CLUSTAL format seed alignment for MF_02071

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B2UG58_RALPJ          ------------------------------------------------------------
A5WDP2_PSYWF          ------------------------------------------------------------
D5X6U6_THIK1          ------------------------------------------------------------
E8RSP4_ASTEC          ------------------------------------------------------------
F9ZTH2_ACICS          ------------------------------------------------------------
F5Y5V0_RAMTT          ------------------------------------------------------------
A5FVV7_ACICJ          ------------------------------------------------------------
B6IYQ2_RHOCS          ------------------------------------------------------------
A9HEX8_GLUDA          ------------------------------------------------------------
Q2LU98_SYNAS          ------------------------------------------------------------
A0A0Q0VRN8_9DELT      ------------------------------------------------------------
RLPA_PASMU            ------------------------------------------------------------
RLPA_ECOLI            ------------------------------------------------------------
G8PGE6_PSEUV          ------------------------------------------------------------
Q47JW1_DECAR          ------------------------------------------------------------
C3XAP7_OXAFO          ------------------------------------------------------------
RLPA_NEIMA            ------------------------------------------------------------
RLPA_PSEAE            ------------------------------------------------------------
RLPA_PSEAB            ------------------------------------------------------------
Q5ZSG3_LEGPH          ------------------------------------------------------------
H8L5A5_FRAAD          ------------------------------------------------------------
A1U3B7_MARHV          ------------------------------------------------------------
RLPA_VIBCH            ------------------------------------------------------------
A6VSZ3_MARMS          ------------------------------------------------------------
Q9PBF9_XYLFA          ------------------------------------------------------------
RLPA_HELPY            ------------------------------------------------------------
E8RJE0_DESPD          ------------------------------------------------------------
A0A062TZ58_9RHOB      ------------------------------------------------------------
Q0C174_HYPNA          ------------------------------------------------------------
A0A0F3IQU7_9PROT      ------------------------------------------------------------
Q124M0_POLSJ          ------------------------------------------------------------
F4G645_ALIDK          ------------------------------------------------------------
A0A0M4DDP9_SPHS1      ------------------------------------------------------------
Q2RVL9_RHORT          ------------------------------------------------------------
Q213I6_RHOPB          ------------------------------------------------------------
G4R9N5_PELHB          ------------------------------------------------------------
A0A0Q7ILZ4_9RHIZ      ------------------------------------------------------------
Q926D0_RHIME          ------------------------------------------------------------
B9JWA8_AGRVS          ------------------------------------------------------------
A6X0N7_OCHA4          ------------------------------------------------------------
J7QP88_METSZ          ------------------------------------------------------------
I3TL76_TISMK          ------------------------------------------------------------
B6IMK1_RHOCS          ------------------------------------------------------------
C6XJM6_HIRBI          MARAAQTRNAMRFCIVKRVVLSTAVIVSGVIAPGASAETYNGVPITFVGSSPSTPQYMQI
A0A0N9U883_SPHMC      ------------------------------------------------------------
A7H7G4_ANADF          ------------------------------------------------------------
E1TGZ6_BURSG          ------------------------------------------------------------
Q0BQW6_GRABC          ------------------------------------------------------------
Q47B78_DECAR          ------------------------------------------------------------
M1PKD2_DESSD          -----------------------------------MLEYQVQKGDTITEVTRRLNTNWET
                                                                                  

B2UG58_RALPJ          ---------------MHVRLAAMLKLTRPISSLPAGRTLRAWLTHGTALLVLAGCAAVPS
A5WDP2_PSYWF          ----------------------MKKFTSALCAL-ACMVGATNLAHATDSKQTISVKSPSD
D5X6U6_THIK1          --------------------MSAGGGVWTTAQGGRDSRPRLPGSALAVALLLGLALGGCA
E8RSP4_ASTEC          --------------------MSTQLNLIAKR------------SVQMLVLASIWLLAACA
F9ZTH2_ACICS          ------------------MPTPSPIALWRFGAFGIVLTGLAGCASLPAHHATSSTFGYHA
F5Y5V0_RAMTT          ----------------------------------------------MTHERIAAALAAAV
A5FVV7_ACICJ          --------------------------------------------MGAIILCTAGLAACAA
B6IYQ2_RHOCS          -----------------------------------MPASARPAVFGARLIGATRLVGPPR
A9HEX8_GLUDA          --------MLLADWPSRIGDALKQDRNERRIRSGSQALMALACLFAFASTACGREVTAGA
Q2LU98_SYNAS          -----------------------------------------------------MMHFRNR
A0A0Q0VRN8_9DELT      ----------------------------------------------------------MK
RLPA_PASMU            ----------------------------------------MKQKIFQILTALCCIFYVMS
