CLUSTAL format seed alignment for MF_02066

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q1GYT3_METFK          ------------------------------MMQRLLVLVVVGCLSLPHMVQAALFGDDEA
C6XA93_METGS          --------------------------------MRGLIVGLGLLMGVSQMAHAALFGDDEA
F8GGH3_NITSI          ---------------------------------MLIRAFLLLLLLGCNVSHAALFGDDEA
Q8Y1F3_RALSO          -MRRLRSRGRRSYVGSKDMNTMTKQRVFQAILTATLVAGGALTMAGPAAAG--VFDDDEA
B1XTB7_POLNS          --------------------MMTLSRPAKQTLSRAFCLSTALICLGASSSAWALFSDDEA
A1W6P0_ACISJ          -----------------------MPRMSLLLRPRALGAAALAAAACWSTPSYALFEDSEA
C3XAM4_OXAFO          ---------------------------MKKSSRLFIALLVAATWLPISQAHAGFFEDDEA
Q7VU05_BORPE          --------------------------MRDQALPLRTLVITASLALAAMAAPAHAFADDEA
CPOB_ECOLI            --------------------------MSSNFRHQLLSLSLLVGIAAPWAAFA---QAPIS
A8AJ51_CITK8          --------------------------MSSNFRHHLLSLSLLVGIAAPWAAFA---QAPIS
A0A2I5TAE6_SERS3      --------------------------MNSNFRHHLLSLSLLIGVATPWVATA---QAPIS
E1SLC4_FERBD          ------------------------------MKRVVIVTALLCWGAQPLAAPAPVVEAAPS
Q5E687_ALIF1          --------------------------MKYSNLKRIIPLTLLASAATLVVAAP----APVT
Q15RP3_PSEA6          ------------------------------MNKRILALTLTAIFGAAVNAAP----APVA
D3RR72_ALLVD          ----------------------------MPPSVRFLSLPIVLVLGGLTAPS--------L
E6WQT2_PSEUU          -------------------------------MLHLRAIGMMLVVAALVAATP-------A
Q72AR2_DESVH          -----------------------------MKKHLATGIILPVCAVTALTACVRQGDFDAL
E5Y3R4_BILWA          -----------------------------MKKPYIFPLLL---GSLVLTGCA-NGQIDAM
F2I352_PELSM          ----------------------------------MKKIFIFIIFCMFAYGAQADEQLTTI
Q4FN19_PELUB          ----------------------------MFNYKKIIRLKLILVFIFFPNIIFADNHNVNE
Q28TR8_JANSC          ------------------------------MRFA-LALCCALIAGP-AVAQDNAETLADI
Q5LNU6_RUEPO          ------------------------------MRVAGVVLAVSLTFAG-QAPAQDQQTLADI
A1AZV6_PARDP          --------------------------MMAARGFRGLLLAAGLALAAWPVAAQDAQTLADI
F0JEW7_DESDE          ---------------------------MKMKNSSLFTVLLILLSLSALAGCATRTDVEAM
D0KY68_HALNC          -------------------------MNRLKIKRNAKKITVLAVFGMVMTQPTWAQTPPGW
L0E129_THIND          ------------------MTGHTDATVNRWTRGPVTGLLGLAIVFAWTPAGAQSGSPVVT
G2IVB6_PSEUL          ---------------------------MKRLALGALLLTLLAGCATTTELDDTRSRLEDT
Q83F57_COXBU          -----------------------MRLIKMKIKTLCVSSALAALMLSAPLTWADAPVEDIS
Q8D2E4_WIGBR          ------------------------------MMIILNNKIVYCIFLIAVASLKTATAKIQV
F2K2U2_MARM1          ------------------------------MAFNKAVIRSIALVAASAASFASANTVQGL
E1QJP7_DESB2          ----------------------------MTMKKTLMMAAVVALAAMLTTGCAVTQERFDA
E8RGY3_DESPD          MKTIRNIAVAGCSLMLLTQCASQDEVQNLQYQLRAMNQKLEDVKSNTVNQMQKKQASSVS
B3EAU2_GEOLS          -------------------------------MGHLHKLGLLSLSLLVLGGCAANDLMVKR
B8FK10_DESAL          --------------------------MHMSTVVKIMTKTCFVVALAFTLAGCSWFDWLKQ
C7LWA6_DESBD          -------------MRNAEENGDCDMRSTLVFVTGMLVGVLLSWASGPASMYLARGWPALR
Q1MS60_LAWIP          -----------------------------MYYMEVFMYRLYSIILCIVILCSGCSLWTRI
F2IX64_POLGS          --------------------------MARTLAALAAAVWMIGALSTPVSAQLFGRGNDES
Q2W2B3_MAGSA          ------------------MRPWESHSSASVSKMRLVVRRFVLSTALSALLIGAAFVSPAS
I3TJ10_TISMK          ------------------MSVPATRSRPSGLKRRLVGGTALVMTTLALLVVDRPDAGAQQ
B6JJ16_OLICO          ----------------------MSSRLRIVAGAGLACAWLALPLTAPMAHAQGYDTDPQM
B0T055_CAUSK          ----------------------------MKLKAALLASVLALTAAPTLSWAQTAMPDPLD
C6XND4_HIRBI          --------------------------MNIMRDLRLSTAAVLSPVVVLVSVFAFSAQAQVS
Q0ALY7_MARMM          -------------------------------MIRFVCLFALTAAIALSAPSQAQSRRELA
Q9ZDU4_RICPR          --------------------------------MKLIILLITFLFSLFSLGKSEMPQGKPL
F7XTS0_MIDMI          ------------------------MQRIKFLAFSSLFLSCLELHAASPVDITKAQISEGA
