CLUSTAL format seed alignment for MF_02074

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNLS_PSE14            --MTVPIAIIGTGIAGLSAAQALTSAGHQVHLFDKSRGSGGRMSSKRSDAGSLDMGAQYF
A0A0P9MY51_PSESX      --MSLSQSSVPVS-PDSQQPRRLHQPGIRCTFSTKA---AXXXXXERSDAGSLDMGAQYF
RNLS_PSESM            --MTVPIAIIGTGIAGLSAAQALTAAGHQVHLFDKSRGSGGRMSSKRSDAGALDMGAQYF
W0H4A7_PSECI          --MTVPIAIIGTGIAGLSAAQALKAAGHDIHLFDKSRGSGGRMSSKRSEAGSLDMGAQYF
Q4K6B1_PSEF5          --MTVPIAIIGTGIAGLSAAQALRDAGHTVHLFDKSRGSGGRMSSKRSDAGSLDLGAQYF
G8QBV7_PSEF3          --MTVPIAIIGTGIAGLSAAQALTEAGHIVQLFDKSHGSGGRMSSKRSDAGALDMGAQYF
A0A109LJZ0_PSEFL      --MTVPIAIIGTGIAGLSAARALQDAGHAVHLFDKSRGSGGRMSSKRSDAVALDMGAQYF
L1LUN8_PSEPU          --MTVPIAIIGAGIAGLSAAQALQKQGLAVHLFDKGHGSGGRMASKRSDAGALDLGAQYF
J8S161_PSEPU          --MTVPIAIIGAGIAGLSAAQALQKAGQSVHLFDKGHGSGGRMASKRSEAGALDLGAQYF
M4X0R1_9PSED          --MSAPIAIIGTGIAGLSAAHALRDAGQDVQLFDKGHGSGGRMASKRSEAGALDLGAQYF
A0A024HAZ0_PSEKB      --MSAPIAIIGTGIAGLSAAHALLDAGQEVRLFDKGHGSGGRMASKRSEAGDLDLGAQYF
Q9HVD5_PSEAE          --MSVPIAIIGTGIAGLSAAHALRSAGQTVQLFDKGHGSGGRMASKRSEAGTLDLGAQYF
I4JJS0_PSEST          -MSKAPIAIIGTGIAGLSAAQALRAAGQDVQLFDKSRRCGGRTASKQIESGSFDLGAQYF
A4VMG6_PSEU5          -MSKAPIAIIGTGIAGLSAARTLHDAGQAVHLFDKSRGSGGRMASKRSDAGSLDLGAQYF
F6AAH1_PSEF1          MTNAAPIAIIGTGIAGLSAAEALHAAGYPVQLFDKSRGSGGRMASKRSDAGALDLGAQYF
C1DEU3_AZOVD          --MTFPIAIIGTGIAGLSAAGALRAAGLEVQLFDKGRGSGGRMASKRTEVGALDLGAQYF
A0A0B3BXE1_9PSED      -MQNNPIAIIGSGIAGLAAARTLAEAGRSVQLFDKSRGSGGRLASKRSNIGDLDIGAPYF
K5Z6H2_9PSED          --MTQKIAIIGAGMAGLSAARALQQAGLPVQLFDKSRGSGGRISSKRSEIGALDLGAPGF
A0A1H1WCJ2_9PSED      MSQAPSVAIIGAGMSGLSAATRLQQAGLQVTLFDKSRGSGGRMSSKRTDLGTFDMGTQYF
                             : :  . ..   .  *   *    :  *.   .     :: :   :*:*:  *

RNLS_PSE14            TARDRRFATAVKQWQAQGHVSEWTPLLYNFHGGRLSPSPDEQVRWVG--EPGMSAITRAM
A0A0P9MY51_PSESX      TARDRRFATAVKQWQAQGHVAEWTPLLYNFHGGRLSPSPDEQVRWVG--EPGMSAITRAM
RNLS_PSESM            TARDRRFATAVKQWQAQGHVAEWTPLLYNFHAGRLSPSPDEQVRWVG--KPGMSAITRAM
W0H4A7_PSECI          TARDRRFVAAVNQWQAKGHVAEWTPSLYNFHGGRLSPSPDEQVRWVG--TPGMSAITRAL
Q4K6B1_PSEF5          TARDRRFVTEVQRWQAKGWVAEWTPQLYNSHGGQLSPSPDEQTRWVG--TPRMSAITRAL
G8QBV7_PSEF3          TARDRRFVTEVQRWQANGWAAEWNPQLYNFQNGQLSPSPDEQTRWVG--TPRMSAITRAL
A0A109LJZ0_PSEFL      TARDRRFVNEVQRWQSNGWAEQWKPQLYNFKSGQLTPSPDEQIRWVG--TPRMSAITRAL
L1LUN8_PSEPU          TARDRRFVEQVQHWQDKGWVAEWKPQLYNYRDGQLTPSPDEQTRWVG--VPRMSAITRGL