RLPA_ECOLI            -----------------------------------MRKQWLGICIAAGMLAACTSDDGQQ
G8PGE6_PSEUV          ---------------------------------------------------MSWNNKGLA
Q47JW1_DECAR          --------------------------------MSRFVAPLSLALLLAACGGPSPIRDTTV
C3XAP7_OXAFO          ----------------------------------MLSLKNHRCLVMAAMLASACALILSG
RLPA_NEIMA            -----------------------------------MTLTRKTLFLLTAAFGIHSFQTASA
RLPA_PSEAE            -----------------------------------MSKRVRSSLILPAVCGLGLAAVLLS
RLPA_PSEAB            -----------------------------------MSKRVRSSLILPAVCGLGLAAVLLS
Q5ZSG3_LEGPH          ------------------------------------------------------------
H8L5A5_FRAAD          -------------------------------MRLAAKLVAAWALAGLAACSSQPSRPRAD
A1U3B7_MARHV          --------------------------------------------------MVKVSDKRIP
RLPA_VIBCH            -----------------------------------MNRIYLYLLIVLILAGCSSP-----
A6VSZ3_MARMS          -----------------------------------MRKISTLCWVILSLVLTACA-----
Q9PBF9_XYLFA          -----------------------------------MNTRWYFIALVFDLMACSTTPHKSG
RLPA_HELPY            ----------------------MGLALEKVCFLGVIFLISACTVKKEGVKNLSYKHESLR
E8RJE0_DESPD          ------------------------------------------------------------
A0A062TZ58_9RHOB      --------------------MFAKPQSRSLHFSSLMAIAMVAFSVAGTAEAGKGS-AAPI
Q0C174_HYPNA          ----------------------MPFKRSTFVGRSRVALSVLAFACALSATAEAGSRGAPI
A0A0F3IQU7_9PROT      --------------------------MGQGFFASLILIQLAGCAATPSAPV---------
Q124M0_POLSJ          --------------------MACNTAPGKP-------VHQGAVRVWIVASLLAVLAGCAT
F4G645_ALIDK          -------------------MLERHRQAGAAMVHGMSLVRPSLLRRLLPAVCAAVLAGCAV
A0A0M4DDP9_SPHS1      ------------------------------------------MRRFTVMALPLLLA----
Q2RVL9_RHORT          -------------------MGHRHPPAAAGPTGREQTTQTGAMRFHATAAIAPRSMTKIP
Q213I6_RHOPB          ----------------------MHKPFHAGRRNLASVIASGAQSIRVEAHELPSFLQHRC
G4R9N5_PELHB          --------------------MSSSIGSARRRP----------LFAAIGTTVTAALLLAGC
A0A0Q7ILZ4_9RHIZ      --------------------MRTVTTTSWRHA----------IRLVALAALVAPMIAACG
Q926D0_RHIME          --------------MTSNNGAAYLVRGLRLAA---------VPLLCAVLAACGSTSSVKK
B9JWA8_AGRVS          --------------MVLQR--RSVSGCLRMAW---------VVLAGVAVTSCGANHDVSK
A6X0N7_OCHA4          --------------MDSKRGLKHSVNGKAVKLRDKRSSVVILSFMAIAVALAGCASAPQP
J7QP88_METSZ          ------------MRFVVFKNAAHAPRPLVRSS-----IILSKLLPLICLGALAGCSSTTG
I3TL76_TISMK          -----------------------------------MAPPVDGRAARASRRTLMLTGVALA
B6IMK1_RHOCS          -----------------------------------MLRTDVVRSTLVGMRLPARSMMALA
C6XJM6_HIRBI          ASAPTSSAKVQGGSKRIEYRYPDQPNMSYGKQGPRLLGNNAKPIAFASATSAISRNQAQK
A0A0N9U883_SPHMC      ----------------------MKPSMLY------------RPAGLAAALLMLS------
A7H7G4_ANADF          ------------------------------------MTARRSRP--LGRVALAVLLGAV-
E1TGZ6_BURSG          --------------------MTLASLGAALALTGCVAAGVDTSPSDAGPTGMQTLQGASR
Q0BQW6_GRABC          -------------------MRHLSKRGFPALLSSVLVLGSAGQAFATTHRPSHHVSTRHF
Q47B78_DECAR          --------------------------------MTKRRPWWSKWQRQVAAIACGLLLLNAV
M1PKD2_DESSD          LRKNNPDAIGRSTKNGNWFLKEGSIIGSENSFAKSLQYAEQQQRQEIAAANPISIPRANS
                                                                                  

B2UG58_RALPJ          EPPAGRQSGLQASK----------------------------------------------
A5WDP2_PSYWF          IDSVLNELARKKSQ----------------------------------------------
D5X6U6_THIK1          ------------------------------------------------------------
E8RSP4_ASTEC          ------------------------------------------------------------
F9ZTH2_ACICS          ------------------------------------------------------------
F5Y5V0_RAMTT          ------------------------------------------------------------
A5FVV7_ACICJ          ------------------------------------------------------------
B6IYQ2_RHOCS          ------------------------------------------------------------
A9HEX8_GLUDA          ------------------------------------------------------------
Q2LU98_SYNAS          ------------------------------------------------------------
A0A0Q0VRN8_9DELT      ------------------------------------------------------------
RLPA_PASMU            ------------------------------------------------------------
RLPA_ECOLI            ------------------------------------------------------------
G8PGE6_PSEUV          ------------------------------------------------------------
Q47JW1_DECAR          DGQKGSVSKSPTPTRKPTA-----------------------------------------
C3XAP7_OXAFO          CGTTPTTSGKLASKKAGKI-----------------------------------------
RLPA_NEIMA            ------------------------------------------------------------
RLPA_PSEAE            SCSSKAPQQPARQAGI--------------------------------------------
RLPA_PSEAB            SCSSKAPQQPARQAGI--------------------------------------------
Q5ZSG3_LEGPH          -----MNYVYLKSVAE--------------------------------------------
H8L5A5_FRAAD          AHSLRTGNAYHDNLLL--------------------------------------------
A1U3B7_MARHV          ALALAALLAGCASSPE--------------------------------------------
RLPA_VIBCH            -----------GGR----------------------------------------------
A6VSZ3_MARMS          -----------SGP----------------------------------------------
Q9PBF9_XYLFA          TYPSPATSKITGGKPTQTTNICPPTSPYAPAQELPGTRDGY-------------------