I4BZU0_DESTA          -----------MNTSGNGTSVLKREGRLPVFRLSWVLILVTLALSGCLTRTSGPTLPYVK
A7HF15_ANADF          -----------------------MSGHPGAVRAPAGSGGVAIWTRRGMVALAVLLGACWY
Q1D227_MYXXD          --------------MLPSGWSFPSRSGDRPAGQALAGAPTGREKSGRAGRLRLRWRPMRS
D0LFM4_HALO1          -------------------MILTKEADVPNARLQRLKRGCALLIWGALLTSLSGCFWVTT
                                                                                  

Q1GYT3_METFK          RKKIAD--------LQEQVQAQNQETQAALAELKKSQQAL----EAR-SQGMLDLMAQID
C6XA93_METGS          RRKIAD--------LQQQVQTQNQATQAAIDELKKNQQAL----EQRYTQSLTDMLGKID
F8GGH3_NITSI          REQIAA--------LRKQVSEMEARIAKMEQALN--------------SQALLELYAQVE
Q8Y1F3_RALSO          RRAIID--------MRDKFNNFQSSAAQR---------------IDQNSRNQIDAQNQIE
B1XTB7_POLNS          RKAILD--------LRKSL-----------------------------ATTQLELQGQIN
A1W6P0_ACISJ          RRAILE--------MRQRVDALTQASQRAGERSGDE--------VSQLRRSLLDLQMQIE
C3XAM4_OXAFO          RRSILD--------LRAKVKDLENSKLDK--------------------SSGVNLTNQDD
Q7VU05_BORPE          RRAILD--------LRQQVQQQNEQNQ----------------------RARLQLADQLQ
CPOB_ECOLI            SVGSGS--------VEDRVTQLERISNAHS-------------------QLLTQLQQQLS
A8AJ51_CITK8          SVGSGS--------VEDRVTQLERISNAHS-------------------QLLTQLQQQLS
A0A2I5TAE6_SERS3      NAGSGS--------IEDRVIELERIANARG-------------------QLLTELQKQVS
E1SLC4_FERBD          SARSGD--------INSRVDRLERQMQARN-------------------QSQLQLQQTLD
Q5E687_ALIF1          DLNASSNSTSSAPASSASIERLERLIKSRN-------------------QIQLQLQQQLD
Q15RP3_PSEA6          DVSSGS--------TESRLTTLERLFNTRT-------------------AQQHRVQEQLD
D3RR72_ALLVD          WAADPA--------LEGRIGRLERILEN---------------------QSGSELLLQMQ
E6WQT2_PSEUU          HAQKMS--------LADRVARLEAQANNT--------------------QQTQDLLNQLS
Q72AR2_DESVH          QSRVLR--------QEQQQQQLNMQLSGVQ-------------------PAQADTWSQVQ
E5Y3R4_BILWA          QMRLNQ--------QEQQIRLLNSQLSGVQ-------------------PAQADTWAQVQ
F2I352_PELSM          INELKT--------LNKDLKTLEKAVYSKSFSSQNSTNSSSGNIPATLEGALTRQLVKLS
Q4FN19_PELUB          ILEL----------IQKDLKTLEKAVYSGSINSNSQTGTN-----ENSEDVLTRHLLKLS
Q28TR8_JANSC          RQELSV--------LYVEIQRLRGELNTTGGASGSGAAG--------------STLDRVN
Q5LNU6_RUEPO          RQELTV--------LHVEVQRLKREFSTTGSPTPSTAGG--------------TVLERVD
A1AZV6_PARDP          RTELNQ--------LSADLQSLRAQLVASGPAGFAAAGGD-------------SAIDRMN
F0JEW7_DESDE          QSDRQQ--------DLNRIRQLEAELAESKQQLKAEIEKS----NNPIREQSADMWAEIQ
D0KY68_HALNC          LNWSDKSDAAPAATTQAPETDAQSATPQPLSSQPLGTGETGVNTASGQTVIIQNLLDSVS
L0E129_THIND          QHQLQM--------VETRLDRVERLLDSGV---------------------LTEMLQNTD
G2IVB6_PSEUL          RRQLDQINRQ----ANTRLTDVETKLSN---------------------DKLLAMISELE
Q83F57_COXBU          AQPQPTKTTVSPSETPETAIPTAPVSLPTTQTDLTVTHRLARLEQQLNNIINMNLPQQIS
Q8D2E4_WIGBR          KKAIPA--------IEDRITKINRLFKSHS-------------------QLLNQIQNKIH
F2K2U2_MARM1          SPAAAADLLFQLESLQQEVQQLRGLVEEQE---------------YELKKMKTRQRDRYI
E1QJP7_DESB2          LQGVVNSNQAQLRKLSQKVDQMSTQMDSQR-------------------QPQAEVVADLT
E8RGY3_DESPD          KIDQVEDETLRIKSSIEENASQTSQFREQVNQNIANLQSSMENARTDQDAKISELSQKVA
B3EAU2_GEOLS          QTETET--------KVEHLFQIAGGIEARL----------------------NELSGRLA
B8FK10_DESAL          DNTDPR--------LEDAHKKLDAIATNTDIA----------------EQQLHSVNKRLS
C7LWA6_DESBD          LVETPARMVPSLTSVQDDNVAMGRPSASVLRRPVTRSVRMATSNVILVREAAVSSNATGA
Q1MS60_LAWIP          KKAIKS---------NDTIQEEVLNEAEAG-------------------TIAEALSELDA
F2IX64_POLGS          QVRLND--------MEERLRRLTGQIEQLSYQL---------------RELQDQMRRMQE
Q2W2B3_MAGSA          AQSDTRALYDRIERLERDLMTLQSQSARGGSTVVRSSAND----GSVSGSAASRLEDRIN
I3TJ10_TISMK          QGSLPPAALGAFDGRLSGVEETQRRHTGRIEEL---------------EFRMRRLEERVD
B6JJ16_OLICO          EIDRLSDQLRKLTGQNEELQHRNRILEEQLRQLQGGAAPAPGRGPAPPSQPPQQTQPYQG