J8S161_PSEPU          TARDRRFVEQVQQS-GLPPVGPRNGSHSCTTTAMVNSAPPPTSRRAGWAVPRMSAITRGL
M4X0R1_9PSED          TARDRRFLDAIQKWREHGWVAEWDPALYQYRDGELSPSPDEQPRWVG--TPRMSAITRAL
A0A024HAZ0_PSEKB      TARDRRFLDAIQKWRDAGWVEEWDPALYQYRDGALSPSPDEQPRWVG--TPRMSAITRAL
Q9HVD5_PSEAE          TARDRRFLDALQHWREEGWVDEWKPALYQYRDGQLSPSPDEQPRWVG--IPRMSAITRAL
I4JJS0_PSEST          TARDRRFREALQHWQDEGWAAPWAPNLYLSRAGQLEPSTDEQLRWVG--TPQMASIARAL
A4VMG6_PSEU5          TARDRRFAETVRQWQAGGWVDQWTPTLFQSRDGQLSPSADEQLRWVG--TPTMSAITRGL
F6AAH1_PSEF1          TARDRRFAATVAQWQARGWVEPWTPNLYQYANGVLSPSADEQVRWVG--NPRMSAITRAM
C1DEU3_AZOVD          TCRDRRFAEAVQQWRDRGWIAEWQPSLYDSANGTLRPSQDEQIRWIG--TPRMSALTRGL
A0A0B3BXE1_9PSED      TARNAHFQAAVAQWQAAGWVAPWTPALYRHQDGHLLRVDNDTPRWVG--TPRMSALTRAL
K5Z6H2_9PSED          LAQDPAFLTTLADWTSAGSCAAW------------AAIDGPQPYWVG--TPRMSAISRAL
A0A1H1WCJ2_9PSED      TARDADFVAAVAQWRAEGWVAEWQPRLFRYDEQGLAASLDQQQRFVG--SPRMTALSRGL
                       .::  *   :                                   *   * *::::*.:

RNLS_PSE14            RGDLPVSFSCRITDVFRGEQHWNLLDAEGENHGPFSHVIIATPAPQATALLAAAPKLASV
A0A0P9MY51_PSESX      RGDLPVSFSCRITDVFRGEQHWNLLDAEGENHGPFSHVIIATPAPQATALLAAAPKLASV
RNLS_PSESM            RGDMPVSFSCRITEVFRGEEHWNLLDAEGQNHGPFSHVIIATPAPQASTLLAAAPKLASV
W0H4A7_PSECI          LDDLPVTFSCRITEVFRGEEHWNLQDADGNNHGPFSHVVIAIPAPQAATLLAAAPKLASV
Q4K6B1_PSEF5          IGDLEAHFACRITEVFRGEQHWHLQDAEGFTHGPFSHVVIATPAPQATALLAAAPKLAGV
G8QBV7_PSEF3          LDKLQVQFACRITEVYRGQEHWHLQDAEGFTHGPFGQVVIATPAPQATALLAAVPKLAAV
A0A109LJZ0_PSEFL      LDDLPVEFGCRITEVFQGTQHWNLLDADGGNHGPFSHVIIATPAPQATALLAAAPKLASA
L1LUN8_PSEPU          LKDVTVNFSCRISEVFRGKHYWHLQDTDGCSHGPFSRVIVAVPAPQATPLLAATPKLAAV
J8S161_PSEPU          LKDVTVNFGCRIAEVFRGKQYWHLQDTEGCSHGPYSRVVIAVPAPQATPLLAATPKLAAV
M4X0R1_9PSED          LQDQVVTFTCRITEVYRGEEHWHLQDSEGQTHGPYSRVLVATPAPQAAALLASAPKLAAA
A0A024HAZ0_PSEKB      LHDLPVTFSCRITEVFRGEQHWQLQDSEGQNHGPFSHVLIATPAPQAAALLSSAPKLAAA
Q9HVD5_PSEAE          LTDLQVVFSCRITEVFRGKQHWHLQDSEGQNHGPFNQVLIAIPAPQATPLLASVPKLAAT
I4JJS0_PSEST          LGDLPVTFSCRITEAFRGEELWTLVDANGASHGPFSQVIVATPAPQASALLAAAPKLAAV
A4VMG6_PSEU5          LGEMPVTFSCRITEVFRGEQYWTLVDATGASHGPFSHVIIALPAPQAAALLSGAPKLAAV
F6AAH1_PSEF1          LGALPVKFSCRITEVFRGEQHWHLLDAEGESHGPFAQVIIATPAPQASALLATAPKLAGT
C1DEU3_AZOVD          LGDMPVRFSCRITEVFHGKQHWMLQDADGKAYGPFNQVVVATPSPQAAQLLAAAPKLASS
A0A0B3BXE1_9PSED      LGDLPVRFNCRVTEIAASAGHWHLLDTDGNRHGPFSQVIVAVPAPQASALLGAAPSLAAR