RLPA_HELPY            AYENAKDYDPTTKKAAY-------------------------------------------
E8RJE0_DESPD          ----MVAVKYRARAAVT-------------------------------------------
A0A062TZ58_9RHOB      VYKGQSVGGERIS--SERETVFISPDQARPDRDKARARIQFNYPGQGTGASTIKTAQPVK
Q0C174_HYPNA          VYKSDAMNGAAPSFQTAQAPARASAPAKSAPIDKATARIEFRYPD-----SQPAVGQPVA
A0A0F3IQU7_9PROT      ------------------------------------------------------------
Q124M0_POLSJ          APP-----VQPPS-----------------------------------------------
F4G645_ALIDK          QQPQPAAKSAPPT-----------------------------------------------
A0A0M4DDP9_SPHS1      ------------------------------------------------------------
Q2RVL9_RHORT          AAR-----SRRLP-----------------------------------------------
Q213I6_RHOPB          ELI-----RQRLQ-----------------------------------------------
G4R9N5_PELHB          SGADLFAGNEFFS-----------------------------------------------
A0A0Q7ILZ4_9RHIZ      GGLGATVNRAAFS-----------------------------------------------
Q926D0_RHIME          ---TKSRSKEYFA-----------------------------------------------
B9JWA8_AGRVS          VSTTKKRSKEYFA-----------------------------------------------
A6X0N7_OCHA4          KS-KTKRSKEYFA-----------------------------------------------
J7QP88_METSZ          SHRSAGLGGLGQI-----------------------------------------------
I3TL76_TISMK          A-LALTACAGRPT-----------------------------------------------
B6IMK1_RHOCS          GILLLSACATRAP-----------------------------------------------
C6XJM6_HIRBI          ISGSSYVAPSGVL-----------------------------------------------
A0A0N9U883_SPHMC      ------ACAGGNF-----------------------------------------------
A7H7G4_ANADF          ------------------------------------------------------------
E1TGZ6_BURSG          ------------------------------------------------------------
Q0BQW6_GRABC          SHHASTPRSVYAAYADE-------------------------------------------
Q47B78_DECAR          ------------------------------------------------------------
M1PKD2_DESSD          KIVFPIPQPPPSTPLQEVE-----------------------------------------
                                                                                  

B2UG58_RALPJ          ---------------------------------------PAAPALKLADPRDNPDAWGTL
A5WDP2_PSYWF          ---------------------------------------PTSLLQTSFEPSSLAASSSLM
D5X6U6_THIK1          ----------------------------------------SAPQRSASSGAPINAQEGCH
E8RSP4_ASTEC          ----------------------------------------GGP-KLSTRDEPEVVKNG--
F9ZTH2_ACICS          ----------------------------------------ARVGAAYSNGQVCYAPSP--
F5Y5V0_RAMTT          ----------------------------------------LGAASGTALGQPAEGSAR--
A5FVV7_ACICJ          ----------------------------------------KAPQASLAMPPPAEPPTQAL
B6IYQ2_RHOCS          ----------------------------------------LVGALWLALLLPATGARAG-
A9HEX8_GLUDA          ----------------------------------------ETVPASASPDISSAVGDDGH
Q2LU98_SYNAS          --------------------------------------ISRIARCLLAFQIVFLFAAHPL
A0A0Q0VRN8_9DELT      --------------------------------------TRKVFITHLILYLVMLFINIGC
RLPA_PASMU            --------------------------------------AQAIDAKKLYGLQGPKLIYQAP
RLPA_ECOLI            --------------------------------------QTVSVPQPAVCNGPIVEISGAD
G8PGE6_PSEUV          --------------------------------------HRGSRIYALLLLITAIVIVFVA
Q47JW1_DECAR          -------------------------------VLKRGGGFYKDDGPAEDIPDGLDDIPDAE
C3XAP7_OXAFO          -------------------------------KSQKGGGYYLDDGPMDEIPDNLMEVPDAV
RLPA_NEIMA            ---------------------------------------------------------DAV
RLPA_PSEAE            -------------------------------SGPGDYSRPHRDGAPWWDVDVSRIPDAVP
RLPA_PSEAB            -------------------------------SGPGDYSRPHRDGAPWWDVDVSRIPDAVP
Q5ZSG3_LEGPH          -------------------------------VEDN-FMNYYSILLTIKRLIIGLLPILLV
H8L5A5_FRAAD          -------------------------------AQDRRYRSSHDSVPDGPPPDFSKLPEPVP
A1U3B7_MARHV          -------------------------------VDHSSRYTIKQDRAPSGSFDASGLADATP
RLPA_VIBCH            --------------------------------------YDMSDDQAPDTPLSVEHIEDAH
A6VSZ3_MARMS          --------------------------------------ISRSDS----------------
Q9PBF9_XYLFA          -------------------------------TKNGLYKPGIKDSIPDQLPDVSCIPEPLV
RLPA_HELPY            -------------------------------KRNFFERHFKRYSDSQDSNTKDQPLDNGM
E8RJE0_DESPD          -------------------------------ILLALLLGISFGCASKVPKTREGVTQSGK
A0A062TZ58_9RHOB      REYASISAPLSSMQAPVYDPTVSPKGFDAKAAAAKIVPQQVEPSVEAEALPSLAVPAPGE
Q0C174_HYPNA          GEFKTASAQSGPIAASTRESAYSE-----------------APQMIAPAPPVVEAVSLQA
A0A0F3IQU7_9PROT      ------------------------------------------------AQSVAPVVKPDE
Q124M0_POLSJ          ----------------------------------------GFPPGPATKPAVTAPTAPAD
F4G645_ALIDK          ----------------------------------------AAPPAPAAAAAPPARPAPRE
A0A0M4DDP9_SPHS1      -----------------------------------------------------IPVAAQE
Q2RVL9_RHORT          ----------------------------------------WPAFLAITLTALTAACAQTA
Q213I6_RHOPB          ----------------------------------------SST---MTRSDTIFAASIGA
G4R9N5_PELHB          ------------------------------------------ESSMGVKASPRVTT--SR
A0A0Q7ILZ4_9RHIZ      ------------------------------------------SSEYGVGVSPRVTT--AA