B0T055_CAUSK          DRSVKRLDKMEKVVRELRAIVFQGRDTGKPVVVQP----------AETDAQIAALSEKLN
C6XND4_HIRBI          VDPMVARLQSRMDTIEQNIQRATGRVEESG-------------------FQTNQLQKRIE
Q0ALY7_MARMM          ERIDAT---------EVRLGNLESEFMAGD-------------------PVAEALIRRMD
Q9ZDU4_RICPR          KYAVNND-------FENRLDEQE--------------------------QEIRKLIGKVE
F7XTS0_MIDMI          MAARLDSIEKGLNVLQKYVYNLSSSQLAGSQG-----------------SGNVENHINVD
I4BZU0_DESTA          PAQSVPHTDPGTVHLAARVEEMENEIRRLRDMIERAQAGG-------NDRLVKTLQDRVA
A7HF15_ANADF          PKERGARLEQRVERIEGEAPAVQPGADAEAAR-----------------EQARRVDATLA
Q1D227_MYXXD          LALISLLALPGCFYPADRGRALEAKVDRLGTDSAQIQAEL--------KETREQLVATLP
D0LFM4_HALO1          KREGEK--------LRAEVDSLDSRVAEREED-----------LQSKIQQLEQVLAKATA
                                                                                  

Q1GYT3_METFK          RLNQEISRLRGELEVVNH-----------NIENTQQRQRDLYADTDSRLRKLEEGG----
C6XA93_METGS          ALNQQISRLQGQLEVANH-----------NIDMTQQRQKDLYADTDGRLRKLESG-----
F8GGH3_NITSI          TLGLELGKLNGQIEMLSN-----------DNALLQKRQRDFYIDLDNRLRQIEQPGKQGS
Q8Y1F3_RALSO          TLKSEVARLRGQNEQLQN-----------EVDTLARQQKDYYADLDARLKKFEPQQAT--
B1XTB7_POLNS          KLKTENAELRGKVEELEK-----------QGEDINASQKTYYQDLDTRLGNFEPRTAT--
A1W6P0_ACISJ          ALRTEQATLRGQNEQLLR-----------DVAELQRRQKDMAQGVDERLRQFEPATVT--
C3XAM4_OXAFO          ALRDEIARLRGQIEVLTN-----------QVKTMEERQKDFYLDLDTRLKKLEPREAT--
Q7VU05_BORPE          AMQQEIAQLRDQLELISR-----------QQPNAQGGQ---------------PQHAG--
CPOB_ECOLI            DNQSDIDSLRGQIQENQY-----------QLNQVVERQKQILLQIDSLSS-GGAAAQSTS
A8AJ51_CITK8          DNQSDIDSLRGQIQESQY-----------QLNQVVERQKQILLQMDSLSS-GSAATPSAG
A0A2I5TAE6_SERS3      ATQDEIDSLRGQIQENQY-----------QLQQVVERQKQIYQQIDGLSSKGGQPSSAAA
E1SLC4_FERBD          QMQREIGELRGQSENQAY-----------QIQQMLERQRQLYQDLAKLQS----------
Q5E687_ALIF1          GLSQELSEMRGTVERNSY-----------ELDQMLERQRQLYIEIDNIRT---------A
Q15RP3_PSEA6          LLQNEVNELRGSIEKHNY-----------QLERILERQRELYLEIDKRIA---------A
D3RR72_ALLVD          RLQSEVQELRGLVEQQRF-----------DIERLQRQQRDQFLDLDARLAGTGRASGSGG
E6WQT2_PSEUU          LLRSEVQELRSALEQLQY-----------EHQQLQQRNRDQYLDLDGRLNRLE------G
Q72AR2_DESVH          SMRQELATMRGQIDDMRYKL--DSFGKSGDVAAMRDQLSKHDAALRQIASQFDVELKLDQ
E5Y3R4_BILWA          SLRQEMSAVKGQIDDFN-----NATAAAGGLPGLAQRVNNHEAALQAIATQFGMELPV--
F2I352_PELSM          ELEEQIQKMTASNEETLF-----------NLQKISERVDKIQRDTELRFSDLGSGSTS--
Q4FN19_PELUB          DVEKQFQELTNKFEEINF-----------KLDKLSNRLSKVQADNQIRFQDLENALSSGE
Q28TR8_JANSC          AIEAEVTRLTALTERLQL-----------NVDSVVRDGTNRIGDLEFRLCELESACDV--
Q5LNU6_RUEPO          AIESELQRLTRLTEQLNA-----------RIDRVVADGSNRVGDLEFRLCELEPACDI--
A1AZV6_PARDP          AMEARLAQLTGQTEQLQN-----------RIDRIVRDGTTRIGDIEFRLCEMEEGCDL--
F0JEW7_DESDE          SLRAEIAKMRGEVDNLNIRM--DRQVGAADSAVTVEDLSKRLSEVEFAMVNELQVDLPEV
D0KY68_HALNC          RLQEQVRDLRGQNEVQEN-----------QIQRLQKAQQSAFSSFDDRLSKLEQTGGSTL
L0E129_THIND          ALQAELRQLRGQVERLQH-----------EVRSLRAGQRAEIRALEERLGLLEGDRTAP-
G2IVB6_PSEUL          SLKAEQARLRGELEVQGY-----------NLQNTQKRQNDLYADLDARLAKLEGGAPA--
Q83F57_COXBU          DLQQRLAQVRGQLQVQER-----------NLELLNNQQRSFYRDLDQRITQLKNLNSN--
Q8D2E4_WIGBR          ENQNDLENIRSQVQFNQH-----------ELHKLIKNQNEFQDKLKIFINNYEKLKLS--
F2K2U2_MARM1          DLDKRISLIMSSSQAPQA-----------QVASVSQTESQPQQESGSISVASAPINSA--
E1QJP7_DESB2          VMRQELARLSGQVDEASH-----------MGGGAAEQMSQSLQHIEQRLAKVEKYLGISA
E8RGY3_DESPD          VLEEKISLISENFTKIQQ----------DKINEAEKRAQAAAQKAEAAKQRAASAASSAA
B3EAU2_GEOLS          GLEEQETQRAALIKELGN-----------GVRELKEVNQALQAKLQAAPATATSKVEV--
B8FK10_DESAL          AIEQRLLNMEGQMGNMSI-----------MMESISLAPSEIQQQAGYSQDVEDDYLTA--
C7LWA6_DESBD          HASAQIPAGLGAPVVAANAT--IGSAAEPSAAPLPESVHAAKAGLKTAAPVPDISKSKSG
Q1MS60_LAWIP          DREKESSTYLNKISDKKT-----------NIDPESVEKNTQHVKSVDPSPSLDETIPK--