K5Z6H2_9PSED          LGNLPAIFSCRISEVFRGERHWQLLDTAGASHGPFSHVIVALPAPQAGALLTAAPALAAR
A0A1H1WCJ2_9PSED      LGNLPLHSSTRIEQLQRIDQQWQLRDSADEQYGPFDRVIVAIPPAQALPLINDIAALADP
                                *: :       * * *: .  :**: :*::* *..**  *:   . **  

RNLS_PSE14            VAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPGRDDTLDSWVLHATSQ
A0A0P9MY51_PSESX      VAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPGRDDTLDSWVLHATSQ
RNLS_PSESM            VAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPERDDTLDTWILHATSQ
W0H4A7_PSECI          VTGVKMDPTWAVALAFSTPLQTPMQGCFVQDSPLDWLARNRSKPQRDDTLDTWVLHASSS
Q4K6B1_PSEF5          AAGVKMDPTWAVALAFDTPLETPMEGCFVQDSPLDWLARNRSKPGRDSHLDTWVLHATSA
G8QBV7_PSEF3          AAGVKMDPTWAVALAFEAPLDTPMEGCFVQDSPLDWLARNRSKPGRDSKLDTWVLHATSD
A0A109LJZ0_PSEFL      AAGVKMDPTWAIALAFDKPLDTPMEGCFVQDSPLDWLARNRSKPGRDTTLDTWVLHATSA
L1LUN8_PSEPU          VAGVQMEPTWAIALGFDTPLDTPMQGCFVQGCALDWLARNRSKPGRDEHLDTWVLHATSS
J8S161_PSEPU          AAGVQMEPTWAVALAFQTPLDTPMQGCFVQDNPLDWLARNRSKPGRDEQLDTWVLHATSD
M4X0R1_9PSED          AASIPMEPTWAVALAFREPLDTPVQGCFVHEGPLSWLASNHSKPGRDEQLDTWVLHAASG
A0A024HAZ0_PSEKB      AASIAMEPTWAVALGFAEQLQTPVQGCFIQEGPLTWMASNRCKPGRSEHMDTWVLHASSS
Q9HVD5_PSEAE          AASVVMEPTWAVALGFREVLDTPVQGCFVHGSPIAWLACNRSKPGRDTTLDTWVLHATSQ
I4JJS0_PSEST          AASVAMEPAWAVALGFSTPLPTEVEGCFVQDDALDWMARERSKPGRNGRLDTWVLHASNS
A4VMG6_PSEU5          AASVAMEPTWAVALGFATPLGTTLEGCFVQDDALDWIARNRSKPGRDGALDTWVLHATSS
F6AAH1_PSEF1          VAGVTMEPTWAVALAFAEPLQTPLEGCFVQDEVLDWTARNRSKPGRDASPDTWVLHASSS
C1DEU3_AZOVD          VASVAMEPNWAVALSFEQPLDTPVDGCFIQDSPLEWASRNHGKPGRASQPDTWVLQANSR
A0A0B3BXE1_9PSED      AASVSMHPTWAVALGFRQPLPSAVEACFVRGAPLDWLARTSSKPGRDSGMDSWVLHADSA
K5Z6H2_9PSED          AASVVMEPVWAVALGFAEALPGAQHSLRLDDEILQQATHDSAKPGRDNRLDSWVLHATAD
A0A1H1WCJ2_9PSED      AARSEMEPGWAVALGFSAPLELPLDAVFVRQGPLDWIARDASKPNRGS-AETWVLQSTPS
                      .:   *.* **:**.*   *    ..  :    :   :    ** *    ::*:*::   

RNLS_PSE14            WSRQNLDASREQVIEHLHGAFAELIDCAMPAPVFSLAHRWLYARPAGSHEWGALSDADLG
A0A0P9MY51_PSESX      WSRQNLDASREQVIEHLHGAFAELIDCAMPAPVFSLAHRWLYARPAGSHEWGALSDADLG
RNLS_PSESM            WSRQNLDASREQVIEHLHGAFAELIDCTMPAPVFSLAHRWLYARPAGAHEWGALSDADLG
W0H4A7_PSECI          WSRQHLDMPKEQVIEHLHGAFAELIDCPMPAPVFSQAHRWLYARPAGSHEWGALSDADLG
Q4K6B1_PSEF5          WSRQHIDLSKEAVTEQLHGAFAELLHSVMPAPTFSLAHRWLYARPATSHEWGALADADLG