Q926D0_RHIME          ------------------------------------------ESVYGVKASPRVAT--GN
B9JWA8_AGRVS          ------------------------------------------ESAYGVKASPRVVE--NG
A6X0N7_OCHA4          ------------------------------------------ESKYGVKASPRVAFSKGK
J7QP88_METSZ          ------------------------------------------DPRYGVRPSPRVIAE-GE
I3TL76_TISMK          ------------------------------------------QPTSSAPAVGQGTTP--S
B6IMK1_RHOCS          ------------------------------------------APPPAQS--GPAAVP--G
C6XJM6_HIRBI          ------------------------------------------NNSAAAPNRGLRAVKLAS
A0A0N9U883_SPHMC      ------------------------------------------RPVSDTPVR---------
A7H7G4_ANADF          ------------------------------------------------------------
E1TGZ6_BURSG          ------------------------------------------YALQHDGTNEADNSSDTQ
Q0BQW6_GRABC          -------------------------------------TVSADDLNSGELSKFNSANGFSA
Q47B78_DECAR          ------------------------------------------SPAWAAGKKKSAKPAIAR
M1PKD2_DESSD          --------------------------------KQGRIVEHTIQEGETLWGLAVKKYHVHV
                                                                                  

B2UG58_RALPJ          SFRGVPDSSSLKLDENTDTSPGLRADLGTFEQRGLASWYGRGFHGRRTASGERFDMHAFT
A5WDP2_PSYWF          NAKGS-KVSQDNDDVLSHLTLVASNAVNKFKQSGRASWYGGKFHGRKTASGERFDMNSLT
D5X6U6_THIK1          APPPNLRAAYNRTYTVRGRSYSPLRNADGYDEVGIASWYGWESGT-TTSMGTRFNPRDFS
E8RSP4_ASTEC          ----QYRAANLRPYKVRGDTYSPYVPDIGDTLTGTASWYGHESGS-LTATGEHFDPNALS
F9ZTH2_ACICS          ----DLQAAYNQPYEINGHWYHPLTTARNYDVRGIASWYDRASSSSVTAMGTAFHQNALT
F5Y5V0_RAMTT          ------------------------LDHSGRKQVGQASFYADKFTGRPMADGTPMDPRDDN
A5FVV7_ACICJ          PALTVAKRLSTMPPVAVPAVLRPPLDLSGRNETGKASYYARRFAGRRTADGQRFNPHAPM
B6IYQ2_RHOCS          ----------------EPEAGTSAAREPVALDRGEASFYGDGFQGRRTASGERFDQAKPT
A9HEX8_GLUDA          PPTAWAASVRAALARRSQHLMHVGRSALSWSEQGVASWYGHLRRVRPTSSGRAFDPRALT
Q2LU98_SYNAS          QAEDTSELKTDPINQKDISDLQKPE-----GTVGRAYYYRKSLKNKKTSSGAIYCPHKLT
A0A0Q0VRN8_9DELT      QTFSQTQKVDNPDPAQVTSNYSEPD-----GAVGIARYYKKRCNGRRTTSGEIYNPKKLT
RLPA_PASMU            VTKSHHYVVKGVSYRTQTSKEASGY-----ARDGIASFYHKKFNGRKTASGQIYNENLYT
RLPA_ECOLI            PRFEPLNATANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLT
G8PGE6_PSEUV          FILRPHQVEIKTSSQCGEASWYAL--------------------TSQTASGEMMDPSKLT
Q47JW1_DECAR          PKWEPLHKPATKPYVVLGKEYVPNTTVKPYKARGIASWYGKKFHGQKTSIGEPYDMFAMT
C3XAP7_OXAFO          PKVESIRTATARPYVVFGQTYTPMTELQPYKKSGVGSWYGKKFHGQKTSSGEAYDMFAMT
RLPA_NEIMA            VRAEKLHASANRSYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSGGERYDMNAFT
RLPA_PSEAE            MPHNGSVK--ANPYTVLGKTYYPMNDARAYRMVGTASWYGTKFHGQATANGETYDLYGMT
RLPA_PSEAB            MPHNGSVK--ANPYTVLGKTYYPMNDARAYRMVGTASWYGTKFHGQATANGETYDLYGMT
Q5ZSG3_LEGPH          ACTHQQSHGPDH-YVVRGKTYHVMKSAKHYKAKGIASWYGSHARHQKTSTGERYNMYAMT
H8L5A5_FRAAD          KAEPLSLYGNKSPYTVLGRTYKVLPSAHGYVARGTASYYGSKFHRYKTSTLEDYDMYAYS
A1U3B7_MARHV          RYEQPRTAGNKSPYTVWGKRYHVMDSNDGYVQRGTASWYGEKFHGHKTSNGEVFDMYAMS
RLPA_VIBCH            PQYEPYSFGGNKDYNLRGKSYRIIKNPKGFTESGKASWYGKKFHGHLTSNGEIYDMYSMT
A6VSZ3_MARMS          ---------------------------VGFEESGGASYYAMKYQGRKTASGELFDQKAMT
Q9PBF9_XYLFA          TIEPRSAIGNQSPYVVLGKSYRVLDEAKGYIKRGVASYYGTKFHGRLTSNREVYDMYAFT
RLPA_HELPY            RDSSSIQRATMRPYQVGGKWYYPTKVDLGEKFDGVASWYGPNFHAKKTSNGEIYNMYAHT
E8RJE0_DESPD          K--RAKSKATQRPYVINGITYYPIPSAVGYVERGLASWYGEPFHGRKTSNGETYNMYGDT
A0A062TZ58_9RHOB      QGAPQPAQQRAQRQTPATAQAISLDPIPVFDEMGLATTFGDEFEGLPTANGEIFSQNDLV
Q0C174_HYPNA          MPEPAGQGMDYTPLKPVVEASAPADVNAAFAETGIAIVYGDEFAGLPTANGEVFSQTELT
A0A0F3IQU7_9PROT      APIPAPSAYPPAAAPPVLARQAGVPVQ-----QGRPTWYKRSRHTHTTATGEALDDRLFT
Q124M0_POLSJ          PMGGPAPANPSV--AAEPELLAGE--VPRELERGQASWYGPRFHGRRTASGERYDMHALT
F4G645_ALIDK          PALRMKPERRPGEGSGAPALRAPEPEAPVLLASGQASWYADSLHGRRTANGERYDREEFT
A0A0M4DDP9_SPHS1      QIAGDDG---------------------TEMGSGVASYYGNELAGNRTASGERFDPDELT
Q2RVL9_RHORT          PVVAPAPAPMVEVIPAKP-----------AVDRIYVSWYGRSHQGKRTASGEIFDANGMT
Q213I6_RHOPB          ALLAAGPAAAETGRAA-------------------------YYHGGRTASGEVSTAQAFT
G4R9N5_PELHB          NVPKGGGRYVVGKPYTVAGNRFVPREQPDLDVTGRASWYGPAFHGRLTANGEIFDMYSLS
A0A0Q7ILZ4_9RHIZ      NPPKGGGRYQVGRPYTVRGKVYTPAEQPDYVAVGDASWYGADFHGRRTANGEIFSANAIT
Q926D0_RHIME          NIPKGGGRYQVGKPYQVKGRWYQPKEDFGYNKSGMASWYGSAFHGRLTANGEVYDKHHLS
B9JWA8_AGRVS          PVPKGGGRRLVGNPYVVAGKVYKPRENPNYEASGLASWYGSAFHGRYTANGEVYDQYGIS
A6X0N7_OCHA4          PLPRGGGRDQTGQPYKVKGRWYYPKEDKKYVKVGHASWYGEAFHGRLTANGEVYDMTHLT
J7QP88_METSZ          EVPKGGGAYMVGKPYKIAGRTYYPSERP-FRATGMASWYGSDFHGRRTANGEIFDSASIS
I3TL76_TISMK          SSSAARPNQKIGKPYQVMGRWYYPADEPGYREEGVASWYGPTFHGKYTANGEVYDQNALT
B6IMK1_RHOCS          GT------YKVGDPYQINGVWYYPAVDYTYNQTGVASWYGPGFHTRATANGENYNENELT
C6XJM6_HIRBI          TPPAGFAKQKIGAPYEIQGRWYVPFAEPNYDEVGVGSWYGPQFHGKDSAVGEVFDQNALT
A0A0N9U883_SPHMC      ----------IGKPYAVRGTTYVPAAAPAYDMVGYASWYGSE-SGNRTANGEQFRPGWIT
A7H7G4_ANADF          ---AACSHAPRHAP-DESPRRPSAEAPAASGEVGLASFYGKRFHGRRTASGARYDMNAMT
E1TGZ6_BURSG          LPSAAEPHVPAQPANDESPVVPACACGKGFRQTGLASWYGKIFQGRRTASGERYDMHALT
Q0BQW6_GRABC          SGSIQPSTTPARHAIAFQGTIAGQDVQPKPIETGVASWYGKKFRGRVSADGTVFDEHNLT
Q47B78_DECAR          HAKKAAHRVVRPASPASEFGPADLIGDDSPSLHGLASFYGRGFQGRKTSTGERFDINQFT
M1PKD2_DESSD          KDIMADNGISDPTTLQIGQTIKIRLPESSGEEPVVASWYGQDFHGKPMANGDIYDMHAAT