F2IX64_POLGS          DNEYRFQQLEGGRPAKRSDV--PPASAPATAANGTTSAGAIPPASSGTLGTLPAEGSGDA
Q2W2B3_MAGSA          ELEDANRFLTGKIEEANF-----------KAAQLNKQLERMQADIDLRFKDLEGGKGGSS
I3TJ10_TISMK          GLERNLNDRLGRIEQMLQNG--AAAGAAAGTGDATGMTPGAAAPADAAPGQGQAAGQGQA
B6JJ16_OLICO          QPYQGQQPYQAQPQQSPYQ----------GEQGAPQSAPYSDGPVQSPRGGNRGDAFDPS
B0T055_CAUSK          DLEQTLTKLNGQNETLTHD--------LDQARRASDSEKTRADALDQRLAALEKRIVD--
C6XND4_HIRBI          FQAEEISILKQALAAQNE-----------RVKKLEAIINAPLDAAANAADGPAETTVPLV
Q0ALY7_MARMM          ELEYQVQSLTGETERLNF-----------ENRQLRQQVEALEAEVEANQRPAEPIMDDAA
Q9ZDU4_RICPR          ILQHKIDLLKQNLNMLNQ------------EENIEVLETDDFKKQDIFDIALLEGMHD--
F7XTS0_MIDMI          EIGEQFKSIRSDLENIKQ-----------EINQINDRMLKITSDVEHRLADLEGPIKEKR
I4BZU0_DESTA          SIEKHLGLEAPREASAPAAS---------PSQPTYPEPRQAPQQMRPEAPPTSRAPQQQP
A7HF15_ANADF          QVNTRLEALDRATRAGAPP--------PEGQAELVKELRQLRATLEQHGQRLDAVERSLA
Q1D227_MYXXD          KIDEKVAEVTKALKGLDTAARRKDADIGVQFQKTVEDLAQLRGQVETYLHKITELETALA
D0LFM4_HALO1          VLQRNSADLGADVAALSEDI--------RTMQGLASEASQIAEEVRADVTRMQAEQAAER
                                                                                  

Q1GYT3_METFK          ----------------VPSA------------------------VQSGADGNHAPAGPNN
C6XA93_METGS          -----------------APA------------------------ATADAAQPASGAVTEA
F8GGH3_NITSI          SAPAAPASISDSTPTATPSV------------------------KEQTAAPPAAGAVIPE
Q8Y1F3_RALSO          ------------------------------------------------------VDGREG
B1XTB7_POLNS          ------------------------------------------------------IEGVSG
A1W6P0_ACISJ          ------------------------------------------------------LDGREF
C3XAM4_OXAFO          ------------------------------------------------------AAAKES
Q7VU05_BORPE          ------------------------------------------------------NPPGVT
CPOB_ECOLI            GDQSGAA--------------------------------------ASTTPTADAGTANAG
A8AJ51_CITK8          GEQSG-A--------------------------------------ATATPAPGAGAATSG
A0A2I5TAE6_SERS3      EGSTATT--------------------------------------PDAGATNTSSTSPAA
E1SLC4_FERBD          ---------------------------------------------APQAAAPAATAPSST
Q5E687_ALIF1          KPT-----------------------------------------------VEAKPEATEG
Q15RP3_PSEA6          VMTQNGS--------------------------------------GATDEFNQTNQVSQP
D3RR72_ALLVD          GETAAPSLQPGLVDASGTGL------------------------DALPGATPSANPVTPP
E6WQT2_PSEUU          GELPAPP--------AATGA------------------------AAPAPAAPAAPKVADA
Q72AR2_DESVH          PQADAAGALAPSTEPGHDGA------------------------SRFVVAAETKTSGPVT
E5Y3R4_BILWA          ----AAVPGAPGAAPGMPDA------------------------T----AAAPVPAAPVM
F2I352_PELSM          ----TTSVQKTNTPKQLPGTGKMQDFSKVLDTPSNDTKIASNQKQEIRSISPAAVVQTAD
Q4FN19_PELUB          IGKKLTSIPKEQVDKTLPGSSQPQDLGSISYKDTE----SEETSQQIQSVETTASIVTEN
Q28TR8_JANSC          -----GSLGE---TPSLGGV--------------------EPSSAGSTGTGGGAVTATPL
Q5LNU6_RUEPO          -----SKLSQ---GTTLGGD--------------------VPV----------TPAATPQ
A1AZV6_PARDP          -----GSLTTPTLGAQGGGS--------------------APLPSSDQ-----QGALTQS
F0JEW7_DESDE          RKAHDAAAAA----------------------------------TATAGATAAATATAAT
D0KY68_HALNC          APSAPVPPSVPATKEPAASV---------------------PTAPAPASSASAAPAASPA
L0E129_THIND          ------------------------------------------------EPEPPEPEVIDT
G2IVB6_PSEUL          -----------------------------------------------SSASPASSGATDG
Q83F57_COXBU          ----------------------------------------------NSDSSNDNSASSSQ
Q8D2E4_WIGBR          -------------------------------------------------YVKNNNNFKKN
F2K2U2_MARM1          -------------------------------------------GSDIGSASSDAMETTPV
E1QJP7_DESB2          PPPPAPATEGGLTG-------------------------------GDEAVAATVPTVEEK
E8RGY3_DESPD          PVATTAVSPASAPSSSAFVKVEPGS------KKTKVASTASSQTTAATTTMPTTTKKAAE