G8QBV7_PSEF3          WSRQHIDLSKEAVIEHLHGAFAELLHSAMPAPSFSVAHRWLYARPAGSHEWGALADADLG
A0A109LJZ0_PSEFL      WSKAHLDLPKEAVIEHLHGAFAELLHSAMPAPSFS----WRTVGSTRAHR----AAMNSA
L1LUN8_PSEPU          WSKQHIDLHKEAVIEQLLGDFAELVGCAVPAPSFTLAHRWLYARPAGSHEWGVLADADQG
J8S161_PSEPU          WSRQHIDLPKEEVIEQLWGEFAELVGCVVPAPTFALAHRWLYARPSSNHEWGALADADQG
M4X0R1_9PSED          WSKQHIDLPKESVIEHLRGAFAELIGCAVHAPDFALAHRWLYARPMEAHQFGALADADLG
A0A024HAZ0_PSEKB      WSRQNIDKPKEEVIEHLYGAFAEMIGCAVPAPVFALAHRWLYARPLEPRQLGALNDADLG
Q9HVD5_PSEAE          WSRQHIDMAKEDVVEHLRCAFAEVIGCAVPEAAFSIAHRWLYARPAEAHQWGALGDPDLG
I4JJS0_PSEST          WSRQHLDLSKEAVSEQLLGAFAELIDCVVPAPEFTLAHRWLYARPAQTHEWGALADAGLG
A4VMG6_PSEU5          WSRQHLDLSKEAVIERLHGAFAELIDCVVPAPEFTLAHRWLYARPAQAHEWTALADAGLG
F6AAH1_PSEF1          WSRQHLDLAKEQVVERLHGAFAEMIGCAVPAPVFSLAHRWLYARPSGAHQLGALADADLG
C1DEU3_AZOVD          WTRQYLDLAKDQVIEQLYGAFAEMIGCTVPEPVFSLAHRWLYGRPVGSHGWGALADSSLG
A0A0B3BXE1_9PSED      WSERHRELPATQVIARLYDAFAATIDCPLPPSDFSLAHRWLYARPAQPLSPGVLADPEVG
K5Z6H2_9PSED          WTRQHLELPKEAVIDRLAHAFAERLGQRLPPAEFTLAHRWLYAYSARRTDWGALGDQQQG
A0A1H1WCJ2_9PSED      WAAAHLESEPHAVVEELLSALQAVVGAPLPAPTFQHAHRWLYARPAALSDWGALAAPAQG
                      *:    :     *  .*   :   :   :  . *     *    .              .

RNLS_PSE14            IYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQ-
A0A0P9MY51_PSESX      IYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQ-
RNLS_PSESM            IYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQ-
W0H4A7_PSECI          IYVCGDWCLSGRVEGAWLSGQEAARRLLEHLK-
Q4K6B1_PSEF5          LYVCGDWCLSGRVEGAWLSGQEAARRLHESLQ-
G8QBV7_PSEF3          LYVCGDWCLSGRVEGAWLSGQEAARRLHASLQ-
A0A109LJZ0_PSEFL      CWPTPTWACSSVVTGASPAGWKVPG--------
L1LUN8_PSEPU          LYACGDWCLSGRVEGAWLSGQEAARRLIEHLE-
J8S161_PSEPU          LYACGDWCLSGRVEGAWLSGQEAARRLLEHLE-
M4X0R1_9PSED          IYACGDWCLSGRVEGAWLSGLEAARRLLEHL--
A0A024HAZ0_PSEKB      IYACGDWCLSGRVEGAWLSGLEAARRLLEHI--
Q9HVD5_PSEAE          IYACGDWCSSGRVEGAWLSGQEAARRLLEHL--
I4JJS0_PSEST          LYACGDWCLSGRVEGAWLSGQEAARRLLEHL--
A4VMG6_PSEU5          LYACGDWCLSGRVEGAWLSGQEAARRLLENL--
F6AAH1_PSEF1          LYVCGDWCLSGRVEGAWLSGQEAARKLIAHNQ-
C1DEU3_AZOVD          LYACGDWCLSGRVEGAWLSGQAVARKLLQHRAS
A0A0B3BXE1_9PSED      LYACGDWCRSGRVEDAWLSGRDAALQLLERS--
K5Z6H2_9PSED          LFACGDWCLDGTVEGAWRSGQQAAQLLLASL--
A0A1H1WCJ2_9PSED      VYVCGDWCLGGRLEAAWLSGQHAAKALLETA--
                       :    *. .. :  *  :*  ..