                                                                      :           

B2UG58_RALPJ          VAHPSLPLQSWVLVRNLANDRVVVAKVTDRGPYYGK-RILDMSYAAAKRLDFVKRGSTQV
A5WDP2_PSYWF          AAHPSLPFNTYLRVTNKGNGKSVVVKVNDRGPYHGN-RVLDLSYAAAKQIGLVSRGIANV
D5X6U6_THIK1          AASRVLPLPTCVQVTNLDNGLSALVLVNDRGPFVSG-RLLDLSMGAAQALGVTRT-GTAR
E8RSP4_ASTEC          AAHKTWPLPSVIEVTNLDNGRSLRLRLNDRGPFVDG-RLLDLSKGAAKALGVHQT-GTAR
F9ZTH2_ACICS          AASRVLPLPSCVRVTNLVNGRSVLVLVDDRGPFVSG-RVMDLSLGTAHALGMVTQ-GTTP
F5Y5V0_RAMTT          AASKTLPLGTTARVTNLETGRSAVVTIQDRGPFVPG-RIVDLSPATAERIGLSREDGLAP
A5FVV7_ACICJ          AASKTLPLGTVAKVVNLSNGTSTTVTVADRGPNVES-RMLDVSPEVAIRLGMIRE-GVAR
B6IYQ2_RHOCS          AASKDLPLGTRAEVTHLETGRSVEVTVNDRGPYVEG-RIIDLSKQAAKAVGLTKQEGTAP
A9HEX8_GLUDA          AAHPTLPMGTRVLVRSEDTGRSVVVTVNDRGPFLGS-RIIDLSPAAAARLGMLNA-GTAH
Q2LU98_SYNAS          AAHPTLPLGKKVKVINIGNKKSVVVTVNDRCRKHHF-EFIDLSQAAARALGFFGKGMAMV
A0A0Q0VRN8_9DELT      AAHPNLPLGRLVKVENLSNNKTTIVKINDRCRNHEE-IFIDLSREAARKLGILKQGKTNI
RLPA_PASMU            AAHKTLPLNSYVLVTNLRNQRKVIVRINDRGPFVKG-RIIDLSRAAAREIGLIGSGVGHV
RLPA_ECOLI            AAHPTLPIPSYARITNLANGRMIVVRINDRGPYGND-RVISLSRAAADRLNTSNNTKVRI
G8PGE6_PSEUV          AAHLTLPMGTRVLVTNLTNGKSLTVRINDRGPYAQN-RLIDLSKAAAAELGFIKSGVTQV
Q47JW1_DECAR          AAHPSLALPSYVRVTSVQSGKSVVVRITDRGPFHAD-RVIDLSYTAAYKLGLINGGSGQV
C3XAP7_OXAFO          AAHPTLPIPSYARVTSLETGRQVIVKVNDRGPFLSN-RIIDLSYTAAFKLGYLNKGSGQV
RLPA_NEIMA            AAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGN-RIIDVSKAAAQKLGFVNQGTAHV
RLPA_PSEAE            AAHKTLPLPSYVRVTNLDNGKSVIVRVNDRGPFYSD-RVIDLSFAAAKKLGYAETGTARV
RLPA_PSEAB            AAHKTLPLPSYVRVTNLDNGKSVIVRVNDRGPFYSD-RVIDLSFAAAKKLGYAETGTARV
Q5ZSG3_LEGPH          AAHPTLPIATRVRVKNLNNGRSVVVRINDRGPFLSN-RLIDLSFAAAKKLGI--KGIAPV
H8L5A5_FRAAD          AAHKTLPLPSYVRVTNLANGKSVVVRVNDRGPFKDD-RLIDLSYIAAVKIGIWPSGTGQV
A1U3B7_MARHV          AAHKSLRIPGYARVTNLDNGRSVIVRVNDRGPFHGD-RLIDLSYAAAKKLGYQSRGTARV
RLPA_VIBCH            AAHKTLPIPSYVKVTNTDNGKSTVVRVNDRGPFHDG-RIIDLSYAAAYKIGVVQAGTANV
A6VSZ3_MARMS          AAHKRLPFGSKVKVTNVANGKSVIVRVNDRGPFVRG-RIIDLSKSAFQRIGNARDGVIEV
Q9PBF9_XYLFA          AAHKTLPLPSFALITNLDNGKSVVVRVNDRGPFHDD-RLIDLSYAAAVKLGFTENGLANV
RLPA_HELPY            AAHKTLPMNTVVKVINVDNNLSTIVRINDRGPFVSD-RIIDLSNAAARDIDMVKKGTASV
E8RJE0_DESPD          AAHKTLPMDTMLLVKNLENGRSTVVRINDRGPFVQE-RIIDLTYTKAKALGVVGKGTAKV
A0A062TZ58_9RHOB      AAHPTLPLPSLVEVINPQTNARVIVRVNDRGPFEEG-AMLQLSKRAANELGIGGAGRGNI
Q0C174_HYPNA          AAHPSLPLPSLVSVTNVDTGREVVVRVNDRGPFEDG-ANVQLSRKAAETLGMNGAGKGNV
A0A0F3IQU7_9PROT      AAHLTLPLGSFVRVTDIATGNSVIVRVNDRGPYTRG-FIIDLSKSAADALGVFRNPRMMV
Q124M0_POLSJ          AAHKTLPFGTLVRVRSLVTGREVEVRINDRGPFGAG-RVIDVSRAAAEALGMMGLGVKDV
F4G645_ALIDK          AAHRSLPFGARLCVRSLVNGRTVIVRVNDRGPFTPG-RIIDLSRAAAEELGMVGLGIKPV
A0A0M4DDP9_SPHS1      AAHRTLAFGSRVRVTNTANGKSVVVRINDRGPFSRG-RVIDVSSAAAREIGMHRSGTAKV
Q2RVL9_RHORT          AAHPKLPFGSKVKMRNPESGQSVVVRVNDRGPFVST-RGMDVSEAAAKALGIWAKGIALV
Q213I6_RHOPB          AAHRTLPFGTKVLVTHIGNGRSVVVRINDRGPFGRG-RIIDVSTAAARELDMIASGTAMV
G4R9N5_PELHB          AAHPTLPLPSYVRVTNADTGATTIVRVNDRGPFSYE-RTIDLSRRAAEVLGFQQQGTANV
A0A0Q7ILZ4_9RHIZ      GAHPTLPLPSYVRVTNQANGRSVIVRVNDRGPYMPG-RIMDLSYRAAAMLGYVNNGHTQI
Q926D0_RHIME          AAHPTFPLPSYARVTNLENGTSVIVRVNDRGPYEYG-RIIDVSSKTADLLDIKRKGSANV
B9JWA8_AGRVS          AAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPFHAN-RLIDLSDKAAELLDVKGHGTANV
A6X0N7_OCHA4          AAHPTMPLPSYARVTNLANGSSVIVRVNDRGPYEYD-RVIDLSQKAAEMLDYQHHGTANV
J7QP88_METSZ          AAHPTMPLPSYARVTNLRNDRSIVVRVNDRGPYHGG-RVMDVSQRVAQALDFHGVGTTRV
I3TL76_TISMK          AAHTTLPLPSIVRVTNLENGRVLIVRVNDRGPFVGD-RVIDLSKRSAQLLGVIQKGTARV
B6IMK1_RHOCS          AAHQTLPMPSLVRVTNLENGRSIVVRINDRGPFVPG-RIIDMSRRGAQLLGFEQQGTAKV
C6XJM6_HIRBI          AAHPTLPIPSLARVTNLENGRSVVVRINDRGPFVDD-RIIDLSKQSATVLGYKDNGTAKV
A0A0N9U883_SPHMC      AAHTTLPLPAYVEVTALDTGRRIIVRINDRGPFAAG-RIIDLSRGAAEELGMKAQGHAAV
A7H7G4_ANADF          CAHPRAPFGARLKVTDLENGRSVVVTVNDRGPFKRG-RVVDLSRAAARKLGMIERGLARV
E1TGZ6_BURSG          AAHRTLPLGACVRVTSLARMRSVVVRINDRGPFVRG-RIIDLSYAAAEALGVRGAGSAQV
Q0BQW6_GRABC          AAHRWLPLGSKVRVTLADSGRYVDVTITDR-PGTRK-RVIDLSRGAAAELGIISQGTAKV
Q47B78_DECAR          AASNHFPLGTMLAVRRVDNDRCAIVKVNDRMHAKHRKRVIDVSRSVAEYLEMIHAGVVFV
M1PKD2_DESSD          IAHKEMPLGTRVELKNTETGEKVRAVVTDRGPYIDG-RDVDLSYGLAKKLSLVEQGVGSL
                       *     :     :            : **         :.::      :          

B2UG58_RALPJ          EIRRLSRAEVEALRPELTQTDVASNDG------------------------DADVGGDEP
A5WDP2_PSYWF          TIERVGSP----------------------------------------------------
D5X6U6_THIK1          VRIVALPEGANAPLQIAQATTPQPSPQTGSAPVVSQPSTSLSEQPAFAPQQFAAAPVTQV
E8RSP4_ASTEC          VRIKFLGPAVLGARPTYAAATPEV------------------------------------
F9ZTH2_ACICS          VQIQAVANSPGMPAVDSPQLTPVRSTMPPPEPTAVTSTGAPPSTYASPAAQARLQAVVED
F5Y5V0_RAMTT          VEVAPIEVPQPGGGVRRGVGAR--------------------------------------
A5FVV7_ACICJ          VLVEPITIPEPDGKVKLGAGAAHA------------------------------------
B6IYQ2_RHOCS          VEVVARPSDQPTEELRRKVLEVAN------------------------------------
A9HEX8_GLUDA          VVLQPAPVTEVAQAESTDTSADAI------------------------------------
Q2LU98_SYNAS          QIIPFEE-----------------------------------------------------
A0A0Q0VRN8_9DELT      RITIVDKNDL--------------------------------------------------
