_TROWT          --------------------
A8LCW6_FRASN          --------------------
E3DAS9_GARV3          --------------------
D7BNS1_ARCHD          --------------------
F5XH31_MICPN          --------------------
B1MCF7_MYCA9          --------------------
A1T8F0_MYCVP          --------------------
A1UFI5_MYCSK          --------------------
Q741L1_MYCPA          --------------------
B2HNC3_MYCMM          --------------------
C3PGN0_CORA7          --------------------
B1VDL6_CORU7          --------------------
F8E313_CORRG          --------------------
A0A059VSS5_STRA9      --------------------
Q1J1B4_DEIGD          --------------------
Q9RRE0_DEIRA          --------------------
H8GUR8_DEIGI          --------------------
C9ZG10_STRSW          --------------------
H2K1I7_STRHJ          --------------------