CLUSTAL format seed alignment for MF_02070

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TAGA_BACSU            ----------------------------MQTETIHNIPYVNSNLTSFIDYLEKHYIDQK-
Q65E79_BACLD          ---------------------------MLQTETVHHLAYVNGDLPGFLNHLEKSFIDRN-
TARA_BACPZ            ----------------------------MQTKPINQLDFVDSELTSFVSHLETTYLDQN-
F9UL35_LACPL          ------------------------MSVPFDTVNILNVPFIKTTNAGFVQQLQTDILAH--
Q03SY1_LACBA          ------------------------MQSTFPTVTVLDIPFVKTTAAEFLTEVQHRIIQQ--
J9W243_LACBU          ----------------------MNNQSPTQPVDILGIPFENTTEKDFQAILHNVINQH--
C2D5T0_LACBR          ----------------------MEKQSQKKPVSILGIPFENTNQEQFESLLKQRINHH--
D5H1S9_LACCS          ----------------------------MSKVNILGVDFDNKTFNQFQNEFINRLNNH--
Q5FLM4_LACAC          ----------------------------MNKVNVLGVDFDNKTFNQFQNEFINRLNNH--
TARA_STAA8            --------------------MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQS-
TARA_STAAR            --------------------MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQS-
Q5HR98_STAEQ          --------------------MYQNQR-IKDKINILGVSFDNTTMLEMVENIKQFISSNT-
Q49VI2_STAS1          ----------------------MMENNHIDKIDVLSVYFDNVTLLEMRNNIKRFFLADE-
A0A033UW49_STAAU      MAKVLEKDLNSISEQIELNRENSYDVIKPPTVNVLGLPFANLTANEMVERIKYFVNQET-
A0A0M1UYH9_PAESO      ----------------------------MNSVKIFDIPFTTFKKKDLIEEILKRVNKN--
I0JRM1_HALH3          ----------------------------MKHVNILGVPFSITNHSTLVEQLNQHIQKH--
D7UVX8_LISGR          --------------------------MERKQVDILGIPFLAVTQSEFVQLLIQDALEG--
G4L8T8_TETHN          ----------------------------MITEEIMGFPVDVITYNEIIKDLPEYLQSD--
G4L8S6_TETHN          ----------------------------MTTEKIMDFPVDIINYDDIIDDLSNYLQTE--
C9A4H5_ENTCA          ----------------------------MRSELIMGIPVDNLSYDNIIEDVSSYLDKQ--
Q836E1_ENTFA          ------------------------MKSKVRTEYIGGLPVDVLTHQEIMDDLESYLKAK--
D6Y043_BACIE          --------------------------MSQNQERFLGVPVVTLNREALFKDIEERIGRG--
C5D8D6_GEOSW          ----------------------------MGKEKYLDVYVSTLNYDEILADIEKRMAAG--
I0JRN7_HALH3          -----------------------------MKEQFLGVDVSSYSYEELKQNTIADIEQR--
A3DIX1_HUNT2          ---------------------------MRNTVNILGIPIDNVSMDEALNVVKGFLSED--
E4RPR4_HALHG          ---------------------------MRDFLTILNVKIDKLDLDGATARIRSLLGDD--
Q8R864_CALS4          ----------------------------MDKLYIFGVPIHRVTMIEAVEILKGYLKED--
R5IHY4_9FIRM          -----------------------------MKLDIMGLQFDNVTMDEASARAEQILAGK--
R6TSE0_9FIRM          -----------------------------MRIDVLGVGFDNLTLEEAVEAGMDLVRAP--
D9RYL6_THEOJ          -----------------------MQPDINDEIDIMGILLDRVDYYKASQRIMEFLESP--
F9MVK5_9FIRM          -----------------------------MEVSFFGSRVQALSMDQVDSYLEEALAQG--
K0B368_GOTA9          ---------------------------MRETIRIFGVKIDKLTLNEVVKKVKELLDGDE-
D6GQU8_FILAD          -------------------------------MKILDVRVDRVNRTQALEQCVNGMEDK--
D1BMX7_VEIPT          ---------------------------MNKRISVLSVPIDCVTMDEAVQRILQLTEQP--
R6AF15_9FIRM          -----------------------MIDIEKSSHNVMDVTVYALTMQEVLQWAKEGMGDE--
F6CNV9_DESK7          -----------------------------MHINLLGARVDVVDLAGAVEKVAAFVAT---
C8VYS2_DESAS          -----------------------------MKVNLLGAAIDALDMQQTVERTAEFIKS---
A5CYH8_PELTS          -----------------------------MRVSVLGVGIDALTMAEAVERVAGFVKS---
Q24MR8_DESHY          ------------------------MERFTMRADILGVKVDRESMAETVLKIRKAVEE---
L0FDS4_DESDL          -----------------------------MRADILGIKVDKETMSETLLKLQEAVNN---
G7WGF3_DESOD          -----------------------------MRVDVLGITIDTYSMSETVEQIFQFINN---
J7IX20_DESMD          -----------------------------MRVNVLGITIDSYSMQEAVAEIRKAIED---
F0T299_SYNGF          ----------------------------MDEVNILGVRIDGFRMSEVLTLVCQTIKS---
Q0AUE3_SYNWW          -----------------------MKNKTQSRINILGCQIDKVNMDQALAFIEKSIKG---