RLPA_PASMU            RVELIQLDRQ---------------------GRISGAASATLAKLAKNQEAVNMLLQGED
RLPA_ECOLI            DPIIVAQDGS---------------------LSGPGMACTTVAKQTYALPAPPDLSGGAG
G8PGE6_PSEUV          KISVANE-------------------------FKQHLKGHKCNNQQYTFNSAANTLTE--
Q47JW1_DECAR          EVEAIIPGDL----------------------AGTTYAQTTSPPRVTSTTNGDDIEQLAK
C3XAP7_OXAFO          QVELLLPDEI----------------------ERINLARNNAYSPIDKPVAVAKAPVQQT
RLPA_NEIMA            KIEQIVPGQ---------------------------------------------------
RLPA_PSEAE            KVEGIDPVQWWAQR-------GRPAPMVLAQPKQAVAQAAPAAAQTQAVAMAQPIETYTP
RLPA_PSEAB            KVEGIDPVQWWAQR-------GRPAPMVLAQPKQAVAQA-PAATQTQAVAMAQPIETYTP
Q5ZSG3_LEGPH          EIEVV-------------------------------------------------------
H8L5A5_FRAAD          EVRALDPGSVSPPRPLPPPAVKPPDSVRAWQAIAPAPAPAAAVARNATEAMAPVSRAELP
A1U3B7_MARHV          EVAAI--------------------TVRPDGAMFLAGKPFDAAGQ---------------
RLPA_VIBCH            RIEVITVD----------------------KPTKPRPKSKNNALEYVIQVVSSQHIERVR
A6VSZ3_MARMS          EIEVLR------------------------------------------------------
Q9PBF9_XYLFA          EVRVLSEDDNPMLLARHNKRIAPTAANPIATTMAPMATTQPPTTNIATAAKPDNPINHLQ
RLPA_HELPY            RLIVLGFGGV-------------------------------------ISTQYEQSFNASS
E8RJE0_DESPD          EIVALGAQEP-------------------------------------EEAPAVAVAPPAA
A0A062TZ58_9RHOB      KLRYLGAAPAIAPGTHRGTPAASYQSV-----------------SAEPPQAATPAPVYTY
Q0C174_HYPNA          RLRYLSPAPVVATRPAAKTSSAPALLR-----------------ESPVAQPAVSQAVSAP
A0A0F3IQU7_9PROT      SLELLSDKP--------DADHLSVPVS-----------------TLPTGAAALAALGGKP
Q124M0_POLSJ          -LLLVPESTPVVEAPVPPVAK-------------------------KRRARKVHQGRSGG
F4G645_ALIDK          ELWQLGADDEACPESLEPAAQGSGLGL-----------------DAEAAAKALQQPAPKA
A0A0M4DDP9_SPHS1      SMTLLGADTKLAENS--------------------------------RAAGTVGIAD---
Q2RVL9_RHORT          EVESPLLGRPITPGRFTVDSLASSR-----------------------------------
Q213I6_RHOPB          RIDPQ-------------------------------------------------------
G4R9N5_PELHB          RVQYIGPAPLEGDDTKFLVASINQLTPYEI--------QNNTRMAFQEPVQVADTAPAQA
A0A0Q7ILZ4_9RHIZ      QAEYVGPAPLEGDDTRMLMASYSGPADFGG--------GNTQFAQADNTNSLADIAGNFF
Q926D0_RHIME          RVQYVGRAPLEGNDMPYLMASYVRKGDRGPSVMPEG--QIASGVMVASNEPLRDMVPNLR
B9JWA8_AGRVS          KVKYVGPADMTGHDMPYLMASYVRKGQRVPGVDPFGGGQIASGVMVASNAPQQNFFGRFA
A6X0N7_OCHA4          KVEYVGRAPLNGNDDAFLMASYRPAGGDAIG-------QPATGVMMAMNGPTPTSPKSRV
J7QP88_METSZ          KVEWVGRADLEGDDDEKLLATLRDDGQ---------PAQLDAPVMTAANEDPARATRYDE
I3TL76_TISMK          RLENVTEEY-GLDYLPEADGVMLASLG--------------AEATATPPATSPRGPVVAT
B6IMK1_RHOCS          RVQILADESRAIAAAAQSGRVQVASDG--------------GPVPKASPRPSVQVEGEAL
C6XJM6_HIRBI          RVQYMGYAPEAHNSIPAKYVEEARQTL--------------AKGKAEAPANPMLMKASYS
A0A0N9U883_SPHMC      RVRRVEPS------------EKDRKRL--------------RKGKAAASLSPVPQ-----
A7H7G4_ANADF          RVERAD------------------------------------------------------
E1TGZ6_BURSG          RIEHIAPVRGADGARRCMDLPASA------------------------------------
Q0BQW6_GRABC          TLSQL-------------------------------------------------------
Q47B78_DECAR          RIAPVKKGERGERGE-------------------------------GAGACRAAFEPELP
M1PKD2_DESSD          VMRVL-------------------------------------------------------
                                                                                  

B2UG58_RALPJ          APAKKKAMKRRAKHR---------------------------------------------
A5WDP2_PSYWF          ------------------------------------------------------------
D5X6U6_THIK1          PSMPTPGASLPPQAPEPAPIEVQTLPPLTPASLSTFVPAVSDPQAALPAAAASIQPPMPQ
E8RSP4_ASTEC          ------------------------------------------------------------
F9ZTH2_ACICS          AFASNPARPVVIAHEEAPETARAPEVAPTNTATRTQRQ----------------RRQRNP
F5Y5V0_RAMTT          ------------------------------------------------------------
A5FVV7_ACICJ          ------------------------------------------------------------
B6IYQ2_RHOCS          ------------------------------------------------------------
A9HEX8_GLUDA          ------------------------------------------------------------
Q2LU98_SYNAS          ------------------------------------------------------------
A0A0Q0VRN8_9DELT      ------------------------------------------------------------
RLPA_PASMU            TVELTQHTEEKTVKAATTKPEKYTTVYKIRILNLDSKKQAEKLISKLGREDIRADITVNQ
RLPA_ECOLI            TSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPAPQPVVT
G8PGE6_PSEUV          ------------------------------------------------------------
Q47JW1_DECAR          RMALEERPVQTAVMAGMSGDTGIQKGIYLQLGAFSNVENAENLKNHLLRELDWLT--ETM
C3XAP7_OXAFO          RTVVEANAVKPASKP-VSKVSTAGPGYYLQLGAYQEASNAQSYQMKFASNMSHKL--PSL
RLPA_NEIMA            -----------------SAPVAENKDIFIDLKSFGTEHEAQAYLNQAAQNLASSASNPNL
RLPA_PSEAE            PPAQHAAAVLPVQIDSKKNASLPADGLYLQVGAFANPDAAELLKAKLSGVTAAPVFISSV
RLPA_PSEAB            PPAQHAAAVLPVQIDSKKNASLPADGLYLQVGAFANPDAAELLKAKLSGVTAAPVFISSV
Q5ZSG3_LEGPH          ------------------------------------------------------------
H8L5A5_FRAAD          AATALPTKPAAAPPAPMATAAVGAGGLYLQAGAFGDRANAERVATRIRATGVAVQVVSGL
A1U3B7_MARHV          -------APVVASQASGTTELAAGEGLFVQLGAFSQRDPAEAMRERLLGVLDNPVRVREI
RLPA_VIBCH            TLAQNLGQNLSAPSFVESTNNTHR------------------------------------
A6VSZ3_MARMS          ------------------------------------------------------------