B3EAU2_GEOLS          -------------------------------------------------------VNPDP
B8FK10_DESAL          ----------------------------------------------PEVQKPPAPAPEPP
C7LWA6_DESBD          SSKSVPDISKSESGSYKARPVTS---------------------RPDSAVTAKAPAASAD
Q1MS60_LAWIP          -------------------------------------------------KKVQIDNNNNK
F2IX64_POLGS          EWAASGGYRDAPAGAAVEAG------------------------PGAGPLDLSALARGQA
Q2W2B3_MAGSA          SSAQPQSMSMPAASAPATTPSGAPVLIP------------PKGVKPGANSADNDGPAPGP
I3TJ10_TISMK          AGQGEAPRSG---------------------------------AVQPLGTITTRRDAAGN
B6JJ16_OLICO          QNPNAPGAPRPLGSMRGQSN-----------------FVEPSTQPGAQPGAPMSLESPGG
B0T055_CAUSK          ----------------------------------------------QEAAAAAAVAATPA
C6XND4_HIRBI          GATDSTT-------------------------------------KASLAAARTDEAIASK
Q0ALY7_MARMM          VAWMNEGLDGAAPEVDGSAIAIVD----------------------PDDPHAEARAAATG
Q9ZDU4_RICPR          ------------------------------------------------NVSKKTFEVNKD
F7XTS0_MIDMI          --------------------------------------------ENAQIIDRVESQLNEI
I4BZU0_DESTA          G--------------------------------------------TGPGVQLTRPQTSTN
A7HF15_ANADF          QGQQRSGAARVAES------------------------------RPSASKTSSKPSAAAP
Q1D227_MYXXD          AQD------------------------------------------QKLVAMQGEAALKEA
D0LFM4_HALO1          TAV------------------------------------------EERLILLEERLAKLE
                                                                                  

Q1GYT3_METFK          NADN---------------------------PEARDLEAARALAA-SGKFKEAFDAYGKF
C6XA93_METGS          PASS---------------------------SEAKDLDAANALLQ-ASKFKESFDAYQKF
F8GGH3_NITSI          TSSSDGTASS---GALDSGRVSANELAPAGPAENSAYKEAYDLFK-NGEYANAIAQFESF
Q8Y1F3_RALSO          MVQP---------------------------GEKTEYDAALKTFQ-SGDFKGAGNQFSAF
B1XTB7_POLNS          TVQP---------------------------GEKKAYDDALKAFQ-AGNLKKADDSFAAF
A1W6P0_ACISJ          RADP---------------------------AEKRDFEAALALFR-AGKFGEASNAFSGF
C3XAM4_OXAFO          TADS---------------------------NENAAYATAEDKFK-AGDYKGAVSAYNSF
Q7VU05_BORPE          AVDQ---------------------------QEQAAYDGAIDLFR-KGQYKDAAESLAAF
CPOB_ECOLI            APVKSG-------------------------NANTDYNAAIALVQDKSRQDDAMVAFQNF
A8AJ51_CITK8          APVQSG-------------------------DANTDYNAAIALVQDKSRQDDAIVAFQNF
A0A2I5TAE6_SERS3      VPASSG-------------------------DANSDYNEAVALVLEKKQYDQAIVAFQNF
E1SLC4_FERBD          PAVSSL-------------------------SEADAYTQALNLATKERRFDDAIPAFRRF
Q5E687_ALIF1          AYAADT-------------------------NENAAYQNAVDLILKEKNYAGATKAFQEF
Q15RP3_PSEA6          SSQTSL-------------------------NEDQAYDKAVNLILKDKLYDDAIPEFQSF
D3RR72_ALLVD          VPASPGSV----------GIPSLPAPETHGASERDLYSQGFEHLK-ERQYQEAKTAFNDL
E6WQT2_PSEUU          APRVHG----------------DPGSLALGADELAAYDAAFKTLK-AADYAASAEAFQGF
Q72AR2_DESVH          VPPTQSGTLAVSNGTPAQQPAAAKPAAPAADTATALYDTGISSFN-SRNYKDALKSFKDF
E5Y3R4_BILWA          QPQAAA---------PAPQQAAPQTQA-QGDIAKALYDNGVQSFN-ARNYKQALKSFSDF
F2I352_PELSM          VEAE-S--------------------ILPKGTPASQYKFATNFIK-VGDYQKAEIALKEF
Q4FN19_PELUB          FESEKN--------------------ILPNATPEKQYEFATSFLK-VGDYSTAERAFREF
Q28TR8_JANSC          PSTPQP--------------------SGLAVAEQQDYDRASLAFD-EGRFADASVAFQTF
Q5LNU6_RUEPO          PSQPQ---------------------TELAVGERAEFDSATQALE-AGDYAKAADLFTQF
A1AZV6_PARDP          KPPSAG--------------------AAATAAEKADFDRAREVLG-QGDFRRAAELFAAI
F0JEW7_DESDE          AAPADAPEEAAVATGAAAAGAATAAAQADTDPAKALYDKAYALYK-EGNYERARSYWAEF
D0KY68_HALNC          PATSQD--------------------AAATAKQQALYNAAFAQLK-DGQYDQAITGFQAA
L0E129_THIND          LPDAD---------------------------EQGAYQAAFDQLM-SGDYPEAILQLERF
G2IVB6_PSEUL          GAPSSS--------------------APAATPASSDYDKAIALLR-NRDFPHATEALKRF