C8WT65_ALIAD          ---------------------MAVQGFAKDVVDVLGVRFHRVTMAEAVEKILFWTAD---
J9HLM0_9BACL          ----------------MEAGDVAVQGFAKDVVDVLGVRFHRVTTAEAVEKILYWTGD---
D5WVU2_KYRT2          -----------------MNGKGVGHGVMEQRVEVMGTGFDPVTLEEAAKRIAEWVDGWNG
D9SQB3_CLOC7          ---------------------------MNNYVDILGISFSKLNLQETINLIDNKIEKY--
G7MDE6_9CLOT          ---------------------------MESYVNILGINFSKLNLKETVKLIDTKVSED--
D3EMH0_GEOS4          ----------------------MKQTYPFPTVSVFDIPFSKLSMKDTVKYLTEAVQ----
C6D5B3_PAESJ          ------------------------MSKQVPTVPIYGIPFSKMSMDETVKYLTEAIE----
A0A0F7R3M9_BACAN      --------------------------MQVKTVDILGVPFSTMTMDETIQYLKGQLEVE--
A7GVG0_BACCN          --------------------------MAVQTVDILGVPFSTMTMEETVQYLMKQLEVE--
A0A158RH90_BACC3      ----------------------------MDHQLIKGIPFSTLEYAKAISLLKGWLHEK--
R4K3Z4_CLOPA          -----------------------------MFSKVLNYNIFNKSKNELIKYITNLK-----
A0PZR9_CLONN          ---------------------------MELFTSILNYKVFKQSKKQLIDYIQNFE-----
A5N222_CLOK5          -----------------------------MFTRILKFDVFNRSKLEFLNYIEKFS-----
Q891W1_CLOTE          -------------------------MEKIMFSKILSYDVFKDSKEELLKYMDNFE-----
C4IHX5_CLOBU          -----------------------------MFTKILDFNVFNEDKESLMNYVEGLD-----
A6LS39_CLOB8          -----------------------------MFTKILDFNIFNRDKNALMNYIENFE-----
Q8XJ91_CLOPE          -----------------------------MYKELLGYKIFSDNKEELLKEIENKK-----
D9SMZ3_CLOC7          -----------------------------MASDLLGYKIYSKSMDHLIHEVMVSEN----
Q3A906_CARHZ          ----------------------------MAVIKIYDFPVASLSLNEAVNKVIKLIEERR-
                                                                                  

TAGA_BACSU            --IGAVISTVNPEIAFAAIKDRD----YFDVLSS-SNFILPDGIGVVMMSRLTNNRLQSR
Q65E79_BACLD          --EGAFIATVNPEIGYAAAKDKD----YFKTVSS-ADFILPDGIGIVLTSRLINSRLKSR
TARA_BACPZ            --KGAFIVTANPEIGFEAMQNPR----YEAVLSS-ADFILPDGIGVVMVSKLIGKPLQSR
F9UL35_LACPL          --RNRFVVTANPEILMYAREHPN----YQQVLTQ-ADYITPDGIGVIQGAQILGTPLPER
Q03SY1_LACBA          --QNTFVVTANPEIVMYGHDHPD----YQQLLLT-ADFITPDGIGILNGAQILNQPLPER
J9W243_LACBU          --QNTFVVTANPEIVMYAKANPD----YEKLITT-ADYIVPDGIGIIMGAKMLKTPLKER
C2D5T0_LACBR          --KNTFVVTANPEIVMYARQNRP----YETLIKR-ADYIIADGIGIIIGAKLLKDPLQER
D5H1S9_LACCS          --LSTFIVTANPEIVMAANENPE----FMKILKNDPDYITADGIGIVKAAKMLKQPLPER
Q5FLM4_LACAC          --VSTFVVTANPEIVMAANENPE----FMKILQNDTDYITADGIGIVKAAQMLKTPLPER
TARA_STAA8            -TNNLFIVTANPEIVNYATTHQA----YLELINQ-ASYIVADGTGVVKASHRLKQPLAHR
TARA_STAAR            -TNNLFIVTANPEIVNYATTHQA----YLELINQ-ASYIVADGTGVVKASHRLKQPLAHR
Q5HR98_STAEQ          -DDNLFIVTANPEIVDYATEHEL----YRNLINQ-ADYVVPDGTGIVKASKRLKQPLKRR
Q49VI2_STAS1          -GENLFIVTANPEIVDYATENEA----YRKLINS-ADYVIPDGTGIVKAASILKTPLKTR
A0A033UW49_STAAU      -KDNLFIVTANPEIAHYAYSNNH----YQRRIKH-ADYIVPDGIGIVKAAKYLNTPLKER
A0A0M1UYH9_PAESO      --EKTYIVTANAEIAMYAKQNKD----YENIIKK-ANYIVPDGIGVVKGAKILNQYIPER
I0JRM1_HALH3          --EKSFVITANPEIVMRANQEEA----YMKSLHR-ATYITADGIGIVKASRLLGQTLPER
D7UVX8_LISGR          --KKRFVVTANPEIVMQTRQDNT----FKQVVLQ-ADYIVADGVGILMAAEQFGDPLPER
G4L8T8_TETHN          --KKMSAISVNPQIIVEGQNRSE----IYEFIKK-STHRIPDGIGIVLVSKLLGGQIKER
G4L8S6_TETHN          --KKMSAISVNPQIIIEGQSYPE----IQEFVKE-STHRIPDGIGIVLVSKLTGGQIKER
C9A4H5_ENTCA          --SKMTIVSINPQIVTESKKYPD----IVDFIWR-STHRIPDGIGIVLVSRLTGGSIFDR
Q836E1_ENTFA          --EKMIVTSVNPQISLLAFEHPE----VKLYLKR-ATHRIADGIGVVKASKLMGGSIRER
D6Y043_BACIE          --AQSTLIAINPEKVMTARKNPT----LSRLIEE-ATYQIPDGTGILLASRLKKGVIRER
C5D8D6_GEOSW          --EKSTIVAVNPEKLIAANKDEN----VKQLINS-ATYQIPDGIGVVLASKLKGGRITSR
I0JRN7_HALH3          --RQSFIVAINPEKILQAQKDPN----LKNLLNK-ATYQIPDGVGVLLASKINRGDISSR
A3DIX1_HUNT2          --RVHTVYTPNSEIMMAAQRDPE----LKKILCE-ADLLVPDGAGVVLASKINGCPLKER
E4RPR4_HALHG          --NSSLVVTPNSEMIAMAAEDSE----LAEILNS-AALATADGAGVVLASMIMGDKLPER