Q9PBF9_XYLFA          PLPTNAPLIAALTPIGSPTTIATRQPKSPTITSTNVSKATPPSEATKDTLTDSVHTSQVT
RLPA_HELPY            SKILHKEFKVGESEKS-----VSGGKFSLQMGAFRNQIGAQTLADKLQAE--NPNYSVKV
E8RJE0_DESPD          GKPAQLAKPKAKPKKAPPIPDFDKGNFYVQVGAFVKIENARTLAKAFAKRGRDVIIQQYP
A0A062TZ58_9RHOB      TPVAAEPTPAAAAPSRYQPQTM--------------GDYYVQVGAFSDISNAQD------
Q0C174_HYPNA          VAAEDELLGGGASAPRLMSMTVAPPAPAYTAPASATGDVFVQLASFSDIGNAEA------
A0A0F3IQU7_9PROT      KPASAAKAKPGGAKSAKMPTKP--------------APVKATLAKPTPAAKAAP------
Q124M0_POLSJ          NAL---------------------------------------------------------
F4G645_ALIDK          KAPAARKPRRNKRR----------------------------------------------
A0A0M4DDP9_SPHS1      ------------------------------------------------------------
Q2RVL9_RHORT          ------------------------------------------------------------
Q213I6_RHOPB          ------------------------------------------------------------
G4R9N5_PELHB          STPVAPVPTPRPSTATEAAGAIAAPEYIPFRVLSYVGATSLETASEPTGTPLRM------
A0A0Q7ILZ4_9RHIZ      GNLFSYADTTPQEQDAAIGTAFAAVNAMATRA---GGLDDWAQSVDMDARNIKL------
Q926D0_RHIME          AVPVPNKSMLDAGVPVNALAKPAQAPA---ATSAFGEFVVLPQIGPMPTSRPQL------
B9JWA8_AGRVS          GPASASAPQPKTAKPVIAPASASAYGSNSYPVSASANAPRPVQRQPVAVSRPEP------
A6X0N7_OCHA4          PMPVMDAVPVSAPIPENSPFAVDPAYS----DPSGGAAPMLPANVPVPSQRPGSSFGVAN
J7QP88_METSZ          RAEVAELSARVAYENGPASDDQARAYAR-----QESDAPLPPLREQAGID----------
I3TL76_TISMK          ASIVEE---QVEAVPAGEVFATPV------PPPAGTRTAPGSDRTYVQVGAFRE------
B6IMK1_RHOCS          PPQQERPAGRPAPVPTGVPGRTAEDGRFLPAPVVEQRPVSGPQRLWVQAGAFTI------
C6XJM6_HIRBI          PRPIQRQMMPLQQASLPLSFSNQE-------------------KYVLQAGVFGE------
A0A0N9U883_SPHMC      -RELERLRMRLPAKAR--------------------------------------------
A7H7G4_ANADF          ------------------------------------------------------------
E1TGZ6_BURSG          ------------------------------------------------------------
Q0BQW6_GRABC          ------------------------------------------------------------
Q47B78_DECAR          CTTCTQPAKLPEFLPGSDG-----------------------------------------
M1PKD2_DESSD          ------------------------------------------------------------
                                                                                  

B2UG58_RALPJ          ------------------------------------------------------------
A5WDP2_PSYWF          ------------------------------------------------------------
D5X6U6_THIK1          PALNLPANSASPQNYVQTGAFTLQANAEAEKARLQAAGIDDVLVVPGYIRGQTFYRVQIG
E8RSP4_ASTEC          ------ADGDRQRYRVQVGAFSERANAERVSDQLRARVDE----------RRGLYVVTLG
F9ZTH2_ACICS          QPRQWPSAGLQPALYLISADPMDLDRAREEQRRLQEFGISTAQLVD---VHGRGYAVRIG
F5Y5V0_RAMTT          ------------------------------------------------------------
A5FVV7_ACICJ          -------SKAQIAAAIGTSRRVMRQDGIRVADR---------------------------
B6IYQ2_RHOCS          -------GDDGEQAPPAPAATRP-------------------------------------
A9HEX8_GLUDA          -------AAAAPGAPRRVAHHAGR------------------------------------
Q2LU98_SYNAS          ------------------------------------------------------------
A0A0Q0VRN8_9DELT      ------------------------------------------------------------
RLPA_PASMU            DKFDIYFGPFSDKSQVNDVKAQLRKLNYSKPLIVYTFDD---------------------
RLPA_ECOLI            APSTTPATSPAMVTPQAVSQSASGNFMVQVGAVSDQARAQQYQQQLGQKFGVPGRVTQNG
G8PGE6_PSEUV          ------------------------------------------------------------
Q47JW1_DECAR          RVNPGSGIHRLHLGPYANRGDADRVAEKISAVLGFRPTVITR------------------
C3XAP7_OXAFO          EIVQMGNFYKLLAGPYPSLADATQAVEEMKS-MGTKSFVVRR------------------
RLPA_NEIMA            SVEKRRYEYVVKMGPFASQ---ERAAEAEAQARGMVRAVLTAG-----------------
RLPA_PSEAE            VRNQQ-ILHRVRLGPIGSADEVSRTQDSIRVANLGQPTLVRPD-----------------
RLPA_PSEAB            VRNQQ-ILHRVRLGPIGSADEVSRTQDSIRVANLGQPTLVRPD-----------------
Q5ZSG3_LEGPH          ------------------------------------------------------------
H8L5A5_FRAAD          SAGK--VVQRVRVGPLPDAAAAGQAARRIELLGLPRPQPAPSPL----------------
A1U3B7_MARHV          TTDNG-RFHRVQVGPFKSEGDARYAQNLLESRGFRQSIVLTDSH----------------
RLPA_VIBCH            ----------LFLGPFTDDDLTQTLLEQVKSAGYDSAFIKTINKRAK-------------
A6VSZ3_MARMS          ------------------------------------------------------------
Q9PBF9_XYLFA          ATTAL-DSILVQVASFTSHENASRALTQLTSAGIVGANLSAIVNSGRTFWRLRINAPNHD
RLPA_HELPY            AFKDD--LYKVLVQGFQSEEEARDFMKKYNQNAVLTRE----------------------
E8RJE0_DESPD          AAGMN--LYRVMIFASNSLAKAKQYEQQMKNEGFRYALLLAR------------------
A0A062TZ58_9RHOB      -----------------------LERRLPAGMATVVVPARVN------------------
Q0C174_HYPNA          -----------------------LLRNVEASLPVEIVPARVN------------------
A0A0F3IQU7_9PROT      -----------------------VKPKAMAQKPAAKTP----------------------
Q124M0_POLSJ          ------------------------------------------------------------
F4G645_ALIDK          ------------------------------------------------------------
A0A0M4DDP9_SPHS1      ------------------------------------------------------------
Q2RVL9_RHORT          ------------------------------------------------------------
Q213I6_RHOPB          ------------------------------------------------------------
G4R9N5_PELHB          ----------ALGTWNDEARAREIATRFAVIGAVDTATLVQG------------------
A0A0Q7ILZ4_9RHIZ      ----------GLGIFADQGNAVALAERFALLGAVDEEAVTVN------------------