Q83F57_COXBU          KPSSGD----------------TSNTNNIQLQDSNTYRQALDLLT-KKQYDKAQASFQNY
Q8D2E4_WIGBR          SSINEN------------------------YEDKLEYNKHIKLVLGNKNHDKAIEKFKNF
F2K2U2_MARM1          VAITEP-----------------------SDEAKGAYKAAYALIR-EKKFEEAAQAFDDF
E1QJP7_DESB2          TGPSS--------------------AAPAKLSDKERYNLALRLYE-QKSFDAARDRFEEL
E8RGY3_DESPD          QPAAQTAAAAPPASTKAASSAAPEEKSQAASSSSDPFSQGMNQYK-GKNYKEAYKSFEQS
B3EAU2_GEOLS          VPKGRD------------------------AGPPPAYVKAFGLYS-TNNFATAIQAFELF
B8FK10_DESAL          KTASSS-----------------------LISPEEQYAGAYLHYQ-NREQDKAIRAFKAF
C7LWA6_DESBD          ALKKKA---------------------AAEISPEQEYARALKSYQ-NGRHALAREQFAAF
Q1MS60_LAWIP          LSQS---------------------------QEQKMYKDALHLYE-LHKYNESITLFDQF
F2IX64_POLGS          VVSPPATGTAPPGVSVGDPIGGQIASLDVTGDARTDYDRAYSFAL-NGDYAQAEQAFRIF
Q2W2B3_MAGSA          QNLGAMPAGALKKGEAEAQAQAAKAPPAAPKDAQSAYEEAYGLAQ-KGDYDGAEQGFRSF
I3TJ10_TISMK          SVTTTEAAPSQPTPPPVAGGEAAKTRAASIQSEQELYRYGLDLLLKDRDYAGAEVAFNEL
B6JJ16_OLICO          MAAPSAPPAAG---------GGSITTAPPTQSPKDEFDLGIGYMQ-RKDYALAEETMRNF
B0T055_CAUSK          APAPVA----------------------ASADPTAAFKAARQLLL-DGDYGGAEQAFAGY
C6XND4_HIRBI          PADIEDLP----------------------EDPSKLFRQAKNLLL-KGDYPAAETAFAHL
Q0ALY7_MARMM          VLGGGG---------------ASSVTEMAPVDPAVIFEAARARLV-DSDFIGAQAGFEGF
Q9ZDU4_RICPR          IA-----------------------------PYKQAYDLALAAYK-DNKLTEAKDKFKNF
F7XTS0_MIDMI          ENRPDPS--------------TQVNVDKGLTTPEEQFRNAYYLLR-EKNFDGAGDAFEKF
I4BZU0_DESTA          PEVQQPQ---------------VDIRNTPIAPDEKAYRDAFQLLR-SGNYDQAVMQFEEL
A7HF15_ANADF          APGPAPG-------------------PALSANETDVLALARAQEQ-QGNKTVARELYEQY
Q1D227_MYXXD          EAKKKAE-------------------ELKRPTDKKEFLALAKAKAKAGDVLLARQLYNEF
D0LFM4_HALO1          VQAAKP------------------------PSPDELYSQGRAAFE-RGDYGGAQTLLRQL
                                                                          :       

Q1GYT3_METFK          LQTYPRSALVPDALLGLGSAQFSL-KNYKASISTQQKLISQHPESDKVPDAMFSIANSQI
C6XA93_METGS          LQAYPASTHAADAMYGLGFSQFSL-KNYKAAIATQQKLLKQYPDSAKAPEASFNIANSQI
F8GGH3_NITSI          LENYPQSSLAPGAAYWIGNARYAL-RDYQLAIDAQRKLISTYPDSSKVPDAFLNIASSQH
Q8Y1F3_RALSO          VKKYPQSPYLPLAQFWLGNALYAQ-RDYKGSTYVLENMARANPQHPKAPEALLQVATNQG
B1XTB7_POLNS          TAKYPKSPYLPLALYWGGNSKYAN-KEYAGAISQLQNLIKKYPNHPRIPAAMVTLGNAQL
A1W6P0_ACISJ          VRQYPQSGYVPSARFWLGNAQYAT-RDYKEAINNFKALLSAAPDHARAPEAALSIANCQI
C3XAM4_OXAFO          LKQYPKSNLIASAQYQLGNAYYLQ-GDYKNALKQQSAVVKRYPKNQVTPDAMLNMASCQI
Q7VU05_BORPE          IALYPNSQLAPTAQFYLGSSRYAM-KDFKGAIEQLNNLVQNAPTNARAPDALLVIAGSQI
CPOB_ECOLI            IKNYPDSTYLPNANYWLGQLNYNK-GKKDDAAYYFASVVKNYPKSPKAADAMFKVGVIMQ
A8AJ51_CITK8          IKKYPDSTYQPNANYWLGQLNYNK-GKKDDAAFYFASVVKNYPKSPKAADAMYKVGVIMQ
A0A2I5TAE6_SERS3      IKKYPDSTFQPNANYWLGQLYYTK-GKKDDAAYYFANVVKNYPKSPKASEALFKVGVIMQ
E1SLC4_FERBD          IEQYPDSSYTPNAYYWLGQLLYNQ-GQLAEAGTMFATVADKYPKSSKRSDSLLKQGLIAD
Q5E687_ALIF1          VTAYPDSVYSSNAHYWLGQLYFAQ-KNDVEAAKSFAKVVS-YADSNKRADALLKLGEVAK
Q15RP3_PSEA6          LQNFPNSSYASNAHYWLGQLLFNK-QDWAAAANQFETLMNQFPDSSKRADAMLKLGICEQ
D3RR72_ALLVD          LRRYPQGEYADNARYWLGETYYVL-REYPAALAEYDRLVELNPASAKVPGALLKIGFIQY
E6WQT2_PSEUU          LDAYPAGVYAPNALYWLGESYYAT-GNYALAAQQFRALMERYPTHDKTPGALLKLGLSQL
Q72AR2_DESVH          TDTFPNHKLTSNAWFWQGETNFQM-NNFPAAALAYEQVISKFPKSSKLPSALLKQGICFY
E5Y3R4_BILWA          TDTYGKHKLVSNAWFWRGECNYQL-GNFPAAALDYEQVISKYGSSGKAASAYLKQGMCFI
F2I352_PELSM          IEKNPTHSLSGSAQYWFAETFYIR-QLYHDAAAAYLDGYQKFPKSKKAPQNLLKLGIVMN
Q4FN19_PELUB          VINNSEHKLAGNAQYWYAETFRIR-QLYTDAATAYLEGYQKYPKGEKAPINLLKLGVSMV
Q28TR8_JANSC          VDTYPGSPLSADAHYLRGEAEVNL-DRWNPAARAFLASFSAAPDGPRAPIALTSLGVALA
Q5LNU6_RUEPO          DASYPGSPLAAEAHLKRGKALDGL-GDTREAARAYLASFTGDGSGPFSAEALYKLGSALG
A1AZV6_PARDP          AETHVGGPLTAEALFLRGTALDSA-GDLEGAGVAWLESFAANPNGPQAADALLGLSRAMS