Q8R864_CALS4          --RIHIVATPNAEIIMMAQKDEE----YKKILNE-TDLNVPDGSGVVFASRVFNKPLKER
R5IHY4_9FIRM          --KTCYAVTPNAEIAYEALYDET----LRALING-ADLVLPDGAGVVLASKLLKTPLKQK
R6TSE0_9FIRM          --GAHYVVTPNPEIVEVCRADPA----VMDIVNH-ADLVLADGVGVVKGAAMLGTPLKGK
D9RYL6_THEOJ          --GAKIVVTPNAEIIMAAQKNKK----LKDAVNS-ADLSLPDGIGVVLASRLLGRPLEQR
F9MVK5_9FIRM          --KKTRIYTPNTEIVMEAKDKAW----IRDLLNS-GDLRLADGIGLVMGAKINKIPLEER
K0B368_GOTA9          -TKTRTIYTPNTEIIMEARKDSK----LKDILND-GDLVIPDGIGLIHASRIKKKPLPER
D6GQU8_FILAD          --APFVVVTPNSEIVVRANEDVQ----LKQIIEQ-ANLVVPDGIGLVIGSKIVKKPLTER
D1BMX7_VEIPT          --GLHLVATANAEMVMLANENPT----LHSILNN-ASLVVPDGAGILWAAERQGEHVPER
R6AF15_9FIRM          --KPRLIATANAEMIMQAQEDKE----LGRILNR-ADLVVPDGAGVLWAGETLGTPFPER
F6CNV9_DESK7          -GRPHQVITLNPEILYRAQQEPE----LLALINR-ADLVTADGIGVVWAAKVAGTPVPGR
C8VYS2_DESAS          -SKPHFIITLNPEFLYQAQFQHR----LLDLIGG-ADLVTPDGVGIVWACRVAGCPVPER
A5CYH8_PELTS          -GGPHRVITLNPEFLYRARFDGR----LLALVRR-ADLVTADGVGIVWACRMAGRPVPER
Q24MR8_DESHY          -QRPIQVVTANPELIYATGRDVR----LKQLINS-AEVVTPDGVGVVWAAKRLGHPVAER
L0FDS4_DESDL          -HQAIQVVTANPELIYGAGKDAR----LKQLINS-AQIVTPDGVGVVWAAKHLGYPVVER
G7WGF3_DESOD          -KSETRVVTANPEMIYASGQDQN----LKRLINS-ADIVTADGIGVVWAARQLGTPLRER
J7IX20_DESMD          -QLSLRVVTANPEMIYESRKNPR----LRELINS-ADLVTPDGIGVVWAAARLGTPVQER
F0T299_SYNGF          -KKHLRIVTANPEILFRAEKNEE----LRNIVNG-ADLILADGVGIIWAAKVLEGVRLER
Q0AUE3_SYNWW          -NIPSHIITVNAEIVYQAHKDQQ----LREVINS-ASLNTPDGIGIVWAARQLGVTLKER
C8WT65_ALIAD          -GGHHLVVTAGPEFVMQCQRQEA----LLRLVNS-ADLVTADGIGVVWAARRQGRPVPER
J9HLM0_9BACL          -GNHHLVVTAGPEFVMQCQLSES----LLRLVNS-ADLVTADGIGVVWAAAKRGRPVPER
D5WVU2_KYRT2          AGPLKQVVTANPEVVMLARRNPG----VAQVVRR-ADLVTADGIGVVLASTWLGTPVPER
D9SQB3_CLOC7          RSQLFHIITVNPEIAIEIQEDSE----LRKISLE-ADLITPDGIGIVLASRLKRNPVPER
G7MDE6_9CLOT          NNKIFHLITVNPEIAVQIQDDPE----LKKISLE-ADIITPDGVGIVFASRLKRNPVQER
D3EMH0_GEOS4          SGQPHHVITANPIMVMTAVNNPE----YKRMMQG-AEIIVPDGTGIVWAAGVGGDPLEGR
C6D5B3_PAESJ          HKRQTHVITANPIMVMSAVESQD----YYKMMRK-AELIVPDGAGVVWAANYVGTPVTER
A0A0F7R3M9_BACAN      RTHTFQVVTANPEIVMCAKKDEA----FYKTLLN-TDLITPDGIGVVKASGMLGTPLKER
A7GVG0_BACCN          QAHTFQVVTANPEIVMCAKKDSS----FQKTLLQ-ADVITPDGIGVVKASAMLGTPLQER
A0A158RH90_BACC3      QEKPRFVVTANPEIVMSAKENTAKSKQFKKILLS-ADLITADGIGVIIGSKILKGTLKER
R4K3Z4_CLOPA          ---KIHIISGNPEVLYSGLYDNS----IFQGCSEENSVIIPDGIGVVIASKIAKNPVKEK
A0PZR9_CLONN          ---KVNIISGNPEILYMGIKDKF----LNDIYMAKESVIIPDGVGTVIASKIVHDPVSEK
A5N222_CLOK5          ---KVNIVSGNPEILYNGLNDSR----LLRSFTSKSTVIIPDGLGTVLASKIVRPSVKEK
Q891W1_CLOTE          ---KVHIISGNPEVLYNGLNSSI----LYENFIKENSIIIPDGVGTVLASKIVKNPVKEK
C4IHX5_CLOBU          ---KVNIISGNPEVLFNGLNNSM----LHKSFNDKYSLIIPDGVGTVIASKLIKEPVKEK
A6LS39_CLOB8          ---KVNIISGNPEVLFNGLNNLE----LKKNFKSESSIIIPDGVGTVIASKILRKPVKEK
Q8XJ91_CLOPE          ---RVNIISGNPEVLYNGIKNEF----LRNSFTKEDALIIPDGVGTLLAAKINEIDITEK
D9SMZ3_CLOC7          ---KTHIISGNPEVLTSGLKEEE----LFNNFTDKNSIIIPDGIGIVISARLTKVPVEGK
Q3A906_CARHZ          ---KAHIITINPEMIYAALNNPD----LKQLVLNAD-LILPDGVGIVLAGKIKGQSFKER
                              : ..                            .** * :            :

TAGA_BACSU            IAGYDVFKELLGVANKKK--KRIFLYGAKKDVIKGVVSKISSEYPNIKIAGYSDGYVQ-D
Q65E79_BACLD          IAGYDVFINLLSLADRKK--KRVFLYGAKQEVIQAVADRLSTEYPGIELAGYSHGYVK-D
TARA_BACPZ            IAGYDLFTSLLDKADQKK--KRVFFYGAAKHVIAETIERVKRDFPGIEIAGYSDGYVK-D
F9UL35_LACPL          ITGYDTLLTLLEWGSQQH--QRIFLLGAKPAVLKQVTTIVQRDYPGIVVAGARDGYYD-D
Q03SY1_LACBA          ITGFDTLQALLKWGSDQH--RSAYFLGAKPTVIAQLKEVLARDYPGLQVVGLHDGYFK-D
J9W243_LACBU          VTGYDLFVHLLEWGNANQ--KSAYFVGAQPAVIRKLKKVVQENYPFLTIAGTHDGYFG-D
C2D5T0_LACBR          IAGYDLFVSLLEWGSQNH--KSAYFVGAKTEVINKLREVVAQKYAGLKIAGTHNGYFG-D
D5H1S9_LACCS          VTGYDLFTWLMDVANDRG--SRVYLIGAKPQVIHAVQSKIAKEYSNINLVGAEDGYFT-E