Q926D0_RHIME          ------IPLPDGSMAYAAAYVEARVSDKPSPFEAIMVDRNP-------------------
B9JWA8_AGRVS          ------TRIEPTREWQAPAIASAEPMPQPRNAASTGVARREM------------------
A6X0N7_OCHA4          AAGVSGLAGYASDRLAATAYAEERAYGSILTKDAISSAWKRREAEEHGEYVEIGTFKTLE
J7QP88_METSZ          -----------KEPVASTQKARKVVAPLPPVRPAQFAARQAS------------------
I3TL76_TISMK          -----------------PENARALENRLLDYGHTVIAPADVD------------------
B6IMK1_RHOCS          -----------------YDNANRLRAKLSRIGPTLISTAMVG------------------
C6XJM6_HIRBI          -----------------LANAHQLRAKLHTYGQVSVKETRIN------------------
A0A0N9U883_SPHMC      ------------------------------------------------------------
A7H7G4_ANADF          ------------------------------------------------------------
E1TGZ6_BURSG          ------------------------------------------------------------
Q0BQW6_GRABC          ------------------------------------------------------------
Q47B78_DECAR          ------------------------------------------------------------
M1PKD2_DESSD          ------------------------------------------------------------
                                                                                  

B2UG58_RALPJ          ------------------------------------------------------------
A5WDP2_PSYWF          ------------------------------------------------------------
D5X6U6_THIK1          PITGAAPDATLVQKLQGLGLSGYSVVQQ--------------------------------
E8RSP4_ASTEC          PFEGAQKAELYRQKVLAAGYFDAILTRDE-------------------------------
F9ZTH2_ACICS          PMAPTSSPTTYLRSLRRLRLGDFTVSRENG------------------------------
F5Y5V0_RAMTT          ------------------------------------------------------------
A5FVV7_ACICJ          ------------------------------------------------------------
B6IYQ2_RHOCS          ------------------------------------------------------------
A9HEX8_GLUDA          ------------------------------------------------------------
Q2LU98_SYNAS          ------------------------------------------------------------
A0A0Q0VRN8_9DELT      ------------------------------------------------------------
RLPA_PASMU            ------------------------------------------------------------
RLPA_ECOLI            AVWRIQLGPFASKAEASTLQQRLQTEAQLQSFITTAQ-----------------------
G8PGE6_PSEUV          ------------------------------------------------------------
Q47JW1_DECAR          ------------------------------------------------------------
C3XAP7_OXAFO          ------------------------------------------------------------
RLPA_NEIMA            ------------------------------------------------------------
RLPA_PSEAE            ------------------------------------------------------------
RLPA_PSEAB            ------------------------------------------------------------
Q5ZSG3_LEGPH          ------------------------------------------------------------
H8L5A5_FRAAD          ------------------------------------------------------------
A1U3B7_MARHV          ------------------------------------------------------------
RLPA_VIBCH            ------------------------------------------------------------
A6VSZ3_MARMS          ------------------------------------------------------------
Q9PBF9_XYLFA          TALELIRRITHLGLGRPEIVGL--------------------------------------
RLPA_HELPY            ------------------------------------------------------------
E8RJE0_DESPD          ------------------------------------------------------------
A0A062TZ58_9RHOB      --------GADYFRVRVGPFMSRDSADRIQADLRAYGFGTGRVVTAN-------------
Q0C174_HYPNA          --------GADFFRVRVGPFQDHAAAEQIRANLSLNGTADGRIVTGY-------------
A0A0F3IQU7_9PROT      ------------------------------------------------------------
Q124M0_POLSJ          ------------------------------------------------------------
F4G645_ALIDK          ------------------------------------------------------------
A0A0M4DDP9_SPHS1      ------------------------------------------------------------
Q2RVL9_RHORT          ------------------------------------------------------------
Q213I6_RHOPB          ------------------------------------------------------------
G4R9N5_PELHB          --------DQTVTHLMLTHLREGVTETDAVELASSLGLSAPILY----------------
A0A0Q7ILZ4_9RHIZ      --------GGPATRLTLTHLKPGVSRIDVLDLARELGLNDLKLN----------------
Q926D0_RHIME          -------LTPDSILAYAKRQHRNADSR---------------------------------
B9JWA8_AGRVS          ----APVVAPQPVRATATRQKPVAAPSNGGLPPGWHVGPAPVTANAYSNPNEG-------
A6X0N7_OCHA4          EARQVQASLPGSIRFTLTKIPTETSELYELTAVAEKGGNDALLRAAWKVGAENAFVVRLD
J7QP88_METSZ          --------ARNAIRQALNSSVRTN------------------------------------
I3TL76_TISMK          --------GQRFYRVRIGPFKASRDAEKVVARLSRDGYGRGSIVTD--------------
B6IMK1_RHOCS          --------NTEFFRVRVGPLPTVERADAVLAQVIADGSNAARVIVE--------------
C6XJM6_HIRBI          --------GRDMFKVFVGEWQTRDQAVKARANLAGSGFETLIVSN---------------
A0A0N9U883_SPHMC      ------------------------------------------------------------
A7H7G4_ANADF          ------------------------------------------------------------
E1TGZ6_BURSG          ------------------------------------------------------------
Q0BQW6_GRABC          ------------------------------------------------------------
Q47B78_DECAR          ------------------------------------------------------------
M1PKD2_DESSD          ------------------------------------------------------------