F0JEW7_DESDE          TDTFKGHAFTPSAVFWQGQCYYML-KDYARAVILYEDVIEKYQKSSKYKAALLRAGYSWE
D0KY68_HALNC          IDADPQGQWTPSALFWQGETYYVE-QKRDKSEAAYQKILTQFPNSDRVPDALLKTGYIAY
L0E129_THIND          MERYPDGVYSANALYWLGEAKYAS-QDYEGALVDFQAVRDRFPDSDKASDALLKIGYSHF
G2IVB6_PSEUL          IDQNPGAVEAVDAMYWLGVAHAAQ-RQYDAAIDIHRRFVERNPNHPKAPDALRNIANCQR
Q83F57_COXBU          LNDYPNGSYVANAHYWLGEIYLQQ-KDRKNAAHEFQTVRDKFPKSEKVLDAKLKLAIIDA
Q8D2E4_WIGBR          IKKYPKSIYTPNAKYWLGQLYYIK-GKSDDSIYYFASMIKEFPNFQKTPDALLKIAILMQ
F2K2U2_MARM1          VLVYPSNTLTGNAHYWLGELKLVL-GKPEEALNEFNMVVTQFPNHSKVADATYKLGIVND
E1QJP7_DESB2          LKDKPDGAYAASAQFWVGECYYSQ-KRFEEAILAYNQVIKRYAKNAKAPAAMLKQGLAFS
E8RGY3_DESPD          LSTNPNGSQAAKSLYYMGESLYNQ-GEYDLAILDYQKVISNHGKDALAPAALLKQGMSFE
B3EAU2_GEOLS          IKELPASEYVPNAYYWIGECYYSS-SDLPNAHVAFQKVVDGWPRHSKAADALLKIGYSYL
B8FK10_DESAL          LADNPDHDLADNAQYWIGEAYYDQ-KMYPEAIEAFKQVVKKYPDQNKAPAALLKIGYSYL
C7LWA6_DESBD          MRNFPRHRLLPNALYWTGETWYAE-ARYDRAMKYFTQVVQDHPRHGKSADALLKLAYSAL
Q1MS60_LAWIP          MEKYPKSRLMPNALYWKGENLYAQ-QKFADAIFMFKSVTATYPKHQKASDALLKVGMSYR
F2IX64_POLGS          IDTYPNDRLVSNAQYWLGESLLAQ-GEYRAAADAFLKTYTDYPGDQKAPDSLLKLGLSLN
Q2W2B3_MAGSA          LKTYPNHQLAGNAQYWLGDIAFSQRKDFATSAKLFGEAYKKYPKHTKAPDMLYKLGASFG
I3TJ10_TISMK          IQRFKQGELVGNAYYWLGETYYAQ-GQYDRAALTFGEGVTSHDKSSKAPDMVLKLGMSFA
B6JJ16_OLICO          TTKYPSDRLVGDAQYWLGESLYQR-KQYREAAEAFLAVTSKYDKSAKAPDALLRLGESLA
B0T055_CAUSK          VEAFPDSAKAPEARYWLGETQFVR-EAYGDAAGSYLGAVRGWPQTSWAPDAVLKLSRSLV
C6XND4_HIRBI          VSTHPDVPEAAEAQYWLGESLLIQ-EAFPEAAEAYVALIRNYPDAPKAPDSLVKLARSLR
Q0ALY7_MARMM          IADNPDHALTAQAQYWLGETFYVR-SDFTQAADAFIASLRLQPSGEKAPDALVRLAASLH
Q9ZDU4_RICPR          IQKYPNNSLISNAYFWYAECFFKQ-KDYNGAAINYLKCYKESPKGAKSSDGLLKLALSLG
F7XTS0_MIDMI          IKNNPNNTLIGSAHYWIGEVYTNK-QEYDKAAVEYLKGYQVGATSGRAPDNLLKLAESLF
I4BZU0_DESTA          VKRNPKSQFAADAVYSIGEAKFKM-GRYDEAVLNFHRVVKEYPGSLKELDALLKQGEAFE
A7HF15_ANADF          VAQFPADPASAEAHFRLGELAFGE-RRYRDAVLEFGKVAREFPRSGKAPDALVRTGEAML
Q1D227_MYXXD          MKKWAKDPLVGDAHFGLGETYFSE-SKCREALFEYGKVLQDFPKAESAPESYLRSSDCFA
D0LFM4_HALO1          VTQYPSDTRADDAQYYRGEAYYRE-QDYGAAIREFQKVFDKYEDSSLADDALFRAGEAAQ
                                  :    .            :                        .    

Q1GYT3_METFK          QLSDVDGAKKTLRELLDKFPDHELAPSAKRRLNVLDSIKSR-------------------
C6XA93_METGS          QLADIDGAKKTLRDLISQYPKSDVIPRAQSRLKVLESIKR--------------------
F8GGH3_NITSI          EMGDSKASKKTLENILAKYPNSEAAKKAKQRLVNIK------------------------
Q8Y1F3_RALSO          ESGQKAAARKTLETVIAEYPGTEQAKTATSRLKTMR------------------------
B1XTB7_POLNS          ESGNKAAAKKIFSDIIAKYPDTEAAKDAQQLIAGTK------------------------
A1W6P0_ACISJ          ELKDTRAARKTLEDLLRVYPQSEAAAAAKERLARLK------------------------
C3XAM4_OXAFO          GLNDIAGAKKTLSELARKYPKSGAAKKAKERLVQL-------------------------
Q7VU05_BORPE          ELNNRAGAKATLQRIVRDYPTTPAANTAKSRLQLLQ------------------------
CPOB_ECOLI            DKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM-------------------------
A8AJ51_CITK8          DKGDAAKAKAVYQQVISKYPGTDGAKQAQKRLNAM-------------------------
A0A2I5TAE6_SERS3      EKGQPDKAKAVYQQVIKIYPNTESAKQARKRLTAL-------------------------
E1SLC4_FERBD          RQGDKATAQRFFKQVISEYSGSSAANMAQKHLN---------------------------
Q5E687_ALIF1          RNNNNAAAKKYYQKVVNEYPDSTTAKTAASKLESL-------------------------
Q15RP3_PSEA6          ERSNIARAEQLWKKVLTEYPTSSARKLAEIKLNAVK------------------------
D3RR72_ALLVD          EQNAIEQARATLERVIREYPNSTEARLARDRLERGVREARP-------------------
E6WQT2_PSEUU          GEGEVRQALSTLAQVGSQYPGTDAARIAADRLRSIEIGQLR-------------------
Q72AR2_DESVH          KTGKKDAGKIRLEELIKKHPDSPEAKRAQQYIKDNK------------------------
E5Y3R4_BILWA          KAGKKDAAKVRLQELIKKFPKSPEATRATQLMKDNKM-----------------------