Q5FLM4_LACAC          VTGYDLFTWLMSVANERG--SRVYLIGAKPQVIHAVQAKIAKEYSNINLVGAEDGYFR-E
TARA_STAA8            IPGIELMDECLKIAHVNH--QKVFLLGATNEVVEAAQYALQQRYPNISF-AHHHGYID-L
TARA_STAAR            IPGIELMDECLKIAHVNH--QKVFLLGATNEVGEAAQYALQQRYPNISF-AHHHGYID-L
Q5HR98_STAEQ          VPGIELLEECLKIAHVSH--QRVYLLGSKNEIVESAEKKLQSQYPNIHF-AHHHGYIH-L
Q49VI2_STAS1          VPGIELMEECLKIANANN--QKVFLLGAKNDVVMKAEQKLTEKYPDINF-DFHHGFFD-L
A0A033UW49_STAAU      VPGIELMEEMLNIANASS--KRVFLLGSSKEGVKATRKILEEQYPNITF-DHKHGYKH-V
A0A0M1UYH9_PAESO      IPGIELMIDLLEKANDNG--YSVYFYGAREEVLNMMIKNLQVKFPKLNIIGYNNGYDN-D
I0JRM1_HALH3          VTGYDVMIEMLKLADLNH--YRIYLLGAQRDTLEEVKKHIQQFYPHIQVVGSHDGYFDWQ
D7UVX8_LISGR          VTGFDTLTGVLEAASAQR--LRVYFLGAKPEISELMKNTLADAYPALEIVGIRHGYFDVN
G4L8T8_TETHN          VAGIELMYRFLEYANTYK--KSIFLYGAKPEVVADAAEKIQNDYPNLILSGRIDGYTDLS
G4L8S6_TETHN          VAGIELMFRFLDYANTYK--KSIFLYGAKPQVVTDAAKQIKKDYPNLILSDKIDGYTNLS
C9A4H5_ENTCA          VTGYDLMIRILAFANENK--KRIFLYGAKPCILEDTVKNIKHSYPDLIVAGAIDGYNQLK
Q836E1_ENTFA          VTGIDVMDNFLEYANQHK--ERIFLYGAKQEVVEAAAKNIQRQYPGIVISGILHGYTKKK
D6Y043_BACIE          ITGIDTMDALVRLAWERE--EPVFLYGAEDAVVKEAAVTLKKRYLGLKIAGTMNGFQK-D
C5D8D6_GEOSW          VTGIDMMERLIELSAKKG--YRVFLYGAKEEVVKKAKENLEAKYPGLQIVGYSNGYVN-D
I0JRN7_HALH3          VTGIDMLLALCEQASTHD--KSVFLYGAKPGVAEKAKDGLLKKYPNLKVAGVLDGYEK-D
A3DIX1_HUNT2          VAGFDLTNMLFSDEAAKA--VNFFFLGGKPGVAEEAYKNLLDRKININVVGIRNGYFTKD
E4RPR4_HALHG          VAGFDLINHLFSDLEQED--YNFYFLGSKPGIVDRAVVNLKQKYKNLNIAGYHHGYLDKE
Q8R864_CALS4          VAGFDLMMEFVKWASHKD--VSIYLLGAKPEVVEKAQSNLKNLYPSLKIVGFHHGYFNEK
R5IHY4_9FIRM          VAGVDFADRLLSILEKTG--GGLFLLGSKPGVAELAAQKMTEKHPKLYICGMNDGYFKD-
R6TSE0_9FIRM          VPGIEFAMGLMGKLAKEG--RSIYLLGAKPGVAELAGKRLGEQYPGLKIAGTHDGYFKE-
D9RYL6_THEOJ          TTGFDLMMELLKMAADRK--LSIFLLGGKPGVAEDAAKNIKKKFPGIRVAGTHHGYFDES
F9MVK5_9FIRM          VTGFDVSIHLLQIAQREG--YKVYFLGAKKGIAQRAAQEVEEDYPGLVVVGSHHGYYEKS
K0B368_GOTA9          VTGFDLSLKLIELSNKFG--YSIYFLGGKEGVALEAKKKVEEKYPNINIVGIQSGYFKGT
D6GQU8_FILAD          VTGIDLMGALLNHANETK--KTVYLLGGKPGIAEKAGKNIVSQYPNLILLGTHHGYFSGV
D1BMX7_VEIPT          VTGVDVTKELFKVAATHQ--IPVYCLGAAPGVAQRAIDNVSAQVGVLNIAGIHDGFFDSA
R6AF15_9FIRM          VTGADLSVELLKIASKEG--WPVYFLGGAPGVAKKAADRFQKSHGEIRLVGCHDGYFDEE
F6CNV9_DESK7          VTGIDLMLALVARAVREG--WRIFLLGAAPGVAEEAARRLQEKHPGLVVAGTQHGYFRPA
C8VYS2_DESAS          VTGIDLLLYLTERAAREG--WRIFLLGSAPGVAAEAADKLVEKYPGLQIAGTCHGYFKPE
A5CYH8_PELTS          VTGIDLMLSLVERAAAEG--WRVYLLGAAPGVAEEAAKRLILHYPGLTVAGVHHGYFRED
Q24MR8_DESHY          VTGIDLIEALFPIAAEQA--WGVFFLGSQPGVAEKAAEKVAEKHPGF-RWQAAHGYFSRE
L0FDS4_DESDL          VTGIDLVEALLPVAAEKQ--WRIFFLGSQPGVAERAAQKAAEKHPGF-QWQAAHGYFSRE
G7WGF3_DESOD          VTGIDLLQALFPIADRYN--LKIFFLGGRPGVALRAGTLVNEQYPGI-VWDEHHGYFGSE
J7IX20_DESMD          VTGIDLVQSLFPVADQQR--WRIFFLGGKPGVALQAARQVALKYPGI-VWGESHGYFNEE
F0T299_SYNGF          LTGIDLATEIMAAADVEG--RKVFLLGSKPGVAEEAASFLSKKYEKV-QFMTHHGYFGKD
Q0AUE3_SYNWW          VTGIDLLDRICSIAPARG--WKVFFLGAAPGVAEQAASKLLDKYPGLDIVGMENGYFKEE
C8WT65_ALIAD          VTGVELVPQVLSEAMRRNQPLRVYLLGATEASLAACLEQLRAQYPAH-AFAGHHGYFQHP
J9HLM0_9BACL          VTGVELLPAVFRAAEERRQSLRVYLLGASETSLAACLAQLQSAYPTL-AFAGHHGYFSPS
D5WVU2_KYRT2          VTGADLADRLIGFARQRG--WRVYLLGASSASLGGALAELRRHYPEV-DWHGHHGYFDQQ
D9SQB3_CLOC7          VTGYDLLLESLKVGNS--KGWSFYFLGSDEEVNKKTAEYVMKNYPNVKIAGRHHGYFNKE
G7MDE6_9CLOT          VTGYDLFLECLEVGNQ--KGWSFYLLGSDEEVNSKAAEYIIENYSNIKIAGRNNGYFKNE
D3EMH0_GEOS4          VTGFELLHELLKVGET--YRWKFFLLGTTAEVIQEAAERLQMQYPAAIICGYRDGFFGPD
C6D5B3_PAESJ          VTGFDLLHRLMQEGEK--RKWTAYLLGTSTEIIEAAAEKLQLQYPQVRIVGCRNGYFGPE
A0A0F7R3M9_BACAN      VAGFDLMCNLFAKLSEENKPVSVFLLGAKPHVVQAAADHLTKTYSAVSIVGIQDGYFKQE
A7GVG0_BACCN          VAGFDLMNHLFGELSKEKKSVSVFLLGAKPHVVKGAADYLKKTYSAINIVGLQDGYFKPE
A0A158RH90_BACC3      VTGADITHDLIKHCNE--NGYRVFLFGAAPESNKKALEKLNEQFPGAQFKG-QHGFVNGE
R4K3Z4_CLOPA          IAGIEVMDEIIK--LCEREGKGIYLLGAKQELLDECKIRLRDKYKGLNIVGSHNGYFDMD
A0PZR9_CLONN          LAGIEIMEEIIK--KCEKENKGIYLVGAKQEVLENCVKNLLIKYPKLKIEGSHNGYFDLD
A5N222_CLOK5          IAGIEVMEALIE--KCSEEGNPIYLLGARQNILENCIKNLKIKYPNLNIAGSHNGYFDLD
Q891W1_CLOTE          IAGVEFVESLFE--KFEKENKSVYLLGAKKSTLEKFVQTINKKYPKLNIVGKRDGYFNID
C4IHX5_CLOBU          IAGIDVVREVLI--KADKEGRLVYFLGATEEVVLKCVKNIKEDYPNLKIAGYHNGFFDLN
A6LS39_CLOB8          IAGIDIFREILI--KANLEERSIYLLGSKEETIKKCVENIKNEFPKLKISGFHNGFFDLN
Q8XJ91_CLOPE          IAGIEVMNMLLE--EARDKNLKVFLLGAKEETLIKCKEKIKESYDGINIVGSNNGFFDLD
D9SMZ3_CLOC7          IPGIEVLDKILR--EFETKNKSVYLLGATEDTVTKAVAKLKKKYPTLIVAGYHNGFFDLN
Q3A906_CARHZ          VPGIELVEGVIR--KKD--NLKVYLIGAKPGVAEKAAIKLLEFNNTVEIVGIENGYFTND
                       .* :                  :  *                           *:    

TAGA_BACSU            RTL------------------------------------VAKQIARANPDMVFVALGYPH
Q65E79_BACLD          KGE------------------------------------VAKQIAAAKPDMVFVALGYPH
TARA_BACPZ            QRE------------------------------------VADKIAASTPDMVFVALGYPN
F9UL35_LACPL          EQT------------------------------------VVDQIVAAQPDMVFVATGFPK
Q03SY1_LACBA          ATP------------------------------------IVADIQAQQPDMVFAALGFPK
J9W243_LACBU          DRN------------------------------------IVHDIKRTQPDMVFVATGYPK
C2D5T0_LACBR          DRN------------------------------------IINDIRRTQPDMIFVATGYPK
D5H1S9_LACCS          DLEL-----------------------------------VARRIQKAQPDMVFAALGFPK
Q5FLM4_LACAC          DLEL-----------------------------------VARRIQRAQPDMVFAALGFPK
TARA_STAA8            EDET-----------------------------------VVKRIKLFKPDYIFVGMGFPK
TARA_STAAR            EDET-----------------------------------VVKRIELFKPDYIFVGMGFPK
Q5HR98_STAEQ          EDET-----------------------------------VIKRITSFNPDYIFVGMGFPK
Q49VI2_STAS1          TDEM-----------------------------------VLKQVTSFNPDYIFVGMGYPR
A0A033UW49_STAAU      LDYK-----------------------------------VTKKIKKFNPDFIFAAMGFPK
A0A0M1UYH9_PAESO      DNNK-----------------------------------ITNDIINLKPDYIFVAKGYPA
I0JRM1_HALH3          HN-T-----------------------------------ISEEIMQSSPDLVFVALGAPK
D7UVX8_LISGR          ESMA-----------------------------------IAEEIRGSGADFVFVALGAPA
G4L8T8_TETHN          ETE------------------------------------IIEKINYSKPDFLFVALGFPK
G4L8S6_TETHN          EEE------------------------------------VVERINRAKPDFLFVALGFPK
C9A4H5_ENTCA          EEE------------------------------------IVSHINESNSDMLFVALGFPR
Q836E1_ENTFA          QQE------------------------------------IVEQINKAEPRFVFVALGSPK
D6Y043_BACIE          EEK------------------------------------VVEAIRESGAVYLFIAKGSPR
C5D8D6_GEOSW          YDS------------------------------------LVQKINESNADILFVALGSPR
I0JRN7_HALH3          QEH------------------------------------VIQTINEAKPDVLFVALGSPK
A3DIX1_HUNT2          -----------------------------------EEEEIIRQINDSNTDVLLVALGAPK
E4RPR4_HALHG          -----------------------------------LQEEIIAEINAKEIDLLLVGMGVPL
Q8R864_CALS4          -----------------------------------EEENIIEDINKRAAQVLFVALGAPK
R5IHY4_9FIRM          ------------------------------------EAPVIEKINAAKPDVLFVCLGAPK
R6TSE0_9FIRM          ------------------------------------DAPVVEAIRESGADVVLVCLGAPK
D9RYL6_THEOJ          -----------------------------------GEEKVVGIINEASPDILFVAMGAPK
F9MVK5_9FIRM          SLDQ---------------------------DLTQDEEEIIEEIQRLQADIVFVGLGFPV
K0B368_GOTA9          HTGN---------------------------ANHPEEQQIIENINNSKADILFVGFGAPK
D6GQU8_FILAD          HTGK---------------------------KGHAEEKQIVEEIASQKPDLLFVALGAPG
D1BMX7_VEIPT          -----------------------------------EEQEIIKSIADSKAKLVFVALGVPK
R6AF15_9FIRM          -----------------------------------EEKRIIKDIQKSGAKLLLVGLGVPK