F2I352_PELSM          ELGEKDQGCLMLSGVKKQYPKADKSILQKAKYETKKFKCAKS------------------
Q4FN19_PELUB          QIGEKEQGCKMIVGVEEQYPKANQSVLQKAKYESKKFECSKQNS----------------
Q28TR8_JANSC          QIGQPEEACLTLSEVGVRYPGSASVADAQAEMGRLGCQ----------------------
Q5LNU6_RUEPO          RLGQTSQACVTLGEVSVRFPSAASVADAHREMASLGCS----------------------
A1AZV6_PARDP          AKAGPQEGCFYLQEIIARFPSAPQAAEAERRIADTGCDAPVDEDPAGELDPEAAADLADD
F0JEW7_DESDE          RLGKPELAKMRFEEIIKKFPKTVEATQAKRSLDKMK------------------------
D0KY68_HALNC          DANKNKQARDIFQQVISKYPQSQAANLAKQRLARMDAEKR--------------------
L0E129_THIND          ELGHADPAREALNRVVSEYPGTTLSRLAQDRLRRLEGR----------------------
G2IVB6_PSEUL          DLGQVDVAKATLHRLIKLYPKSAAAVKAKEQLKQM-------------------------
Q83F57_COXBU          EDGKIKQAKEELTEIKKQHPESTAAQLANIRLQQLEEVDSATTTP---------------
Q8D2E4_WIGBR          KNKDIEKAKKIYKKIINFYPHDKASNEAKKRLNSL-------------------------
F2K2U2_MARM1          QLGNKEEAKQFLQKVVSQFSGTNSATLAAGYLNNME------------------------
E1QJP7_DESB2          ALGDKRTAKIVLNKLVNTYPKSSQAGLAKKYLAKMD------------------------
E8RGY3_DESPD          KLTDHETAKIIYKKLISDHGGSAEASQAKERLGKL-------------------------
B3EAU2_GEOLS          AQKQQDKAKSSFERLIRSYPGSPAAVKARERLMSSDQPAPVRH-----------------
B8FK10_DESAL          AVDNPEQASKFLRQVVTDYPFSDLVNKAQNKLSDLQPAKPVSDAFPNGGS----------
C7LWA6_DESBD          RQGQHEQAGVYLQQLEVRYPDSPASRLGRQARGRIQGCSEFITVALARG-----------
Q1MS60_LAWIP          ALGDQDNATLHFRALYEDYPKSTAVQRAQKLGIKP-------------------------
F2IX64_POLGS          GLGQTDAACATYSELLTKFPGAPKAVLDQARAEQQRAGCS--------------------
Q2W2B3_MAGSA          HLDMKDQACRTYALLFAEHPDMADRIKRAATGDKQRLGCGK-------------------
I3TJ10_TISMK          ALNRKDDACGAYSILNRKFPNAPANIKVLTEREQKKLGCG--------------------
B6JJ16_OLICO          ALKEKDAACAAFGEVARKYPRASSGVKQGVARGQKRIGC---------------------
B0T055_CAUSK          ALKKPADACKTLDELAKRYPKAPAAITAKAASTRNQAKCAA-------------------
C6XND4_HIRBI          MMGDTTQACGALTELSNLYPQTNPMTRSLAKTERDRAGCDS-------------------
Q0ALY7_MARMM          GMGRTEDACSTLARFGRQFPNAAPASQARAARESVRANCR--------------------
Q9ZDU4_RICPR          ELKKMQEACNILAKLDKEFPINRTSVSKKMTEDAKIKFGCKINKNNKI------------
F7XTS0_MIDMI          KLGKRQECCVTIAKLNKEFPNISISIKRSANQLAKDAVCN--------------------
I4BZU0_DESTA          KLGDPRSARVIYKQLTTDNPHTAQGRLAGTRLKQLPKDE---------------------
A7HF15_ANADF          QLDMREEAKTVLSEVPQRYPGTPAAARARSLLAETPNASTAAGKKRE-------------
Q1D227_MYXXD          QLKMKEESRLALEELIKSYPKSAEAKTAKERIAELDKKAAPAKKGKK-------------
D0LFM4_HALO1          TLRRCSEARAYFGVLRQKYPRSNLVNKSKSKDQELKRDLKDPEKCSS-------------
                                    .                                             

Q1GYT3_METFK          -
C6XA93_METGS          -
F8GGH3_NITSI          -
Q8Y1F3_RALSO          -
B1XTB7_POLNS          -
A1W6P0_ACISJ          -
C3XAM4_OXAFO          -
Q7VU05_BORPE          -
CPOB_ECOLI            -
A8AJ51_CITK8          -
A0A2I5TAE6_SERS3      -
E1SLC4_FERBD          -
Q5E687_ALIF1          -
Q15RP3_PSEA6          -
D3RR72_ALLVD          -
E6WQT2_PSEUU          -
Q72AR2_DESVH          -
E5Y3R4_BILWA          -
F2I352_PELSM          -
Q4FN19_PELUB          -
Q28TR8_JANSC          -
Q5LNU6_RUEPO          -
A1AZV6_PARDP          G
F0JEW7_DESDE          -
D0KY68_HALNC          -
L0E129_THIND          -
G2IVB6_PSEUL          -
Q83F57_COXBU          -
Q8D2E4_WIGBR          -
F2K2U2_MARM1          -
E1QJP7_DESB2          -
E8RGY3_DESPD          -
B3EAU2_GEOLS          -
B8FK10_DESAL          -
C7LWA6_DESBD          -
Q1MS60_LAWIP          -
F2IX64_POLGS          -
Q2W2B3_MAGSA          -
I3TJ10_TISMK          -
B6JJ16_OLICO          -
B0T055_CAUSK          -
C6XND4_HIRBI          -
Q0ALY7_MARMM          -
Q9ZDU4_RICPR          -
F7XTS0_MIDMI          -
I4BZU0_DESTA          -
A7HF15_ANADF          -
Q1D227_MYXXD          -
D0LFM4_HALO1          -