F6CNV9_DESK7          EEGPAGEAVGASPAHTPGNSPNDSTGGPPENPKDPTEWDVVEQIRAAKPDLLFVALGAPK
C8VYS2_DESAS          EEK-----------------------------------DLLNRIKESKPDLLFVALGAPR
A5CYH8_PELTS          EEA-----------------------------------AVAGLVRKARADLLFVALGAPK
Q24MR8_DESHY          EEP-----------------------------------ALLEQIREFKPDLLLIGLGAPR
L0FDS4_DESDL          EEP-----------------------------------SLVEQIRNFKPDLLFVGLGAPR
G7WGF3_DESOD          EEE-----------------------------------DVLEKIKCLQPDLLLVGLGSPR
J7IX20_DESMD          EEV-----------------------------------DLLEKIITFQPDILLVGLGAPR
F0T299_SYNGF          EEE-----------------------------------EIIGRIRNFSPDILLVGLGAPK
Q0AUE3_SYNWW          EEK-----------------------------------AVIAKIKALSPHILFIGLGAPK
C8WT65_ALIAD          DLG-----------------------------------RILEEIRAFRPHLLLVGMGQPR
J9HLM0_9BACL          EVE-----------------------------------SILHEVRAFAPHLFLVGMGQPR
D5WVU2_KYRT2          GER-----------------------------------EILQEIAEIRPHLLFVGMGAPR
D9SQB3_CLOC7          EEL-----------------------------------KIVENIKSAKPDILIVALGSPL
G7MDE6_9CLOT          EED-----------------------------------KIVHDINDSKPDILIVALGSPL
D3EMH0_GEOS4          EDA-----------------------------------AVIEQIRAASPDILFVARGADN
C6D5B3_PAESJ          QDA-----------------------------------EVIEAVRQAAPDLLFVARGADT
A0A0F7R3M9_BACAN      EEE-----------------------------------NVVSRIQEAKPDLLLVALGFPR
A7GVG0_BACCN          EEE-----------------------------------NIISRIQEAKPDLLLVALGFPR
A0A158RH90_BACC3      EIE-----------------------------------EVKMKIKQFKPDLLLVGLGSPK
R4K3Z4_CLOPA          NC-----------------------------------EDILQDIKNSQPHAIFVAMGCPR
A0PZR9_CLONN          DC-----------------------------------THITDDIKEKKPYALFVAMGCPR
A5N222_CLOK5          EC-----------------------------------EDIIQNIKESGAHILFVAMGAPR
Q891W1_CLOTE          DC-----------------------------------EELIRNINILRPHAIFVAMGSPR
C4IHX5_CLOBU          NC-----------------------------------EDIIGSIKESRPWAILVAMGSPR
A6LS39_CLOB8          NC-----------------------------------SDIIEDVKSGNPWAVFVAMGSPR
Q8XJ91_CLOPE          NC-----------------------------------DDLIEKINESKADILFVAMGAPR
D9SMZ3_CLOC7          NC-----------------------------------NDIIENIKASNAEAIFVAMGAPR
Q3A906_CARHZ          -------------------------------------EEKIEQIIKGNPELVLVGMGFPR
                                                                 :       .:   *   

TAGA_BACSU            QEKFIHNYRHLF-PKAVSIGLGGSFDVFSGNVKRAPSWMIRLNLEWFYRLILNPWRWKRM
Q65E79_BACLD          QEKFIYEHKHLF-PQAIAIGIGGSFDVFSGKVKRAPKMFIKLNLEWMYRLLTNPTRWKRM
TARA_BACPZ            QEFFIHKYRHLF-PQAVAVGLGGSFDVFSGNVKRAPSFFIRFHLEWMYRLLTNPARWRRM
F9UL35_LACPL          QEFFIAEHRQ-R-LDALWMGVGGSFDVIAGAVKRAPLFWQKHHVEWLYRLIQEPSRFKRM
Q03SY1_LACBA          QEQFIADHRH-V-THGLWMGVGGSFDVLAGVVVRAPKFWQDHHIEWLYRTLKEPKRLKRI
J9W243_LACBU          QEAFINKNRR-A-ADALWIGIGGSFDVLAGTVKRAPKAWQKMHLEWLYRVVKEPSRFGRL
C2D5T0_LACBR          QEEFIDKNRQ-T-TDGLWMGIGGSFDVLTGTVKRAPGSWQKMHLEWLYRVVKEPSRISRL
D5H1S9_LACCS          QEKLLSILRKNE-TPALMMGVGGSFDVFSGIVKRAPEAFQKTHLEWFYRLITNPSRFKRM
Q5FLM4_LACAC          QEKLLSILRKNE-TPALMMGVGGSFDVFSGIVKRAPEVFQKTHLEWFYRLVTNPSRFKRM
TARA_STAA8            QEEWIMTHENQF-ESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRL
TARA_STAAR            QEEWIMTHENQF-ESKVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRL
Q5HR98_STAEQ          QEQWIQKHKDKF-KHTVMMGVGGSFEVFSGSKKRAPQIFRKLNIEWVYRVLIDWKRIGRM
Q49VI2_STAS1          QEQWIERHAHRF-NKTVLMGVGGSIEVFSGTKKRAPVLFRKMNLEWVYRLLIDWKRIGRI
A0A033UW49_STAAU      QEDWIYYNRHHF-EHTVMMGVGGSFDVISGNVKRAPKMFIKLNLEWLYRIITDLKRVNRA
A0A0M1UYH9_PAESO      QDLWIDKVINKV-DKGCFIGVGGSFDVLGGFVKRAPEMWIKLNLEWLYRIAGNPKRWKRS
I0JRM1_HALH3          QENWIAEHIDQF-NKGVFLCVGGSFDVIAGKVKRAPLSWQNKNLEWFYRLLQQPTRWKRM
D7UVX8_LISGR          QEKWILSQLPTF-DKGIFMGVGGSFDVLSGSVKRAPKLWIVLRLEWFYRLMTNPSRWRRY
G4L8T8_TETHN          QEEWLARNIPQL-DASVFQDVGGSFDVFSGHVKRAPQFFIDVHLEWLYRSLTDRKRFKRI
G4L8S6_TETHN          QEEWLARNIERL-DVSVFQDVGGSFDVLSGHVKRAPQFFIDTHLEWLYRSLTDRKRFKRI
C9A4H5_ENTCA          QEQWLARNIREL-NVSIFQDVGGSFDVISGHVKRAPDIFIKFHLEWLYRSLSNPKRLGRI
Q836E1_ENTFA          QEIFLEQTIDHL-TANVFLDVGGTFDVLAGSVKRAPEFYINHNLEWLYRCLT-MKRYDRL
D6Y043_BACIE          QELWIEQYMKDLPDVKVFQGVGGSFDVLAGKVKRAPAGFQKLGLEWLYRLMKEPKRIRRQ
C5D8D6_GEOSW          QELWIKTYMNDL-NVKVMQGVGGSFDVFAGHVKRAPKLFRNLGLEWFYRLVTDPKRFKRQ
I0JRN7_HALH3          QEYWIVDHMKDL-DVRIFQGVGGSFDVISGRVKRAPRFFQKFGIEWLYRLITEPWRLKRQ
A3DIX1_HUNT2          QEKWIHANKEKL-KVKVCIGVGGTFDVLAGRAKRAPVFFQKHGLEWLYRLYKEPWRFVRM
E4RPR4_HALHG          QERFLANNLAKL-KVKVAITVGGSFDVLAGEVNRAPLWMQKVGLEWFYRLIQEPSRFARM
Q8R864_CALS4          QEKWIYKNKEKL-KVKIAMGVGGSFDVIAGKAKRAPEIYRKLGLEWLYRLIQEPWRYKRM
R5IHY4_9FIRM          QELFMKNHLDEL-HIKLMIGLGGSLDSFAGTVKRAPKWMIRCNLEWLYRLIKEPKRFGRM
R6TSE0_9FIRM          QEKWMAKNGTAT-GAHLLCGLGGSLDVFAGVVERAPKFWCDHGLEWFYRLLKEPRRIGRM
D9RYL6_THEOJ          QEIFMAKNRDKL-RCRVAMGVGGSLDVLSGKVRRAPVFMQRAGLEWLYRLITQPSRFRRM
F9MVK5_9FIRM          QEVFIHKASQRL-DRGVWIGNGGVLDILAKEQKRAPEIFIRLHLEWFYRLIKNPSRWKRQ
K0B368_GOTA9          QENWIYENKDKL-NCKIIIGNGGTIDVLAEKVKRAPEIYQKLGIEWLYRLMKDPKRLKRQ
D6GQU8_FILAD          QEYFIDTYKSVL-NAKLLMGVGGSLDVISGEVKRAPEFYQKAGLEWLYRLIKEPSRIGRM
D1BMX7_VEIPT          QEQWIAEKLSHL-DGVVAIGIGGSFDVLAGNIPRAPEWMQQNRLEWLYRLYLEPQRIGRM
R6AF15_9FIRM          QEKWLYRHKDEL-GPVLAMGIGGVFDVMSGNLKRAPLWMQKNRLEWAYRLYLQPSRIGRM
F6CNV9_DESK7          QEKFIARHKEAL-GVPVAMGVGGSFDVIAGRVARAPLWMQRLHLEWLGRLLREPRRWRRM
C8VYS2_DESAS          QELWIDAHLKDL-KVPAAMGIGGSLDVIAGRVPRAPLWLQRLKLEWLGRLIREPSRWRRM
A5CYH8_PELTS          QEIWMDRYLEET-GAAAAVGVGGSFDVIAGRVKRAPAWMRRLHLEWLYRLLSEPSRWRRQ
Q24MR8_DESHY          QEFWMFSHLDL---NTVSIGVGGSFDALAGINKRAPRWIRHIRLEWLYRLLKQPSRLKRQ
L0FDS4_DESDL          QEFWMFSHLDL---NTVSIGVGGSFDALAGINKRAPQWIQNIHLEWLYRLIRQPSRIKRQ
G7WGF3_DESOD          QDYWIAEHSSL---ATVSIGVGGSFDALAGTALRAPKRIRDMKMEWLYRLWKEPWRWRRQ
J7IX20_DESMD          QEYWNAEHPEL---ARVSIGVGGSFDALAGIVDRAPQRIQELKLEWLYRLWKEPWRWKRQ
F0T299_SYNGF          QEQWIYNHPDL---AYVSMGVGGSFDVLSGQVKRAPLWVRRLGLEWLYRLVSEPSRFKRQ
Q0AUE3_SYNWW          QEYFIRRNLKLL-GVPVCIGVGGSFDVLAGIKKRAPRFFIKLNLEWLYRLLAEPSRFKRQ
C8WT65_ALIAD          QELFLRDVMGKL-PPLVGMGVGGSIDVWGGTVRRAPEAFRRMNLEWLYRLITEPKRFRRQ
J9HLM0_9BACL          QEQFLRDVLGRL-PACVGVGVGGSIDVWGGTVTRAPDVFQRLNLEWLYRLLSEPKRWRRQ
D5WVU2_KYRT2          QDMWIAQ-HRDL-PVGVAMGIGGTIDVWSGVVKRAPAAWRRLHLEWLYRLIRQPSRIRRQ
D9SQB3_CLOC7          ADKWIYKNKTQL-NSKVVFGVGGSLDVITGKVKRTPEVWKKLNLEWLFRRINEPSRKERQ
G7MDE6_9CLOT          ADKWIYKHKSEL-NTKVVFGVGGTLDVITGKVKPTPQIWKKLNLEWLHRRITQPSRKERQ
D3EMH0_GEOS4          QEPWIAQHKQAL-QVPVVMGVGGSFDIISGKLKRAPKVFQKLRLEWFYRLLKEPTRYKRM
C6D5B3_PAESJ          QEPWIAKYKKQL-GVPFIMGVGGSFDIIAGKLKRAPVLFQKLRLEWFYRLLQEPKRLPRM
A0A0F7R3M9_BACAN      QENFIQTNKYRL-ETKMAVGVGGSLDVWAGEVKRAPKWIQAIHLEWFYRLCSNPTRWRRQ
A7GVG0_BACCN          QENFIQNNKNRL-QAKMAVGVGGSFDVWAGEVKRAPKWIQAIHLEWFYRLCSNPTRWRRQ
A0A158RH90_BACC3      QEEFIYENIQTL-NIPLSIGIGGMIDIISGTVKRAPKIMRDTGTEWLYRLLSQPKRFKRQ
R4K3Z4_CLOPA          QEKFINKYMSDLP-ASIYMGVGGSFDVIAGKVNRAPRWMINLGLEWLYRVSKEPWRIKRL
A0PZR9_CLONN          QEKFIHNNFENLP-CTVFMGVGGSFDVFAGKVNRAPKWMIKIGLEWLYRVIKEPFRIKRL
A5N222_CLOK5          QDIFIAENMDRLP-CRVYMGVGGSFDVFSGKTKRAPAWMIKSGLEWLYRVFKEPWRIRRL
Q891W1_CLOTE          QESFIIKYMDRLN-VNVFMGVGGSFDVISGEVNRAPKWMINLGLEWLYRVIKEPFRAKRL
C4IHX5_CLOBU          QEIFIEKIKNITD-TKIYMGVGGVFDIFAGNLKRAPKWMISLGLEWMYRVIKEPFRIKRL
A6LS39_CLOB8          QEIFIEKIIGNSN-VHIFMGVGGVFDIFAGELKRAPKWMISLGLEWLYRVAKEPFRIKRL
Q8XJ91_CLOPE          QEVFIEKYKDKLC-CKIFMGVGGSFDVFAGNVNRAPQFMINIGMEWLYRVAKEPWRIKRL
D9SMZ3_CLOC7          QERFIIKYMDILP-CKIFMGVGGSFDIIAGNLKRAPKWMISLGLEWLYRVSKEPFRIKRL
Q3A906_CARHZ          QEIFIRNLLAKSPEPMVAVGIGGSFDVWAGVTKRAPKFMQKAGLEWLWRLIQEPWRYKRM
                       :                   ** ::        :*        **  *      *  * 

TAGA_BACSU            LSIPKYALTVLKEEKNKK--TFYPKPEKDHTKQI-
Q65E79_BACLD          LNIPKYVFSVLKEERVQKQRHYYPEQIKEQSKIDL
TARA_BACPZ            LSIPKYVTAVLKHERASA-KPHYTGQVKDQSRHL-
F9UL35_LACPL          LVLPRYLRLVKKIARQQAH----------------
Q03SY1_LACBA          AVIPHYLRLVRQQAKQKPSR---------------
J9W243_LACBU          MVLPKYLWQIVKQKYSRKSRRAQ------------
C2D5T0_LACBR          SVLPKYLIAVLKERLSGN-----------------
D5H1S9_LACCS          LVLPQFVVRVKQSKKKGK-----------------
Q5FLM4_LACAC          LVLPQFVVRVKQSKK-GK-----------------
TARA_STAA8            KSIPIFMYKIAKAKRKIKKAK--------------
TARA_STAAR            KSIPIFMYKIAKAKRKIKKAK--------------
Q5HR98_STAEQ          ISIPKFMLKVAIQKYKMKSK---------------
Q49VI2_STAS1          KAIPKFLYKVFKLRLKK------------------
A0A033UW49_STAAU      LKIPLFLKEVQFQKSCTPKKNKYDYMKNR------
A0A0M1UYH9_PAESO      IALPKFIIEVLKEKASIKRKDTK------------
I0JRM1_HALH3          LALPRFSYHVIRQKVKRSL----------------
D7UVX8_LISGR          FAIPQFMMAVRREKKRRNR----------------
G4L8T8_TETHN          LQLPIFVIKSLFWKVRTRNDKKSS-----------
G4L8S6_TETHN          LQLPVFVIKSLFWKVRTKDD---------------
C9A4H5_ENTCA          LQLPIFLCKSIVWSMRNHKRDR-------------
Q836E1_ENTFA          MQIPKYIYLTIKYRNNKSRGQ--------------
D6Y043_BACIE          LLLPQFLIRVMMSNGDKQGS---------------
C5D8D6_GEOSW          LALPKFLWKVLWEKPSAE-----------------
I0JRN7_HALH3          IKLPTFLYKVWKERK--------------------
A3DIX1_HUNT2          LDLPRFILRVIANKIRPEKPERA------------
E4RPR4_HALHG          LALPKFIYLVTKKRFLKN-----------------
Q8R864_CALS4          SALPKFAFKVLLARLKGDF----------------
R5IHY4_9FIRM          LRLPKYLFAVLGKRIRG------------------
R6TSE0_9FIRM          MKLPLFLVHVKQEKGKRR-----------------
D9RYL6_THEOJ          SVLPLFLFNVIFRRGK-------------------
F9MVK5_9FIRM          LAIPKFLIQVITKKNAVKIVREDFNENESKGN---
K0B368_GOTA9          MSLPIFVLIVLFSRE--KVVE--------------
D6GQU8_FILAD          AALPKFMIKVIFSKKG-------------------
D1BMX7_VEIPT          LAIPKFMWTVIRNK---------------------
R6AF15_9FIRM          MAIPKFMMAVKKWKRERK-----------------
F6CNV9_DESK7          LVLPRFAWLAWRKARLGK-----------------
C8VYS2_DESAS          LVLPKFALLVIRRHKLKQ-----------------
A5CYH8_PELTS          VACRSLRGRLLKNTG--------------------
Q24MR8_DESHY          LVLPRFAWKVICSGKEQKRTRKVR-----------
L0FDS4_DESDL          LVLPRFAWKVIRSNKEQARTRKTR-----------
G7WGF3_DESOD          RVLPLFVLKVLHQKYLG------------------
J7IX20_DESMD          TVLPRFVIKVLWQKIIT------------------
F0T299_SYNGF          SILPVFVFAILRQKVKKNRPRQR------------
Q0AUE3_SYNWW          LALPRFAWLVLKQKVTRGRFSCH------------
C8WT65_ALIAD          LALPRFALKVISSPAKREAP---------------
J9HLM0_9BACL          LALPKFALRVLMTGGKAETVESK------------
D5WVU2_KYRT2          LVLPHFALLALGAALTTRRRGGPGPK---------
D9SQB3_CLOC7          KKLKVFAYRAFGEAFNKNIK---------------
G7MDE6_9CLOT          KKLKVFAYRAVVETICKNTN---------------
D3EMH0_GEOS4          LALPKFVVKVLREKENVTKSS--------------
C6D5B3_PAESJ          MVLPKFVVKVVRDKENVKKPRPTT-----------
A0A0F7R3M9_BACAN      LVLAEFLKEVMRSKK--------------------
A7GVG0_BACCN          LVLAEFLKEVMRSKK--------------------
A0A158RH90_BACC3      LVLPRFIFSVMSERIKGIN----------------
R4K3Z4_CLOPA          GVIPKLLLKVIYNTYIIKQKVM-------------
A0PZR9_CLONN          AVIPKFLIHVIFSGNKKYSN---------------
A5N222_CLOK5          SSIPKFLLKVIVCNKRFSQ----------------
Q891W1_CLOTE          SSIPKFLVKVIKEKREPNL----------------
C4IHX5_CLOBU          ISIPKFLLIVLNNRNAGKK----------------
A6LS39_CLOB8          MAIPKFLLLVLKYRNKQISV---------------
Q8XJ91_CLOPE          GSIPKFLVLSLKERGKR------------------
D9SMZ3_CLOC7          GVIPKFIIKAVISNRK-------------------
Q3A906_CARHZ          MVLPKFALKVLVDYKLRGRKDW-------------